2015 Biomass Industry Directory

transcript

Steam Boilershot water

Gas, Oil, Wood, Biomass, Coal, and Solid

Hurst Boiler & Welding Company has been designing, engineering and servicing a complete line of solid fuel, solid waste, biomass,

hot water boilers since 1967, for

Hurst also manufactures acomplete line of boiler room

peripherals such as blowdown separator surge tanks, and

pressurized make-up

DIGESTER GASNATURAL GASMETHANEBIO GASOILCOALSLUDGEBIOMASSSOLID WASTE

Join the Conversation

2015 Biomass Industry Directory | 3

Fifth EditionJanuary 2015

Published byBBI International308 Second Ave. N., Suite 304Grand Forks, ND 58203phone: (701) 746-8385fax: (701) 746-5367

BiomassIndustry Directory2015

directory.biomassmagazine.com

4 | 2015 Biomass Industry Directory

Contents

2015 U.S. BIOMASS POWER PLANT LIST 6

2014 U.S. & CANADA PELLET MILL LIST 9

AG PRODUCTS & SERVICES 14

Feedstock Collection Systems 14

Feedstock Procurement 14

ASSOCIATIONS & ORGANIZATIONS 14

CONFERENCES/TRADE SHOWS & MEETINGS 15

DENSIFICATION & SIZE REDUCTION 15

Balers - Industrial 15

Briquetting 16

Chippers - Brush 16

Chippers - Whole Log 16

Grinders - Horizontal 16

Grinders - Tub 16

Grinders - Vertical 17

Mills - Hammer 17

Pellet Mills 17

Pyrolysis 17

Torrefaction 17

EDUCATION 18

EMPLOYMENT 18

Executive Search 18

ENGINEERING & CONSTRUCTION 19

Anaerobic Digestion Systems 19

Biomethane 19

Buildings 19

Civil Engineering 19

CHP Systems 19

Detailed Design 21

District Heating Systems 21

Electrical 21

EPC 21

Fabrication 21

Gasifi ers 21

Information Technology Services 22

Management Services 22

Piping 22

Plant Optimization 22

Power Plant Construction 22

Pyrolysis 22

Stacks 22

Structural Fabrication 22

Torrefaction 22

Water Treatment 22

FEEDSTOCK SUPPLY 22

Biomass Based Fuel Oil 22

Briquettes 22

Dedicated Energy Crops 22

Pellets 22

Wood Chips 23

Wood Residues 23

LEGAL SERVICES 23

Attorney 23

Intellectual Property 23

MATERIAL HANDLING & STORAGE 25

Bucket Loader 25

Conveyor - Belt 25

Conveyor - Drag 25

Conveyor - Enclosed 25

Conveyor - Mechanical 25

Conveyor - Pneumatic 26

Conveyor - Screw 26

Cranes - Overhead 26

Dryer - Conveyor 26

Dryer - Flash 26

Dryer - Ring 26

Dryer - Rotary Drum 26

Dryer - Spray 27

Dryer - Steam Tube 27

Elevator-Bolts 27

Elevator-Buckets 27

Import/Export Services 27

Loading Equipment 27

Railcar - Moving 27

Scale - Bulk Weigh 27

Scale - Software 27

Screens - Disc 27

Screens - Disc Scalping 27

Screens - Fines 27

Screens - Other 28

Specialty Parts and Equipment 28

Stockyard Equipment 28

Storage-Bins 28

Storage-Other 28

Storage-Silos 28

Storage - Silo Reclaimer 29

Trailer - Moving Floor 29

Transportation - Barge 29

Transportation - Rail 29

Transportation - Truck 29

Truck Receiving/Dumpers 29

Vibration Equipment 29

MEDIA 30

Publications 30

PROCESS EQUIPMENT & SERVICES 30

Air Pollution Control 30

Binders & Surfactants 31

Biogas-Capture 31

Biogas-Purifi cation 31

Boilers - Direct Fired 31

Boilers - Firetube 32

Boilers - Fluidized Bed 32

Boilers - Hot Water 32

Boilers - Parts & Service 32

Boilers - Solid Fuel 33

Boilers - Steam 33

Boilers - Waste Heat Recovery 33

Centrifuges 33

CIP 33

Cleaning 33

Combustion Equipment 33

Condensors 33

Control Systems 33

Cooling Towers 34

Digester-Covers 34

Dust Control - Baghouses 34

Dust Control - Inertial Separators 34

Dust Control - Unit Collectors 35

Dust Control - Wet Scrubbers 35

Energy Management 35

Environmental Testing 35

Fans 35

Filters 35

Fire Protection 35

Furnaces 35

Generator - Diesel / Biodiesel 36

Generator - Natural Gas/Biogas 36

Generator - Steam Turbine 36

Heat Exchangers - Direct Contact 36

Heat Exchangers - Phase-Change 36

Heat Exchangers - Shell & Tube 36

Heat Exchangers - Waste Heat Recovery Unit 36

Hoppers 36

Instrumentation 36

Laboratory Equipment 36

Laboratory Services 36

Lubricants 37

Mixers/Agitators 37

Moisture Analyzers 37

Operations & Maintenance 38

Pipe 38

Pipe-Fittings 38

Pipe-Flanges 38

Pumps 38

Safety 38

Sensors 38

Separators 38

Separators-Magnetic 38

Valves 39

VOC Scrubbers 39

Wastewater Treatment 39

Water Treatment 39

PROJECT DEVELOPMENT & FINANCE 39

Accounting 39

Business Plans 39

Debt Financing 39

Due Diligence 39

Economic Development 39

Feasibility Studies 39

Feedstock Pricing 40

Insurance 40

Market Data 40

Mergers & Aquisitions 40

Permitting - Air 40

Permitting - Other 41

Risk Management 41

Site Selection 41

Software - Accounting 41

RESEARCH & DEVELOPMENT 41

Government 41

Private 41

University 42

ADVERTISER INDEX 44

COMPANY INDEX 45

A POWERFUL

for Biomass Power Plants

RESOURCE

With increasingly high demand for cleaner sources of energy, Babcock Power and its family of advanced technology companies have assembled a team of industry experts in biomass conversion and new plant technology.

With a strength of over 100 years of steam generating equipment experience, the Babcock companies have established themselves as market leaders in planning, designing, fabricating, constructing and commissioning state-of-the-art chute to stack technology.

With proven results of optimum performance and cost-saving ef ciency, this team of elite professionals provides customers with advanced stoker technology boilers, cutting-edge air quality control systems and innovative modular designs.

Contact the Babcock Power professionals at www.babcockpower.com, your single source provider of renewable energy project solutions.

www.babcockpower.com

14488_Biomass_Mag_Full_Pg_Ad.indd 1 12/9/14 11:48 AM

Color Key

Existing Under Construction Proposed Idled

U.S. Biomass Power Facilities List

Abengoa Bioenergy Abengoa Bioenergy Biomass of Kansas LLC Hugoton, KS 21 Yes No Cellulosic ethanol byproductAkeida Capital Management Ampersand Chowchilla Biomass LLC Chowchilla, CA 12.5 No No Agricultural wastesAmador Biomass LLC Buena Vista Biomass Power Ione, CA 18 No No Woody biomassAmeresco Inc. Savannah River Site Biomass Cogeneration Facility Aiken, SC 20 Yes No Forest residueArlington County/ City of Alexandria Covanta Alexandria/Arlington Alexandria, VA 23 No No MSWAvista Corp. Kettle Falls Generating Station Kettle Falls, WA 53.4 No No Logging and mill residueBiomass One LP (Parent) Biomass One White City, OR 30 No No Woody biomassBlueFire Renewables Inc. BlueFire Renewables Fulton LLC Fulton, MS 25 Yes No Wood wasteBoise Cascade LLC Medford Operation Medford, OR 11 Yes No Mill residue Boralex Boralex Sherman LLC Stacyville, ME 18 No No Woody biomassBridgewater Power Co. LP Bridgewater Power LP Plymouth, NH 15 No No Woody biomassBurlington Electric Department Joseph C McNeil Generating Station Burlington, VT 59.5 No No Forest and mill residues, local wood wasteBurney Forest Products Burney Forest Power Burney, CA 31 Yes No Logging and mill residueCaletta Renewable Energy Palmer Renewable Energy Springfield, MA 35 No No Wood chipsCalifornia Ethanol & Power LLC California Ethanol & Power LLC Imperial Valley, CA 49.9 Yes No BagasseCapital Power Corp. CPI USA North Carolina LLC Southport, NC 55 Yes Yes Wood residuals, TDFCapital Power Corp. Roxboro Facility Roxboro, NC 67.5 Yes Yes Wood, TDFCate Street Capital Burgess BioPower Berlin, NH 75 No No Woody biomassCity and County of Honolulu Covanta Honolulu Resource Recovery Venture Kapolei, HI 90 No No MSWCity of Long Beach Covanta Long Beach Renewable Energy Long Beach, CA 36 No No MSWCity of Perham Perham Resource Recovery Facility Perham, MN 4.5 Yes No MSWCity of Spokane Wheelabrator Spokane Inc. Spokane, WA 26 No No MSWCity of Tampa Wheelabrator McKay Bay Inc. Tampa, FL 22 No No MSWCMS Energy Craven County Wood Energy New Bern, NC 50 No No Mill residueCMS Energy Genesee Power Station LP Flint, MI 40 No No Wood waste, animal beddingCMS Energy Grayling Generating Station Grayling, MI 38 No No Mill residue, TDFCollins Company Collins Pine Company Kane, PA 12 Yes No Woody biomassConnecticut Resources Recovery Authority Covanta SECONN Preston, CT 18 No No MSWConnecticut Resources Recovery Authority Mid-Conn. Resource Recovery Facility Hartford, CT 68 No No MSWConnecticut Resources Recovery Authority Wheelabrator Bridgeport LP Bridgeport, CT 67 No No MSWConstellation NewEnergy Albany Green Energy Albany, GA 50 Yes No Woody biomassCovanta Covanta Babylon Inc. West Babylon, NY 17 No No MSWCovanta Covanta Bristol Inc. Bristol, CT 16.3 No No MSWCovanta Covanta Burney Mountain Power Burney, CA 11.4 No No Woody biomassCovanta Covanta Camden Energy Recovery Center Camden, NJ 21 No No MSWCovanta Covanta Delano Delano, CA 58 No No Orchard and vineyard wasteCovanta Covanta Delaware Valley LP Chester, PA 80 No No MSWCovanta Covanta Essex Company Newark, NJ 65 No No RDFCovanta Covanta Fairfax Inc. (I-95 Energy) Lorton, VA 80 No No MSWCovanta Covanta Haverhill Inc. Haverhill, MA 49 No No MSWCovanta Covanta Hempstead Company Westbury, NY 80 No No MSWCovanta Covanta Hennepin Energy Resource Co. LP Minneapolis, MN 40 No No MSWCovanta Covanta Huntington LP East Northport, NY 25 No No MSWCovanta Covanta Indianapolis Inc. Indianapolis, IN 7 Yes No MSWCovanta Covanta Jonesboro Power Station J onesboro, ME 24.5 No No Logging and mill residueCovanta Covanta Lake Inc. Okahumpka, FL 15 No No MSWCovanta Covanta Marion Inc. Brooks, OR 13 No No MSWCovanta Covanta Mendota Mendota, CA 25 No No Orchard and vineyard wasteCovanta Covanta Mount Lassen Power Westwood, CA 12 No No Forest thinning residueCovanta Covanta Niagara Company Niagara Falls, NY 30 No No MSWCovanta Covanta Onondaga LP Jamesville, NY 40 No No MSWCovanta Covanta Pacific Oroville Power Oroville, CA 17 Yes Yes Forest residue, RDFCovanta Covanta Pacific Ultrapower Chinese Station Jamestown, CA 19.8 No No Woody biomassCovanta Covanta Pittsfield Inc. Pittsfield, MA 4 Yes No MSWCovanta Covanta Plymouth Renewable Energy Ltd. Conshohocken, PA 32 No No MSWCovanta Covanta Projects of Wallingford LP Wallingford, CT 11 No No MSWCovanta Covanta SEMASS LP West Wareham, MA 54 No No MSWCovanta Covanta Springfield LLC Agawam, MA 9 No No MSWCovanta Covanta Stanislaus Inc. Crows Landing, CA 22.5 No No MSWCovanta Covanta Warren Energy Resource Co. LP Oxford, NJ 14 No No MSWCovanta Covanta WBH LLC Tulsa, OK 17 No No MSWCovanta Covanta West Enfield West Enfield, ME 25 No No Forest and mill residueD.R. Johnson Lumber Company Riddle Facility Riddle, OR 7.5 Yes No Woody biomassDominion Virginia Power Altavista Power Station Altavista, VA 50 No No Wood waste, slash, other biomassDominion Virginia Power Hopewell Power Station Hopewell, VA 50 No No Wood WasteDominion Virginia Power Pittsylvania Power Station Hurt, VA 83 No No Logging residueDominion Virginia Power Southampton Power Station Franklin, VA 50 No No Wood WasteDTE Energy DTE Stockton LLC Stockton, CA 45 Yes No Woody biomass, agricultural residuesDTE Energy Services DTE Stoneman Station Cassville, WI 40 No No Woody biomassDTE Energy Services Woodland Biomass Power Ltd. Woodland, CA 28 No No Woody biomassDutchess County Resource Recovery Agency Covanta Hudson Valley Renewable Energy LLC Poughkeepsie, NY 9 No No MSWEast Texas Electric Cooperative Woodville Renewable Power Woodville, TX 49 No No Woody biomassEastern Connecticut Resource Recovery Authority Wheelabrator Lisbon Inc. Lisbon, CT 15 No No MSWEcomaine (Parent) Ecomaine (Biomass Power Plant) Portland, ME 14 No No MSWecoPower ecoPower - Hazard Chavies, KY 58 No No Woody biomassEDF Renewable Energy EDF-RE Allendale Allendale, SC 17.8 No No Forestry wood wasteEDF Renewable Energy Pinelands Biomass - Dorchester Harleyville, SC 35.6 No No Logging ResidueEnergy Investor Funds Greater Detroit Resource Recovery Facility Detroit, MI 68 No No MSWEnergy Management Inc. Gainesville Renewable Energy Center Gainesville, FL 102.5 No No Woody biomassEnpower Corp. Wadham Energy LP Williams, CA 26.5 No No Rice hullsEscanaba Green Energy LLC Escanaba Generating Station Escanaba, MI 23 Yes Yes Wood waste and TDFEvergreen BioPower LLC (Parent) Evergreen Biopower LLC Lyons, OR 10 Yes No Mill residueEvergreen Clean Energy Eagle Valley Clean Energy Gypsum, CO 11.5 Yes No Forest restoration residueEver-Green Energy LLC St. Paul Cogeneration LLC St. Paul, MN 37 Yes No Urban tree wasteEWP Renewable Corp. DG Fairhaven Power Samoa, CA 18.8 No No Woody biomassEWP Renewable Corp. DG Whitefield LLC (Biomass Power Plant) Whitefield, NH 19 No No Woody biomassEWP Renewable Corp. Springfield Power LLC Georges Mills, NH 19 No No Woody biomass

LOCATIONCOMPANY PLANT NAMENAMEPLATECAPACITY (MW) CHP CAPABILITY

COFIRE COAL FUEL FEEDSTOCK

U.S. Biomass Power Facilities List

Florida Biomass Energy LLC Florida Biomass Energy LLC Bradenton, FL 60 No No Woody biomass vegetative wasteFlorida Crystals New Hope Power, Co. South Bay, FL 128.9 Yes No Bagasse, woodFortistar Hillman Power LLC Hillman, MI 20 No No Wood waste & TDFGDF Suez Energy North America Inc. Pinetree Power - Bethlehem Bethlehem, NH 16.2 No No Forest and logging residueGDF Suez Energy North America Inc. Pinetree Power - Tamworth Tamworth, NH 25 No No Woody biomassGDF Suez Energy North America Inc. Pinetree Power - Westminster Westminster, MA 17 No No Woody biomassGDF Suez Energy North America Inc. Ryegate Power Station East Ryegate, VT 20.5 No No Whole tree chipsGDF Suez Energy North America Inc. Viking Energy of Lincoln Lincoln, MI 16 No No RDF, natural gasGDF Suez Energy North America Inc. Viking Energy of McBain McBain, MI 18 No No Wood waste and TDFGDF Suez Energy North America Inc. Viking Energy of Northumberland Northumberland, PA 16 Yes No Woody biomassGrays Harbor Paper LP Grays Harbor Paper LP - Powerhouse Hoquiam, WA 14 Yes No Paper mill sludgeGreat River Energy Elk River Energy Recovery Station Elk River, MN 29 No No MSWGreenleaf Power LLC Desert View Mecca, CA 48 Yes No Agricultural residue , urban wood wasteGreenleaf Power LLC Eel River Plant Scotia, CA 28 Yes No Logging and mill residueGreenleaf Power LLC Honey Lake Wendel, CA 36.2 No No Mill and logging residue, urban wood wasteGreenleaf Power LLC Tracy Biomass Tracy, CA 21.5 No No Woody biomassHarrisburg Authority Covanta Harrisburg Inc. Harrisburg, PA 24 Yes No MSWHawaiian Commercial & Sugar Co Ltd (Parent) Hawaiian Commercial & Sugar Puunene Mill Puunene, HI 46.1 Yes Yes BagasseHillsborough County Solid Waste Department Covanta Hillsborough Inc. Tampa, FL 47 No No MSWHoge Lumber Co Hoge Lumber New Knoxville, OH 3.7 Yes No Mill residueHomeland Renewable Energy Inc. Fibrominn Biomass Power Plant Benson, MN 50 No No Poultry litter, agricultural residueHu Honua Bioenergy LLC Hu Honua Bioenergy Facility Pepeekeo, HI 24 No No Eucalyptus and other biomassIberdrola Renewables Lakeview Power Plant Lakeview, OR 35 Yes No Logging and mill residueIndeck Energy Services Inc. Indeck Energy - Alexandria LLC Alexandria, NH 16 No No Wood wasteINEOS Bio INEOS - Indian River Bioenergy Center Vero Beach, FL 6 Yes No Vegetative waste, ag waste, MSWInventivEnergy LLC Aspen Biomass Power Plant Lufkin, TX 44 No No Logging and mill residue, urban wood wasteIslip Resource Recovery Agency Covanta MacArthur Renewable Energy Inc. Ronkonkoma, NY 12 No No MSWKapStone Kraft Paper Corp. Longview Fibre Longview, WA 55 Yes No Mill residueKauai Island Utility Cooperative Green Energy Team LLC Koloa, Kauai, HI 6.7 Yes No Woody biomassKent County Covanta Kent Inc. Grand Rapids, MI 18 No No MSWKoppers Inc. Koppers Susquehanna Plant Montgomery, PA 7.5 Yes No Waste creosote-treated woodLaidlaw Energy Group Inc Susanville Biomass Facility Susanville, CA 14 No No Forest residueLancaster County Solid Waste Authority Covanta Lancaster Inc. Bainbridge, PA 36 No No MSWL’Anse Warden Electric Company L’Anse Warden L’Anse, MI 20 Yes No RDFLeaf Clean Energy Company Multitrade Telogia Bristol, FL 14 No No Logging and mill residue, peanut hullsLee County Solid Waste Authority Covanta Lee Inc. Ft. Myers, FL 57 No No MSWLeidos Holdings Inc. Plainfield Renewable Energy Plainfield, CT 37.5 No No C&D WasteLeucadia National Corporation Imperial Valley Resource Recovery Imperial, CA 18.1 No No Wood waste and ag residueLos Angeles County Sanitation Districts Commerce Refuse-to-Energy Facility Commerce, CA 11.5 No No MSWMacpherson Energy Corporation Mt. Poso Cogeneration Company LLC Bakersfield, CA 44 Yes No Orchard waste, urban wood wasteMaple Island FH Stoltze Land & Lumber Columbia Falls, MT 3 Yes No Mill residueMaryland Environmental Service Eastern Correctional Institute Cogeneration Plant Westover, MD 3.8 Yes No Woody biomassMiami-Dade County Covanta Dade Renewable Energy Doral, FL 77 No No MSWMid-Maine Waste Action Corp. MMWAC Resource Recovery Facililty Auburn, ME 3.6 No No MSWMinnesota Power Hibbard Energy Center Duluth, MN 72.8 Yes Yes Cellulose mattresses fill and other RDFMinnesota Power Rapids Energy Center Grand Rapids, MN 26.5 No Yes Logging and mill residue Nippon Paper Industries USA NPI USA Co-Generation Facility Port Angeles, WA 20 Yes No Logging and mill residueNorth American Power Group Rio Bravo Fresno Fresno, CA 28 No No Woody biomassNorth American Power Group Rio Bravo Rocklin Lincoln, CA 28 No No Woody biomassNortheast Maryland Wast Disposal Authority Covanta Montgomery Inc. Dickerson, MD 55 No No MSWNortheast Maryland Waste Disposal Authority Wheelabrator Baltimore LP Baltimore, MD 64.5 Yes No MSWNovo Power LLC Novo BioPower LLC Snowflake, AZ 27 Yes No Forest thinning, mill residueNRG Energy Inc. Montville Generation Station Uncasville, CT 40 No No Woody biomassOlmsted County Environmental Resources Olmsted Waste-To-Energy Facility Rochester, MN 9.6 Yes No MSWOswego County Solid Waste Authority Oswego County Energy Recovery Facility Fulton, NY 3.6 No No MSWPasco County Covanta Pasco Inc. Spring Hill, FL 31.2 No No MSWPatriarch Partners LLC Old Town Fuel & Fiber Old Town, ME 28.5 Yes No Mill residuePecan Row Landfill Pecan Row Landfill Valdosta, GA 4.8 No No MSW, biogasPhoenix Energy Cabin Creek Biomass Energy Facility Truckee, CA 2 No No Woody biomassPinellas County Utilities Pinellas County Resource Recovery Facility St. Petersburg, FL 75 No No MSWPSNH - Public Service of New Hampshire Northern Wood Power Portsmouth, NH 50 No Yes Woody biomassReEnergy Holdings LLC ReEnergy Ashland Ashland, ME 40 No No Woody biomassReEnergy Holdings LLC ReEnergy Black River Fort Drum, NY 60 No No Woody biomass, TDFReEnergy Holdings LLC ReEnergy Fort Fairfield Fort Fairfield, ME 37 No No Woody biomassReEnergy Holdings LLC ReEnergy Livermore Falls Livermore Falls, ME 40 No No Woody biomassReEnergy Holdings LLC ReEnergy Lyonsdale Lyons Falls, NY 22 Yes No Woody biomassReEnergy Holdings LLC ReEnergy Sterling Sterling, CT 36 No No Woody biomass, TDFReEnergy Holdings LLC ReEnergy Stratton Stratton, ME 48 No No Woody biomassReVenture Park ReVenture Park Charlotte, NC 1.4 Yes No Wood chips, sawdustRio Grande Valley Sugar Growers Inc. Rio Grande Valley Sugar Growers Santa Rosa, TX 23.5 Yes No BagasseRiverstone Holdings Coastal Carolina Clean Power Kenansville, NC 35 Yes No Woody biomassRobbins Lumber Inc. Robbins Lumber Searsmont, ME 1.2 Yes No Woody biomassRockTenn RockTenn - Tacoma Tacoma, WA 64 Yes No Mill residueRollcast Energy Inc. Cadillac Renewable Energy Cadillac, MI 44 No No Forest residueRollcast Energy Inc. Piedmont Green Power Barnesville, GA 60.5 No No Woody biomassRoseburg Forest Products Dillard Complex Roseburg, OR 51.5 Yes No Woody biomassSappi Fine Paper North America S D Warren Westbrook Westbrook, ME 62.5 Yes Yes Mill residue, BLQ, TDFSappi Fine Paper North America Sappi Cloquet Mill Cloquet, MN 60.7 Yes No Mill residueSappi Fine Paper North America Somerset Plant Skowhegan, ME 116.9 Yes Yes Mill residueSauder Woodworking Co. Sauder Power Plant Archbold, OH 7 Yes No Mill residueSDS Lumber Co. SDS Lumber Gorge Energy Division Bingen, WA 10 Yes No Logging and mill residueSeneca Sawmill Company Seneca Sustainable Energy Eugene, OR 19.8 Yes No Forest and mill residueShakopee Mdewakanton Sioux Community Koda Energy LLC Shakopee, MN 23.4 Yes No Agricultural residue, urban tree wasteShasta Renewable Shasta Renewable Anderson, CA 5.5 No No Woody biomassSierra Pacific Industries Sierra Pacific - Aberdeen Aberdeen, WA 18 Yes No Logging and mill residueSierra Pacific Industries Sierra Pacific - Anderson Anderson, CA 5 Yes No Logging and mill residueSierra Pacific Industries Sierra Pacific - Burlington Mount Vernon, WA 28 Yes No Logging and mill residue

Note: Plant map data as of October 23, 2014

The map indicates electricity generation plants that:

-have the ability to supply all or a portion of their power to the grid

-use greater than 40% biomass by volume in annual fuel mix

-have a nameplate capacity equal to or greater than 1 MW

To add a plant to this map email sstucko@bbiinternational.com

Color Key

Sierra Pacific Industries Sierra Pacific - Burney Burney, CA 20 Yes No Logging and mill residueSierra Pacific Industries Sierra Pacific - Lincoln Lincoln, CA 18 Yes No Woody biomassSierra Pacific Industries Sierra Pacific - Loyalton Loyalton, CA 20 Yes No Mill residueSierra Pacific Industries Sierra Pacific - Quincy Quincy, CA 27.5 Yes No Mill residueSierra Pacific Industries Sierra Pacific - Sonora Sonora, CA 7.5 Yes No Logging and mill residueSmurfit-Stone Container Corp. Stone Container Panama City Mill Panama City, FL 34 Yes No Paper mill wasteSnider Industries Inc. Snider Industries Marshall, TX 5 Yes No Woody biomassSolid Waste Authority of Palm Beach Palm Beach Renewable Energy #1 West Palm Beach, FL 62.3 No No MSWSolid Waste Authority of Palm Beach Palm Beach Renewable Energy #2 West Palm Beach, FL 100 No No MSWSouth Boston Energy LLC NOVEC Energy Production, Halifax County Biomass South Boston, VA 49.9 No No Forest residueSoutheast Renewable Fuels LLC. Southeast Renewable Fuels LLC - Clewiston Clewiston, FL 25 Yes No Cellulosic ethanol byproductSouthern Power Company Southern Co. Nacogdoches Generating Facility Sacul, TX 100 No No Forest and mill residue, MSWSP Newsprint Company SP Fiber Technologies - Newberg Newberg, OR 30 Yes No Logging and mill residueStimson Lumber Company Plummer Cogen Plummer, ID 6 Yes No Wood wasteTamarack Energy Inc. Tamarack Energy Partnership New Meadows, ID 6.2 Yes No Wood wasteTaylor Biomass Energy LLC TBE-Montgomery LLC Montgomery, NY 20 No No MSW, C&D and wood wasteTelogia Power Telogia Power Telogia, FL 14 No No Logging and mill residue, peanut hullsThe Powell Group Agrilectric Power Partners Ltd. Lake Charles, LA 12.1 No No RDFThermagen Power Group LLC Fox Valley Clean Energy Center Northfield, IL 7 Yes No Paper mill sludgeU.S. EcoGen LLC U.S. EcoGen Clay Generating Facility Green Cove Springs, FL 63 No No Eucalyptus grandisU.S. EcoGen LLC U.S. EcoGen Martin Generating Facility Indiantown, FL 63 No No Eucalyptus grandisU.S. EcoGen LLC U.S. EcoGen Okeechobee LLC Okeechobee, FL 63 No No Eucalyptus grandisU.S. EcoGen LLC U.S. EcoGen Polk LLC Fort Meade, FL 63 No No Eucalyptus grandisUnion County Utilities Authority Covanta Union Inc. Rahway, NJ 44 No No MSWUnited States Sugar Corp Clewiston Sugar Factory Clewiston, FL 70.6 Yes No BagasseUS Renewables Group Niagara Generation LLC Niagara Falls, NY 56 No Yes Wood waste, TDF, petroleum cokeUSA Energy Group LLC Penobscot Energy Recovery Orrington, ME 25 No No MSW, woody biomassWarm Springs Forest Products Industries Warm Springs Forest Products Warm Springs, OR 9 Yes No Mill residueWasatch Integrated Waste Management District Wasatch Integrated Energy Recovery Layton, UT 1.6 No No MSWWe Energies Rothschild Biomass Cogeneration Plant Rothschild, WI 50 Yes No Urban wood waste, mill residueWheelabrator Technologies Inc. Wheelabrator Claremont Company LP Claremont, NH 5 No No MSWWheelabrator Technologies Inc. Wheelabrator Concord Company LP Concord, NH 14 No No MSWWheelabrator Technologies Inc. Wheelabrator Falls Inc. Morrisville, PA 53.3 No No MSWWheelabrator Technologies Inc. Wheelabrator Gloucester Company LP Westville, NJ 14 No No MSWWheelabrator Technologies Inc. Wheelabrator Hudson Falls LLC Hudson Falls, NY 15 No No MSWWheelabrator Technologies Inc. Wheelabrator Millbury Inc. Worcester, MA 46 No No MSWWheelabrator Technologies Inc. Wheelabrator North Andover Inc. North Andover, MA 40 No No MSWWheelabrator Technologies Inc. Wheelabrator North Broward Inc. Pompano Beach, FL 68 No No MSWWheelabrator Technologies Inc. Wheelabrator Portsmouth Portsmouth, VA 60 Yes No MSWWheelabrator Technologies Inc. Wheelabrator Ridge Energy Inc. Auburndale, FL 50 No No Wood waste, TDF and landfill gasWheelabrator Technologies Inc. Wheelabrator Saugus Inc. Saugus, MA 38 No No MSWWheelabrator Technologies Inc. Wheelabrator Shasta Energy Co. Inc. Anderson, CA 50 No No Logging, mill and agricultural residue Wheelabrator Technologies Inc. Wheelabrator South Broward Inc. Davie, FL 66 No No MSWWheelabrator Technologies Inc. Wheelabrator Westchester LP Peekskill, NY 59.7 No No MSWXcel Energy Bay Front Power Plant Ashland, WI 40 No No Wood waste, RR tiesXcel Energy French Island Generating Plant La Crosse, WI 30.4 No No RDF, Wood waste, RR tiesXcel Energy Red Wing Red Wing, MN 20 No No RDF, WoodXcel Energy Wilmarth Generating Station Mankato, MN 20 No No RDF, WoodYork County Solid Waste Authority Covanta York Renewable Energy LLC York, PA 36.5 No No MSW

Total Existing Nameplate Capacity (MW) 6,580Total Under Construction Nameplate Capacity (MW) 201Total Proposed Nameplate Capacity (MW) 555

Color Key

U.S. Biomass Power Facilities List (continued)

Source: Biomass Magazine / BBI International

Please contact Steve Stucko, Data & Content Manager, with questions or comments regarding the 2015 Biomass Power List at sstucko@bbiinternational.com.

CHP: Combined heat and power, RDF: Refuse derived fuel, C&D: Construction and demolition, RR: Railroad

Agri Fibers Inc.Alexander Energy Inc.Allegheny Pellet CorporationAmerican Pellet CompanyAmerican Wood Fibers - CirclevilleAmerican Wood Fibers - MarionAmerican Wood Fibers - WisconsinAppalachian Wood PelletsArbor PelletAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest Products - Cascade LocksBear Mountain Forest Products - BrownsvilleBearlodge Forest ProductsBeaver Wood EnergyBiomass Power Louisiana LLCDry Creek ProductsPA PelletsBlue Mountain Lumber ProductsBlueFire Renewables Fulton LLCNew Biomass EnergyThermogen IndustriesConfl uence Energy - KremmlingConfl uence Energy - WaldenCorinth Wood PelletsCurran Renewable EnergyDeadwood BiofuelsDejno’s Inc.Dover Resources, Inc.Morehouse BioEnergyAmite BioEnergyEnergex Pellet Fuel, Inc.Enginuity WorldwideEnova Energy Group - NahuntaEnova Energy Group - GordonEnova Energy Group - WarrentonEnova Energy Group - JohnstonBiomass Energy LLCEnviro Energy Environmental Energy PartnersEnviva Pellets AmoryEnviva Pellets WigginsEnviva Pellets AhoskieEnviva Pellets Northampton, LLCEnviva Pellets Southampton, LLCEquustock - MontebrookEquustock - ClareEquustock - ChesterEquustock - TroyEssex Pallet & PelletF.E. Wood & Sons - Natural EnergyFiber By-Products - White PigeonFiber Energy Products ARFiber Recovery Inc.Fiber Resources Inc.First Georgia BioEnergyForest Energy Corp.Appling County Pellets LLCFram Renewable Fuels - HazlehurstFrank PelletsFulghum Graanul Oliver LLCGeneral Biofuels - GeorgiaGeneva Wood FuelsGerman Pellets LouisianaGerman Pellets TexasGlobal Harvest OrganicsGolden Peanut Co. - HeadlandGolden Peanut Co. - DawsonGreat Lakes Renewable Energy, Inc.Green Friendly Pellets, LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet Fuel ElkinsHassell & Hughes Lumber CompanyHenry County Hardwoods Inc.Horizon Biofuels Inc.Indeck Energy Ladysmith Biofuel Center LLCInternational Biomass Energy LLCIsabella PelletGreen Circle Bio Energy IncJensen Lumber Co.Kirtland Products, LLCKoetter & Smith, Inc.Lee Energy SolutionsGreenwood FuelsLignetics of Idaho IncLignetics of Virginia Inc.

Rapid CityKaneYoungsvilleCorunnaCirclevilleMarionSchofi eldKingwoodSalt Lake CityLa FargevilleTroyCascade LocksBrownsvilleHulettFair HavenBaton RougeArcadeUlyssesPendletonFultonQuitmanPortsmouthKremmlingWaldenCorinthMassenaRapid CityKenoshaStocktonMorehouse ParishGlosterMiffl intownColumbiaNahuntaGordonWarrentonJohnstonBumpassUnadillaSilver PlumeAmoryWigginsAhoskieGarysburgFranklinMontbrookClareChesterTroyKeesevilleWest BaldwinWhite PigeonMountain ViewRinglePine BluffWaynesvilleShow LowBaxleyHazlehurstMill CityOliverSandersvilleStrongLa SalleWoodvilleAuroraHeadlandDawsonHaywardBalsam LakeGarards FortWest MonroeElkinsCollinwoodParisFremontLadysmithJacksonLake IsabellaCottondaleOvidBoyne CityBordenCrossvilleGreen BayKootenaiKenbridge

SDPAPAMIOHVAWIWVUTNYPAORORWYVTLANYPAORMSMSNHCOCOMENYSDWICALAMSPAMOGAGAGASCVANYCOMSMSNCNCVAFLMIVAVANYMEMIARWIARGAAZGAGAORGAGAMELATXMOALGAWIWIPALAWVTNTNNEWIALMIFLIDMIINALWIIDVA

8,0008,500

77,00012,00050,00075,00025,000

Undisclosed60,000

8,00045,00040,000

120,0005,000

110,0001,000,000

100,00050,00020,000

400,000250,000110,000100,000

65,00075,000

100,00071,00040,00035,000

500,000500,000120,000

6,000150,000545,000545,000500,000127,000

1,80018,00090,000

136,000365,000551,000551,000

40,00036,00080,00040,000

6,000344,000

65,00022,00075,00050,000

375,00062,000

220,000551,000

21,000200,000440,000

90,0001,100,000

551,00050,000

UndisclosedUndisclosed

70,00017,00050,00060,00060,00030,00040,00020,00090,000

485,00040,000

660,00015,00035,00015,000

110,000120,000

80,00070,000

NoNoNoNoYesYesYesNoYesNoNoYesNoNoNoYesNoNoNoNoYesYesNoNoYesYesYesNoYesYesYesNoNoYesYesYesYesYesNoNoYesYesYesYesYesYesYesYesYesNoYesNoNoNoNoYesNoYesYesYesYesYesNoYesYesNoYesYesYesNoNoNoNoNoNoNoYesYesNoYesNoNoNoYesNoNoNo

Woody BiomassHardwoodHardwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwoodHardwood and softwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodHardwoodSoftwoodHardwood and softwoodWoody BiomassHardwood and softwoodWoody BiomassSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodWoody biomassHardwood and softwoodHardwoodCorn stover, miscanthusSoftwoodWoody biomassWoody biomassSoftwoodHardwood and softwoodMixed grass and weedsSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwoodHardwoodHardwoodHardwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodHardwoodSoftwoodHardwood and softwoodAlfalfa hay, wood residuals, poultry litterPeanut hullsPeanut hullsHardwood and softwoodHardwoodHardwoodHardwood and softwoodHardwoodHardwoodHardwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwoodHardwoodPaper wasteSoftwoodHardwood

Europe, AsiaEurope, AsiaAsia

S. Korea, Japan

Europe

EuropeEurope

United KingdomBelguim, Italy, Spain

AsiaUnited Kingdom

EuropeTBDTBD

Europe

EuropeEuropeEuropeEuropeEuropeItaly, S. Korea, Taiwan, Australia, IcelandItaly, S. Korea, Taiwan, Australia, IcelandItaly, S. Korea, Taiwan, Australia, IcelandItaly, S. Korea, Taiwan, Australia, Iceland

Europe

EuropeEuropeEuropeEurope

Europe

United KingdomUnited KingdomPoland, Germany, Netherlands

CanadaEurope

Scandanavia, Northern Europe, S. Korea Japan

United Kingdom

COMPANY PLANT NAME LOCATION FEEDSTOCK

PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION

Color Key

Existing Under Construction Proposed

Note: Pellet mill map as of February 11, 2014-To add a pellet production facility to this map email sstucko@bbiinternational.com

Find up-to-date information at :

www.biomassmagazine.com/plants/listplants/pellet/US/

Source: Pellet Mill Magazine / BBI International

Pellet Mill Map List

Agri Fibers Inc.Alexander Energy Inc.Allegheny Pellet CorporationAmerican Pellet CompanyAmerican Wood FibersAmerican Wood FibersAmerican Wood FibersAppalachian Wood PelletsArbor Pellet LLCAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest ProductsBear Mountain Forest ProductsBearlodge Forest ProductsBeaver Wood EnergyBiomass Secure PowerBioMaxx Inc.BioMaxx Inc.Blue Mountain Lumber ProductsBlueFire Renewables Inc.BTH Quitman Hickory LLCCate Street CapitalConfl uence EnergyConfl uence EnergyCorinth Wood Pellets LLCCurran Renewable Energy LLCDeadwood Biofuels LLCDejno’s Inc.Dover CapitalDrax Biomass International Inc.Drax Biomass International Inc.Energex CorporationEnginuity Worldwide, LLCEnova Energy GroupEnova Energy GroupEnova Energy GroupEnova Energy GroupEnsign-Bickford Renewable Energies Inc.Enviro Energy LLCEnvironmental Energy Partners LLCEnviva LPEnviva LPEnviva LPEnviva LPEnviva LPEquustock LLCEquustock LLCEquustock LLCEquustock LLCEssex Pallet & PelletF.E. Wood & Sons - Natural EnergyFiber By-Products Corp.Fiber Energy Products AR LLCFiber Recovery Inc.Fiber Resources Inc.First Georgia BioEnergyForest Energy Corp.Fram Renewable Fuels LLCFram Renewable Fuels LLCFrank PelletsFulghum Graanul Oliver LLCGeneral BiofuelsGeneva Wood Fuels, LLCGerman Pellets GmbHGerman Pellets GmbHGlobal Harvest Organics, LLCGolden Peanut CompanyGolden Peanut CompanyGreat Lakes Renewable Energy, Inc.Green Friendly Pellets, LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet FuelHassell & Hughes Lumber CompanyHenry County Hardwoods Inc.Horizon Biofuels Inc.Indeck Energy Services, Inc.International Biomass Energy LLCIsabella PelletJCE Group ABJensen Lumber Co.Kirtland Products, LLCKoetter & Smith, Inc.Lee Energy SolutionsLibra GroupLigneticsLignetics

U.S. Pellet Producers (continued)

Lignetics of West Virginia Inc.Log Hard Premium Pellets Inc.Low Country BiomassMaeder Brothers Quality Wood Pellets, Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet Co. - PeshtigoMarth Wood Shavings SupplyMichigan TimberMichigan Wood FuelsMt. Taylor - WoodYouRecycleMt. Taylor Machine Pellet FuelNature’s Earth Pellets - ReformNature’s Earth Pellets - LaurinburgJaffrey Manufacturing FacilityDeposit Manufacturing FacilitySchuyler Manufacturing FacilityNorth Idaho Energy Logs - HauserNorth Idaho Energy Logs - Moyie SpringsNortheast Pellets LLCMalheur Pellet MillOlympus Pellets - SheltonO’Malley Wood PelletsOzark Hardwood ProductsPacifi c Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellheat Inc.Penn Wood Products, Inc.Potomac Supply LLCLemhi Valley PelletsRisley Pellet Solutions LLCRocky Canyon Pellet Co.Dillard Composite SpecialtiesGeorgia BiomassShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable Resources Superior Pellet Fuels LLCWestervelt Renewable Energy, LLCTri State BiofuelsTurman Hardwood PelletsInstantheat Wood Pellets Inc.Varn Wood ProductsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products - BanksWest Oregon Wood Products - Columbia CityWood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass - SelmaZilkha Biomass - Crockett

LinnSpartansburgRidgelandWeidmanAthensRocklinTacomaPeshtigoMarathonFlintHollandAlbuquerqueMilanReformLaurinburgJaffreyDepositSchuylerHauserMoyie SpringsAshlandJohn DaySheltonTappahannockSeymourRedmondNacogdochesAppletonGlen HopeEast BerlinKinsaleSalmonMonticelloGrangevilleRoseburgSavannahKingsvilleSomersetLexingtonHuntingburgGamalielSnowfl akeNorth PoleAlicevilleLemont FurnaceGalaxAddisonHobokenNorth ClarendonSt AugustineVulcanBanksColumbia CityPierzSummerhillPrinevilleFinleySelmaCrockett

WVPASCMIMECAWAWIWIMIMINMNMALNCNHNYNYIDIDMEORWAVAMOORTXWIPAPAVAIDWIIDORGAMOKYKYINKYAZAKALPAVANYGAVTFLMIORORMNPAORNDALTX

HardwoodHardwoodHardwoodHardwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodHardwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodHardwoodSoftwoodPaper wasteHardwoodHardwoodSoftwoodHardwood and softwoodHardwoodHardwood and softwoodSoftwoodSoftwoodGrassesHardwoodHardwoodHardwoodHardwoodSoftwoodHardwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwood

125,00025,000

220,00022,000

105,00060,00038,00064,00064,00018,00050,000

6,0006,000

75,000100,000

84,00084,00084,00060,00050,00040,00018,00050,00040,00085,00040,00040,00050,000

5,0005,000

50,0002,600

42,00010,00040,000

825,00015,00050,000

100,00010,00012,00018,00012,000

309,00050,00028,00050,00080,00016,600

132,2779,000

30,00050,000

Undisclosed36,000

Undisclosed22,000

303,13544,000

NoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoYesYesNoYesNoNoNoNoYesNoNoNoYesNoNoNoNoYesNoNoNoNoNoNoNoYesNoNoNoYesNoYesNoYesYesNoNoNoNoYesYes

Canada, S. Korea, ItalyCanada, S. Korea, Italy

Undisclosed

Europe

Europe & Korea

S. Korea, Austrailia, ItalyS. Korea, Australia, Italy

Europe and AsiaEurope and Asia

PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION

Total U.S. Existing Capacity - U.S. 9,422,500Total U.S. Under Construction Capacity - U.S. 3,677,412Total U.S. Proposed Capacity - U.S. 5,210,000

Color Key

LigneticsLog Hard Premium Pellets Inc.Low Country BiomassMaeder Bros. Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet CompanyMarth Peshtigo Pellet CompanyMichigan TimberMichigan Wood FuelsMt. Taylor Machine Pellet FuelMt. Taylor Machine Pellet FuelNature’s Earth Pellet Energy LLCNature’s Earth Pellet Energy LLCNew England Wood Pellet LLCNew England Wood Pellet LLCNew England Wood Pellet LLCNorth Idaho Energy Logs Inc.North Idaho Energy Logs Inc.Northeast Pellets LLCOchoco Lumber CompanyOlympus PelletsO’Malley Wood PelletsOzark Hardwood ProductsPacifi c Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellheat Inc.Penn Wood Products, Inc.Potomac Supply LLCQb Corp.Risley Pellet Solutions LLCRocky Canyon Pellet Co.Roseburg Forest ProductsRWE Innogy CogenShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable Resources Superior Pellet Fuels LLCThe Westervelt CompanyTri State BiofuelsTurman Hardwood PelletsTwo Rivers TimberVarn Wood ProductsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products Inc.West Oregon Wood Products Inc.Wood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass EnergyZilkha Biomass Energy

Canadian Pellet Producers

Boreal PelletCanadian Biofuel Inc.Canadian Biofuel Inc.Canadian Northern Timber GroupCanadian Northern Timber GroupCottles Island Lumber Co.Courtice IndustriesDansonsDirect Pellet Industries Inc.Energex CorporationFoothills Forest Products, Inc.General BiofuelsGildale FarmsGranulcoGranules LGGranules LGGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.Holson Forest ProductsK.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy Inc. Lauzon Recycled Wood Energy Inc. Marwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest IndustriesPacifi c BioEnergy CorporationPinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Premium Pellet Ltd.Princeton Co-Generation Corp.Protocol Biomass Corp.Rentech Inc.Rentech Inc.Resolute Forest ProductsShaw Resources Inc.Shaw Resources Inc.SPB SolutionsT.P. Downey & Sons Ltd.Trebio Wood PelletsVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Viridis Energy Inc.Viridis Energy Inc.Wawasum GroupWhitesand First Nation

Boreal PelletCanadian Biofuel - SpringfordCanadian Biofuel - WoodstockAtlantic Fiber Resources - GoosebayAtlantic Fiber Resources - ChanderCottles Island Lumber Co.Hamilton BiofuelFriendly Fuels LimitedDirect Pellet IndustriesGranules Combustibles Energex, Inc.Foothills Forest Products, Inc.General Biofuels - British ColumbiaGildale Farms

Granules LG Inc.Granules LG InternationalGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.

K.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy - Saint-PaulinLauzon Recycled Wood Energy - PapineauvilleMarwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest IndustriesPacifi c Bioenergy Pellet MillHouston Pellet Limited Partnership - HoustonPinnacle Renewable Energy Inc. - ArmstrongPinnacle Renewable Energy Inc. - Burns LakePinnacle Renewable Energy Inc. - QuesnelPinnacle Renewable Energy Inc. - StrathnaverPinnacle Renewable Energy Inc. - Williams LakePremium Pellet Ltd.Princeton Co-Generation Corp.Protocol Biomass Corp.Rentech Inc. - AtikokanRentech Inc. - WawaThunder Bay Pellet PlantShaw Resources - BelleduneShaw Resources - ShubenacadieSPB Bio MaterialsT.P. Downey & Sons Ltd.Trebio Wood PelletsVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Okanagan Pellet Co. Inc.Scotia Atlantic Biomass Co. Inc.Wawasum GroupWhitesand First Nation

AmosSpringfordWoodstockGoosebayChandlerSummerfordHamiltonEdmontonHaliburtonLac-MéganticGrande CacheTerraceSt. MarysSacre-CoeurSt-FelicienMashteuiatshSt-QuentinBristolRoddicktonNew LiskeardLa CreteHearstSaint-PaulinPapineauvilleFrederictonMeadow LakeBracebridgeNew RichmondPrince GeorgeHoustonArmstrongBurns LakeQuesnelStrathnaverWilliams LakeVanderhoofPrincetonPrescottAtikokanWawaThunder BayBelleduneShubenacadiePeterboroughWeldonPortage-du-FortVanderhoofSlave LakeWest KelownaMiddle MusquodoboitGreenstoneArmstrong

QCONONNLQCNLONABONQCABBCONQCQCQCNBNBNLONABONQCQCNBSKONQCBCBCBCBCBCBCBCBCBCONONONONNBNSONNBQCBCABBCNSONON

50,00040,000

100,000120,000190,000

12,00050,00030,000

Undisclosed120,000

30,000500,000

12,00040,000

120,00080,00055,00040,00060,00045,00070,00010,00058,00058,00010,000

6,00050,000

125,000400,000220,000

60,000440,000100,000220,000200,000140,000108,000500,000100,000450,000

45,000100,000

50,000UndisclosedUndisclosed

130,00015,00050,00060,000

120,00067,00068,000

NoYesYesYesYesNoYesNoYesYesNoYesNoNoYesYesYesNoNoYesYesYesYesYesNoNoNoYesNoYesYesYesYesYesYesNoYesYesYesYesNoYesNoYesNoYesNoYesYesYesYesYes

ItalyItalySweden, DenmarkUnited Kingdom

Europe, United States

ItalyU.S., Europe

U.S., ItalyU.S. and ItalyEuropeU.S.

United KingdomUndisclosedItalyEuropeEurope

Europe

Asia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, Europe

Europe, AsiaEuropeEuropeEurope

Europe

U.S.EuropeEuropeEurope

Hardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodSoftwoodHardwood and softwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodOat hullsHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodHardwoodHardwood and softwood

PRODUCTION CAPACITY (METRIC TONS/YR) EXPORTING DESTINATION

Total Existing Capacity - Canada 3,329,000Total Under Construction Capacity - Canada 790,000Total Proposed Capacity - Canada 1,605,000

Color Key

The Largest Biomass Conference in North America

INCREASE EXPOSURELimited Number of Sponsorships Available.Don't Wait, Become a Sponsor Today

At the 2014 event in Orlando…

98% of exhibitors said they’d return

100% of exhibitors rated the quality of leads positive

98% of exhibitors rated their ROI as positive

Surround Yourself with Biomass Decision MakersDon’t Wait, Get Your Premium Booth NowBy purchasing a booth you are surrounding yourself with industry professionals who are looking for solutions to their challenges. Contact us at service@bbiinternational.com or 866-746-8385.

“Overall the conference was a positive experience and an opportunity to find our place in the Biomass Industry.” – Steve Hoagland, Pantron Automation

“The Biomass Conference was an excellent networking event with technical information relevant to the industry.”

– Amy Theis, Fauske & Associates

“This is a very important conference for me. Wouldn't miss it.” – William Perritt, RISI

866-746-8385 | service@bbiinternational.com

#IBCE15 - Follow Us: twitter.com/biomassmagazine

Ag Products & Services Feedstock Collection Systems

Ag Products & ServicesFeedstock Collection

Systems

New Holland Agriculture

500 Diller AvenueNew Holland, PA 17557 Jarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)jarrod.angstadt@newholland.comwww.newholland.com/na

Gulf Stream Fuels, LLC

P.O. Box 147Markham, TX 77456Truman Neuman, VP of MarketingPhone (512-745-6940)tjneuman2010@live.com

Feedstock Procurement

Agricultural Fuels Corp

5361 Young Pine Rd. Orlando, FL 32829James Meade, CTOPhone (407-234-1788) | Fax (407-380-5188)jmm@agfuels.bizwww.agfuels.biz

Cousineau Forest Products

1310 Old Concord RdHenniker, NH 03242Jon Baker, Operations & Wood Procurement ManagerPhone (603-428-7155) | Fax (603-428-7839)jon@cousineaus.comwww.cousineaus.com

Timberland Associates, LLC

2150 CR 750Dumas, MS 38625Tom Busch, OwnerPhone (662-837-0381)tom@timberlandassociates.comtimberlandassociates.com

Associations & Organizations

Shift Your Career in to High GearJoining the SWANA Team provides solid waste management professionals like you with the tools you need to enhance your skills and advance your career.

New Solid Waste Assocation of North America members receive a FREE 1-year Landfill Gas and Biogas Technical Division Membership that adds you to a select group of professionals who are recognized as the premier authorities on landfill gas (LFG) recovery, controls, litigation and management.

TECHNICAL DIVISIO

LANDFILL GAS & BIOGAS

TECHNICAL DIVISIO

LANDFILL GAS & BIOGAS

Associations &

Organizations

The Solid Waste Association of North

America (SWANA)

1100 Wayne Avenue, Suite 650Silver Spring, MD 20910Meri Beth Wojtaszek, Deputy Executive DirectorPhone (800-467-9262) | Fax (301-589-7068)marketing@swana.orgwww.swana.orgSEE OUR AD ON PAGE 14

Advanced Biofuels USA

507 North Bentz StreetFrederick, MD 21701Joanne Ivancic, Executive DirectorPhone (301-644-1395)info@advancedbiofuelsusa.orgwww.AdvancedBiofuelsUSA.org

Biomass Power Association

100 Middle StreetPortland, ME 04104Bob Cleaves, PresidentPhone (207-228-7376) | Fax (207-774-1127)bob@biomasspowerassociation.comwww.biomasspowerassociation.com

3845 Cypress Creek Parkway, Ste. 420Houston, TX 77068Jalene Fritz, Membership CommitteePhone (970-593-8637) | Fax (970-472-1304)jfritz@tpitx.comwww.cti.org

Neutopia ecoSOLUTIONS Inc.

2045 Lakeshore Boulevard WestSuite 411Toronto, ON M8V 2Z6 CanadaRobert Laporte, President & CEOPhone (905-581-6333)rlaporte@neutopia.cawww.neutopia.ca

NH Wood Energy Council

2 Airport RoadUnit 1Gilford, NH 03249Rick DeMark, CoordinatorPhone (603-527-2093)rdemark.ncrcd@metrocast.netwww.nhwoodenergycouncil.org

OÖ Energiesparverband

(Energy Agency of Upper Austria)

Landstrasse 45 Linz AustriaChristine Egger, Deputy managerPhone (437-327-72014386) (Fax 437-327-72014383)offi ce@esv.or.atwww.esv.or.at/english/

European Pellet Conference 2015: February 25 - 26

2016: February 24 - 25

WELS, AUSTRIA

WWW.PELLETS15.EU

The largest

pellet event worldwide!

International Biomass Conference & Expo

Phone (866-746-8385)service@bbiinternational.comwww.biomassconference.comSEE OUR AD ON PAGE 12

National Advanced Biofuels Conference & Expo

Phone (866-746-8385)service@bbiinternational.comwww.advancedbiofuelsconference.comSEE OUR AD ON PAGE 54

International Fuel Ethanol Workshop & Expo

Phone (866-746-8385)service@bbiinternational.comwww.fuelethanolworkshop.com

Roundtable on Sustainable Biomaterials (RSB)

60 North Market Street, Suite C200Asheville, NC 28801Matt Rudolf, Regional Director, AmericasPhone (919-810-2295)matthew.rudolf@rsb.orgwww.rsb.org

15 Technology Parkway S.Peachtree Corners, GA 30092Raine Hyde, MarketingPhone (770-446-1400)rhyde@tappi.orgwww.tappi.org

WebSite Names Only

Box 304Nanoose Bay, V9P9J9 CanadaGary R Campbell

Phone (250-468-7047)mail@siwash.netwww.websitenamesonly.com

Conferences/Trade Shows

& Meetings

Densifi cation & Size

Reduction

Balers - Industrial

C&M Baling Systems, Inc.

P.O.Box 16309Winston Salem, NC 27115John Gibbs, President & COOPhone (336-723-1838) | Fax (336-761-8695)sales@baling.comwww.baling.com

Densifi cation & Size Reduction Briquetting

Briquetting

Biomass Briquette Systems, LLC

P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-893-2444) | Fax (530-893-2444)info@biomassbriquettesystems.comwww.biomassbriquettesystems.com

DI PIÙ - Sunomi LLC

608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)gchecchi@sunomi-llc.comwww.sunomi-llc.com

Hartpence Farms

PO Box 155Moscow, PA 18444Larry Hartpence, OwnerPhone (570-842-6464)larry@hartpencefarms.com

Lehra Fuel Tech PVT LTD

Vpo Nanakpur Jagera-141117, Opp Dera Sacha Sauda Near Shanti Tara College, Distt. LudhianaPunjab, 141117 IndiaSarabjit Singh, DirectorPhone (919815200337)info@lehrafuel.comwww.lehrafuel.com

Vecoplan Midwest

4005 Earnings WayNew Albany, IN 47150Bill Miller, Chief Operating Offi cerPhone (812-923-4992)bmiller@vecoplanmidwest.comwww.vecoplanmidwest.comSEE OUR AD ON PAGE 19

Warren & Baerg Manufacturing, Inc.

39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)info@warrenbaerg.comwww.warrenbaerg.com

YongHua

Zhengzhouroad 559Zhengzhou, 450042 ChinaJack Zhao, 先生Phone (037167817233)binyazhao123@gmail.comwww.briquettemachinecn.com

Chippers - Brush

Morbark, Inc.

8507 S. Winn Rd. | P.O. Box 1000Winn, MI 48896Casey Gross, Sales Manager, Tree CarePhone (800-831-0042) | Fax (989-866-2280)casey.gross@morbark.comwww.morbark.com

Chippers - Whole Log

Morbark, Inc.

8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896John Foote, Vice President, Sales and MarketingPhone (800-831-0042) | Fax (989-866-2280)john.foote@morbark.comwww.morbark.com

ANDRITZ

1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing CoordPhone (289-239-9456)joanne.turnell@andritz.comwww.andritz.com

Grinders - Horizontal

Morbark, Inc.

Continental Biomass Industries, Inc.

22 Whittier St.Newton, NH 03858Art Murphy, Marketing ManagerPhone (603-382-0556)amurphy@cbi-inc.comwww.cbi-inc.comSEE OUR AD ON PAGE 17

Rawlings Waste Wood Recovery Systems

PO Box 4485Missoula, MT 59806John Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)john@rawlingsmanufacturing.comwww.wastewoodhogs.comSEE OUR AD ON PAGE 16

Vecoplan, LLC

PO Box 7224High Point, NC 27264Yuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)ychocholko@vecoplanllc.comwww.vecoplanllc.comSEE OUR AD ON PAGE 19

Grinders - Tub

Morbark, Inc.

American Property Experts

606 Sunnyvale DriveWilmington, NC 28412Bill Waggaman, Business DevelopmentPhone (910-793-1460) | Fax (910-793-6227)bill@tubgrinding.comwww.tubgrinding.com

Rawlings Waste Wood Hogs• Biomass & Co-Gen Operations• Sawmill and Log Yard Waste• Pulp, Pellet & Paper Plants

• Compost & Mulch Operations• Wood Waste Recycling Facilities• Alternative Fuels for Cement Manufacturing

For over 35 Years Rawlings is a proven leader in cost effective wood waste recovery equipment.

Ph: 1.866.RocWear (762.9327) or 406.728.6182 • www.wastewoodhogs.com

Densifi cation & Size Reduction

Densifi cation & Size Reduction Grinders - Vertical

Grinders - Vertical

Brunette Machinery Co.

8717 132nd StreetSurrey, BC V3W 4P1 CanadaKirk Forbes, PresidentPhone (604-522-3977)sales@brunettemc.comwww.brunettemc.com

Vecoplan, LLC

Mills - Hammer

Andrirz Feed and Biofuel

336 West PennMuncy, PA 17756Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)joanne.turnell@andritz.comandritz.com/ft

Bliss Industries, LLC

1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601Chad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)sales@bliss-industries.comwww.bliss-industries.com

Jeff rey Rader,

a brand of TerraSource Global

215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)tgentile@terrasource.comwww.jeff reyrader.comSEE OUR AD ON PAGE 30

Williams Patent Crusher &

Pulverizer Company, Inc.

2701 North BroadwaySt. Louis , MO 63102Steve Baumgartner, Sales ManagerPhone (314-621-3348) | Fax (314-436-2639)sales@williamscrusher.comwww.williamscrusher.com

Pellet Mills

Andrirz Feed and Biofuel

336 West PennMuncy, PA 17756Joanne Turnell, Sales & Marketing CoordPhone (289-239-9456)joanne.turnell@andritz.comandritz.com/ft

Anyang General International Group

Renmin Road, Anyang, ChinaMNancy Yang, Manager AssistantPhone (863725965148)nancyyang012@gmail.comgemcopelletmill.com

Bliss Industries, LLC

1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601Chad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)sales@bliss-industries.comwww.bliss-industries.com

CPM Roskamp Champion

2975 Airline CircleWaterloo, IA 50703Tim Gilbert, North American ManagerPhone (800-366-2563)gilbertt@cpmroskamp.comwww.cpmroskamp.comSEE OUR AD ON PAGE 18

Vecoplan Midwest

4005 Earnings WayNew Albany, IN 47150Bill Miller, Chief Operating Offi cerPhone (812-923-4992)bmiller@vecoplanmidwest.comwww.vecoplanmidwest.comSEE OUR AD ON PAGE 19

Victor Pellet Mill

Wenhua Road Zhengzhou, ChinaWales Z, SalesmanPhone (8637156747890)pelletizermill@gmail.comhttp://www.pelletizermill.com/

Pyrolysis

Heyl & Patterson Inc.

400 Lydia StreetCarnegie, PA 15106Sales Dept.

Phone (412-788-9810) | Fax (412-788-9822)info@heylpatterson.comwww.heylpatterson.com

Torrefaction

Agri-Tech Producers, LLC (ATP)

116 Wildewood Club CourtColumbia, SC 29223Joseph James, PresidentPhone (803-462-0153) | Fax (803-462-9676)josephjjames@bellsouth.netwww.agri-techproducers.com

400 Lydia StreetCarnegie, PA 15106Sales Dept. Phone (412-788-9810) | Fax (412-788-9822)info@heylpatterson.comwww.heylpatterson.com

Konza Renewable Fuels

2953 SW Wanamaker DrTopeka, KS 66614Josh Thompson, MemberPhone (785-286-7390)Josh.Thompson@konzaRF.comhttp://www.konzarf.com/Contact.aspx

Executive Search

H.T. PROF Clean Tech

575 N. Patterson Ave.Suite 444Winston-Salem, NC 27101Todd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)tsporter@htprof.comwww.htprof.com/clean-tech.htm

Commodity Talent LLC

349 Fifth Ave., 7th Flr.New York, NY 10016George Stein, Managing DirectorPhone (646-205-3557)ghstein@commoditytalent.comwww.CommodityTalent.com

Olson Search International, Inc.

PO Box 3127Redmond, WA 98073Jon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)jon@olsonsearch.comwww.olsonsearch.com

Top Wood Jobs

PO Box 4La Center, WA 98629George Meek, RecruiterPhone (360-263-3371)geo@topwoodjobs.comwww.TopWoodJobs.com

Education Education

Education

Martin Engineering

One Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)chelseab@martin-eng.comwww.martin-eng.com

Amatrol Inc.

2400 Centennial Blvd.Jeff ersonville, IN 47130Luke Gillenwater, InternPhone (800-264-8285) | Fax (812-283-1584)lgillenwater@amatrol.comwww.amatrol.com

Employment

Education

Engineering & Construction Anaerobic Digestion Systems

DESIGNING INNOVATIONBiomass Feedstock Processing Systems

(336) 252-4095

vecoplanllc.com

Cellulosic Ethanol • Pellet Production • Combined Heating and Power • Co-Firing Utilities

A worldwide leader in size reduction technology for bioenergy, Vecoplan works with individual customers to design, engineer, manufacture and implement technologically advanced, material specific, and application specific shredding, ferrous and non-ferrous removal, size and density separation, screening and classification technologies and extremely efficient conveyor and bulk material handling, metering, storage and unloading technologies.

Contact Vecoplan today to learn more about our existing systemsor to arrange a visit to one, or several, of our installations.

Engineering & ConstructionAnaerobic Digestion

Systems

ADI Systems Inc.

370 Wilsey RoadFredericton, NB E3B 6E9 CanadaScott Christian, Vice President, Business DevelopmentPhone (506-452-7107)scott.j.christian@adi.cawww.adisystemsinc.com

RWL Water

7135 Madison Avenue WestGolden Valley, MN 55427Nii Mensah, VP of Sales & MarketingPhone (763-746-9277) | Fax (763-746-8408)nmensah@rwlwater.comwww.rwlwater.com

Adtec Power Gmbh

Industriestrasse 1Hard, 6971 AustriaBernhard Schulz, CEOPhone (00436606489040)b.schulz@adtecpower.comwww.adtecpower.com

BIOGAS Equity 2, Inc.

130 Eleanor Dr.Woodside, CA 94062Mike Muller, COOPhone (650-283-9555)mikemuller@biogas2.comwww.biogas2.com

Eisenmann

150 E Dartmoor DriveCrystal Lake, IL 60014John McDowell, Sales EngineerPhone (815-477-5335)john.mcdowell@eisenmann.comwww.eisenmann.us.com

SeaHold LLC

23551 Rose Quartz DrivePerris, CA 92570Thomas Hintz, Managing PartnerPhone (951-943-9697)tom.hintz@seahold.comwww.seahold.com

Vecoplan, LLC

Biomethane

Urban Renewable H2

3010 LBJ Freeway Suite 1200Dallas, TX 75234Ray Gwin, CEOPhone (214-796-4033)r.gwin@urh2.comwww.urh2.com

Buildings

Greystone Construction

500 S. Marschall Road, Suite 300Shakopee, MN 55379Colin O’Brien, Business Development ManagerPhone (952-496-2227) | Fax (952-445-4191)cobrien@greystoneconstruction.comwww.greystoneconstructioncom

ICS, Inc.

(Industrial Contract Services, Inc.)

PO Box 13158Grand Forks, ND 58208-3158David Dangerfi eld, Project DevelopmentPhone (701-775-8480) | Fax (701-775-8479)ddangerfi eld@icsgf.comwww.icsgf.com

Miron Construction Co., Inc.

1471 McMahon DriveNeenah, WI 54956Dan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004) | Fax (920-969-7393)dan.goymerac@miron-construction.comwww.miron-construction.com

Natural Light Fabric Structures

397 Ervin Industrial DriveJordan, MN 55352Colin O’Brien, Dealer/Business Development ManagerPhone (888-708-3272)colino@nlfabric.comwww.nlfabric.com

Rubb Buildings Inc.

1 Rubb LaneSanford, ME 04073Chuck Auger, Marketing ManagerPhone (207-324-2877)cauger@rubbusa.comrubbusa.com

Civil Engineering

Cimarron Light & Power Systems

506 Riverside Drive NEHuron, SD 57350James Schaeff er, PresidentPhone (605-352-4460) | Fax (605-352-1430)cimarron@santel.netwww.cimarronlps.com

CHP Systems

AgriPower, Inc.

46 Deepdale DriveGreat Neck, NY 11021Barry Berman, CEOPhone (516-829-2000) | Fax (516-487-3163)bberman@agripower.comwww.agripower.com

Engineering & Construction CHP Systems

WWW.AGRAIND.COM800-842-8033 AGRA HAS CUSTOM-DESIGNED BIOMASS SOLUTIONS FOR YOU!

TO FABRICATIONFROM DESIGN

AGRAIndustries

YOUR EPC CONTRACTOR

TO COMPLETION!

Engineering & ConstructionSolar Turbines Incorporated

9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)lyons_chris_d@solarturbines.comwww.solarturbines.com

Detailed Design

Dedert Corporation

17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)c.crankshaw@dedert.comwww.dedert.com

Evergreen Engineering, Inc.

1740 Willow Creek CircleEugene, OR 97402Aaron Edewards, Business Development DirectorPhone (541-484-4771) | Fax (541-484-6759)aedewards@eeeug.comwww.evergreenengineering.com

District Heating Systems

Solar Turbines Incorporated

Electrical

1075 Progress CircleLawrenceville, GA 30043Jim Batten, V.P. of SalesPhone (770-682-8259) | Fax (770-277-5524)jbatten@espatl.comwww.espatl.com

AGRA Industries

1211 West Water StreetMerrill, WI 54452Tim Gruling, Manager of SalesPhone (715-536-9584) | Fax (715-536-9587)sales@agraind.comagraind.comSEE OUR AD ON PAGE 21

Fagen, Inc.

501 W. Hwy 212Granite Falls, MN 56241Richard Cantor, Vice President, Business DevelopmentPhone (864-430-5338)rcantor@fageninc.comwww.fageninc.com

10 Quality StreetLexington, KY 40507Alex De Martini, Manager, Business DevelopmentPhone (859-281-5000) | Fax (859-252-5300)ademartini@gray.comwww.gray.comSEE OUR AD ON PAGE 23

OSDV Engineering Inc.

1 Rabbit RunWilmington, DE 19809Charlesl Clerecuzio, Principal / Chief EngineerPhone (856-266-2550)cclerecuzio@osdveng.com

Venture Engineering &

Construction, Inc.

1501 Reedsdale StreetSuite 505Pittsburgh, PA 15233Bill Slatosky, Sr. Business Development ManagerPhone (412-231-5890) | Fax (412-231-5891)bsslatosky@ventureengr.comwww.ventureengr.com

Waste Environmental Solutions, LLC

437 Linden AveElizabeth, NJ 07202Nestor Vela, COOPhone (732-489-0015) | Fax (732-833-8874)nestorvela@wesinternational.comwww.wesinternational.com

Waterleau

1300 Adams Ave, Apt 32PCosta Mesa, CA 92626Laetitia d’Ursel, Business Development ManagerPhone (714-727-7607)laetitia.dursel@waterleau.comwww.waterleau.com

Fabrication

AGRA Industries

1211 West Water StreetMerrill, WI 54452Tim Gruling, Manager of SalesPhone (715-536-9584) | Fax (715-536-9587)sales@agraind.comagraind.comSEE OUR AD ON PAGE 21

AGRA Industries

1211 West Water StreetMerrill, WI 54452 USPat Hinner, PresidentPhone (800-842-8033)lhans@agraind.comwww.agraind.comSEE OUR AD ON PAGE 21

Andy J. Egan Co.

2011 Waldorf NWSuite 200Grand Rapids, MI 49544Rick Atkins, FabricationPhone (616-791-9952)atkinsr@andyegan.comwww.andyegan.com

PanAmerican Hydrogen, Inc.

5806 E. Grimes St.Harlingen, TX 78550Barbara Martinez, VPPhone (956-365-3773) | Fax (956-365-3739)barbara.guaym@phydrogen.comwww.panent.comSEE OUR AD ON PAGE 24

Gasifi ers

PHG Energy

3048 Owen DriveAntioch, TN 37013Mike Webb, Director of Business DevelopmentPhone (615-471-9299)mike.webb@PHGEnergy.comwww.phgenergy.com

Heat Transfer International

4720 44th Street SEKentwood, MI 49512Project Development, Sales ManagerPhone (616-551-5420)sales@heatxfer.comwww.heatxfer.com

PRM Energy Systems, Inc.

504 Windamere TerraceHot Springs, AR 71913Ron Bailey, ChmPhone (501-276-2101) | Fax (501-767-7679)rbaileys@prmenergy.comwww.prmenergy.com

Smart E2 Solutions

14 Edgewood RoadRumson, NJ 07760George St.Onge, Director of Business DevelopmentPhone (732-801-6828) | Fax (732-758-1169)georgesaintonge@se2sol.comwww.SE2Sol.com

Information Technology

Services

ALDATA Software

203, 211 Pembina Ave.Hinton, AB T7V 2B3 CanadaMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)mike.meagher@aldatasoftware.comwww.aldatasoftware.com

Verdanté BioEnergy Services

626 Harper Ave NWPO Box 2917Lenoir, NC 28645G. David Waechter, OwnerPhone (828-394-1246)david@verdantebioenergy.comwww.verdantebioenergy.com

Management Services

NAES Corporation

1180 NW Maple StreetSuite 200Issaquah, WA 98027Jeanette Carroll, Marketing ManagerPhone (425-961-4700)jeanette.carroll@naes.comwww.naes.com

Piping

Koger Air Corporation

P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)mabull@kogerair.comwww.kogerair.com

Plant Optimization

ASI-Industrial

1300 Minnesota Ave.Billings, MT 59101Matthew Hamlin, Vice President SalesPhone (406-245-6231) | Fax (406-245-6236)mjayhamlin@gmail.comwww.asi-industrial.com

Power Plant Construction

BBI Project Development

10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)myancey@bbiinternational.comwww.bbiinternational.comSEE OUR AD ON PAGE 13

TEi Construction Services

170 Tucapau RdDuncan, SC 29334Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 5

Pyrolysis

4720 44th Street SEKentwood, MI 49512 USProject Development, Sales ManagerPhone (616-551-5420)sales@heatxfer.comwww.heatxfer.com

STRATA

503 Olympic BlvdSanta Monica, CA 90401Josh Seldner, OwnerPhone (310-739-8243)strata.inc@hotmail.comwww.strata-oil.com

Western Renewable Technologies

310 N Geneva RoadLindon, UT 84042Mel Radmall, CEOPhone (801-785-9330)info@wrtpyrolysis.comwww.wrtpyrolysis.com

Stacks

Hoff mann, Inc.

6001 49th St. SouthMuscatine, IA 52761Paul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)sales@hoff manninc.comwww.hoff manninc.com

Structural Fabrication

Torrefaction

4720 44th Street SEKentwood, MI 49512Project Development, Sales ManagerPhone (616-551-5420)sales@heatxfer.comwww.heatxfer.com

Water Treatment

Symbiont

www.symbiontonline.com

Feedstock Supply

Engineering & Construction

Project Development

Biomass Based Fuel Oil

Global Clean Energy Holdings

2790 Skypark DriveSuite 105Torrance, CA 90505Richard Palmer, President and CEOPhone (310-641-4234)info@gceholdings.comwww.gceholdings.com

Lewis & Raulerson, Inc.

1759 State StreetWaycross, GA 31501Casey Hall, Executive AssistantPhone (912-283-5951) | Fax (912-283-8281)chall@lewisandraulerson.comwww.lewisandraulerson.com

Sustainable Oils

2790 Skypark DriveSuite 105Torrance, CA 90505Scott Johnson, PresidentPhone (919-428-1102)sjohnson@susoils.comwww.susoils.com

Briquettes

HerBasant Industries

At Sanjivani BuildingFarm Road, Modi Para,Sambalpur, 768002 IndiaL K Agrawal, General ManagerPhone (09438631539)herbasant@gmail.comhttp://www.herbsantextracts.com/

Dedicated Energy Crops

Novatos RE Agro-Industrial

24 Dollar St., CGPV, Felix Ave, Cainta, RizalRizal, 1400 PhilippinesRoberto Alip, PresidentPhone (639192359694)bobet.alip@gmail.comwww.facebook.com/novatos.re

NRG Farm Consulting, LLC

3813 HabershamSchertz, TX 78154Bud Wylie, PresidentPhone (210-725-1756)budwylie8@gmail.com

Pellets

Curran Renewable Energy, LLC

20 Commerce DriveMassena, NY 13662Patrick Curran, President / OwnerPhone (315-769-2000)pcurran@twcny.rr.comwww.curranpellets.com

Engineering & Construction Gasifi ers

BUILDING TOGETHERFOR THE FUTURE

gray.com

Feedstock Supply

WastAway

P.O. Box 7116McMinnville, TN 37111Terry Moore, Chief Business Development Offi cerPhone (931-815-8520)tmoore@wastaway.comwww.wastaway.com

African Green Developments (Pty)Ltd.

80 Milner Rd. MidrandJohannesburg, 1865 South AfricaLeon-Valeri Eremin, CEOPhone (0822647781)vgereminl@gmail.comwww.greenpower-worldwide.com

E3Coal

Rissener Landstrasse 255Hamburg, 22559 GermanyChristopher Stone

Phone (0012022156201)business-development@e3coal.comwww.e3coal.com

Northeast Wood Products, LLC

13 Crow Hill RoadUncasville, CT 06382Mike Reid, SVP-Business DevelopmentPhone (855-324-9621)mreid@northeastwoodproductsllc.comwww.thermaglo.comSEE OUR AD ON PAGE 25

West Oregon Wood Products, Inc.

PO Box 249Columbia City, OR 97018Chris Sharron, CEOPhone (503-397-6707) | Fax (503-397-6887)csharron@wowpellets.comwww.wowpellets.com

Wood Chips

Burns Forest Products LLC

17691 Hwy 4Bienville, LA 71008John Russo, COOPhone (318-259-4997) | Fax (318-259-6338)bfpjohn@aol.com

Ecostrat Inc.

60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaJordan Solomon, PresidentPhone (416-968-8884 ext. 222) Fax (416-968-8886)jordan.solomon@ecostrat.comwww.ecostrat.com

Foster Brothers

PO Box 249Auxvasse, MO 65231Steve Foster, VPPhone (573-386-2271) | Fax (573-386-2676)steve@fosterbros.comwww.fosterbros.com

Wood Residues

Ecostrat Inc.

60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaJordan Solomon, PresidentPhone (416-968-8884 ext. 222) Fax (416-968-8886)jordan.solomon@ecostrat.comwww.ecostrat.com

Legal ServicesAttorney

Agriculture Law & Consulting LLC

16240 Burt StreetOmaha, NE 68118David Bracht, OwnerPhone (402-981-2900)dlbracht@aol.comwww.linkedin.com/pub/david-bracht/1/11b/66

Kilpatrick Townsend & Stockton LLP

607 14th Street, NWSuite 900Washington, DC 20005Mark Riedy, CounselPhone (202-508-5823) | Fax (202-318-4087)mriedy@kilpatricktownsend.comwww.kilpatricktownsend.com

Schnader Harrison Segal & Lewis LLP

Suite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222Megan Harmon, PartnerPhone (412-577-5200)mharmon@schnader.comwww.schnader.com

Intellectual Property

Sterne, Kessler, Goldstein & Fox P.L.L.C.

1100 New York Ave, NWWashington, DC 20005Peter Jackman, DirectorPhone (202-772-8585)PJackman@skgf.comwww.skgf.com

Feedstock Supply Pellets

Material Handling & StorageBucket Loader

Kenco Engineering, Inc.

2155 PFE RoadRoseville, CA 95747Ron Brajkovich, Regional ManagerPhone (800-363-9859) | Fax (916-783-3494)ronb@kencoengineering.comwww.kencoengineering.com

Conveyor-Belt

Martin Engineering

4B Components Ltd.

625 Erie AvenueMorton, IL 615504B Sales, 4B SalesPhone (309-698-5611)webmaster-usa@go4b.comwww.go4b.com/usa

B.I.D. Canada Ltd.

171 Hemlock StreetLower Woodstock, NB E7M 4E6 CanadaDerek Lawrence, Sales & Estimating ManagerPhone (506-328-4381 X 510)dlawrence@bidcanadaltd.comwww.bidcanadaltd.com

ProcessBarron

2770 Welborn St.Pelham, AL 35124Cliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)information@processbarron.comwww.processbarron.comSEE OUR AD ON PAGE 28

Wolf Material Handling Systems

12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)sales@wolfmhs.comwww.wolfmhs.comSEE OUR AD ON PAGE 31

Conveyor-Drag

Conveyor-Enclosed

SHW Storage & Handling Solutions

www.shw-shs.com

Conveyor-Mechanical

SHW Storage & Handling Solutions

www.shw-shs.com

Vecoplan, LLC

Material Handling & Storage Bucket Loader

Material Handling & StorageWarren & Baerg Manufacturing, Inc.

39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone 559-591-6790) | Fax (559-591-5728info@warrenbaerg.comwww.warrenbaerg.com

Conveyor-Pneumatic

Jeff rey Rader,

Conveyor-Screw

Jeff rey Rader,

SHW Storage &

Handling Solutions GmbH

www.shw-shs.com

Cranes-Overhead

Processbio A/S

PO Box 34 Romeo, MI 48065Jorgen Lyngso, American representativePhone (586-255-7075)jl@processbio.comwww.processbio.com

ANDRITZ

Dryer - Conveyor

CPM Wolverine Proctor, LLC

251 Gilbraltar RoadHorsham, PA 19044Chris Law, Industry ManagerPhone (215-443-5200) | Fax (215-443-5206)lawc@cpmwolverineproctor.comwww.cpmwolverineproctor.comSEE OUR AD ON PAGE 26

Dryer - Flash

Dedert Corporation

Dryer - Ring

Dedert Corporation

Dryer - Rotary Drum

Astec, Inc.

4101 Jerome AvenueChattanooga, TN 37407Malcolm Swanson, PresidentPhone (423-867-4210) | Fax (423-867-4636)mswanson@astecinc.comwww.astecinc.comSEE OUR AD ON PAGE 56

Dedert Corporation

Material Handling Conveyor-Mechanical

SCREEN, SIFT AND SCALP foreign material with non-vibrating screening technology. Easy installation and low maintenance.

Manufacturing, Inc.

400 Lydia StreetCarnegie, PA 15106Sales Dept., Phone (412-788-9810) | Fax (412-788-9822)info@heylpatterson.comwww.heylpatterson.com

Thompson Dehydrating Company

2953 SW Wanamaker DrTopeka, KS 66614Ted Thompson, CEOPhone (785-272-7722)angiem@thompsondryers.comhttp://www.thompsondryers.com/

Dryer - Spray

Dedert Corporation

17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000) c.crankshaw@dedert.comwww.dedert.com

Dryer - Steam Tube

Davenport Dryer

301 2nd StRock Island, IL 61204Rob Feller, Sales ManagerPhone (309-283-1134)rfeller@davenportdryer.comwww.davenportdryer.com

Elevator-Bolts

4B Components Ltd.

625 Erie AvenueMorton, IL 615504B Sales

Phone (309-698-5611)webmaster-usa@go4b.comwww.go4b.com/usa

Elevator-Buckets

4B Components Ltd.

625 Erie AvenueMorton, IL 615504B Sales Phone (309-698-5611)webmaster-usa@go4b.comwww.go4b.com/usa

Import / Export Services

Protective Packaging Corp.

1746 W. Crosby RoadCarrollton, TX 75006Anita Pinkerton, ConsultantPhone (800-644-4032)protectivepackaging@greenpeas.comwww.protectivepackaging.net

Loading Equipment

DYNATEK Loading Systems

200 North Harrison StNorth Prairie, WI 53153Gary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)garyk@dynatekloadingsystems.comwww.dynatekloadingsystems.com

SAMSON Materials Handling Ltd.

Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA Great BritainAndy Blythe, Managing DirectorPhone (441353665001) Fax (441353666734)sales@samson-mh.comwww.samson-mh.com

Railcar-Moving

400 Lydia StreetCarnegie, PA 15106Sales Dept.

Phone (412-788-9810) | Fax (412-788-9822)info@heylpatterson.comwww.heylpatterson.com

Scale-Bulk Weigh

Hyer Industries-Thayer Scale

91 Schoosett St.PO Box 669Pembroke, MA 02359Peter Sirrico, Regional Sales ManagerPhone (781-826-8101) | Fax (781-826-0072)psirrico@thayerscale.comwww.thayerscale.com

Scale-Software

Baywood Technologies Inc.

5210 Belfort Road, Suite 210Jacksonville, FL 32256Shannon Fitzgerald, Business DevelopmentPhone (904-733-7336) | Fax (904-731-5695)shannon.fi tz@baywoodtech.comwww.baywoodtech.net

Screens-Disc

Jeff rey Rader,

SHW Storage &

www.shw-shs.com

Screens-Disc Scalping

Jeff rey Rader,

Screens-Fines

Morbark, Inc.

Material Handling & Storage

Material Handling & Storage Dryer - Rotary Drum

Our equipment’s tough so the transition won’t be.

Biomass Conversion

processbarron.com/biomass-conversion

Visit us at POWER-GEN International Booth #3021

Material Handling & StorageScreens-Fines

EBM Manufacturing

1014 Sherwood RdNorfolk, NE 68701Tiff any Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)tiff any@ebmmanufacturing.comwww.gentleroll.comSEE OUR AD ON PAGE 27

Jeff rey Rader,

Screens-Other

ANDRITZ

1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)joanne.turnell@andritz.comwww.andritz.com

Komptech Americas

10855 Dover Street, Suite 1000Westminster, CO 80021Brandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)b.lapsys@komptechamericas.comwww.komptechamericas.com

Specialty Parts and

Equipment

Hawkeye Process Technology Systems

3000 Old Alabama RdSte 119-198Atlanta, GA 30022Bill Schafer, Director Business DevelopmentPhone (614-747-1737)bschafer.hawkeye@gmail.comwww.gogreendevelopment.net

Stockyard Equipment

SCHADE Lagertechnik GmbH

Bruchstrasse 1Gelsenkirchen, 45883 GermanyKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122) Fax (4920950316188)fi egenbaum@schade-lagertechnik.dewww.schade-lagertechnik.comSEE OUR AD ON PAGE 29

Storage - Bins

Hoff mann, Inc.

6001 49th St. SouthMuscatine, IA 52761Paul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)sales@hoff manninc.comwww.hoff manninc.com

Jeff rey Rader,

P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)mabull@kogerair.comwww.kogerair.com

packIQ

1 American WayAnderson, SC 29621Than Nguyen, ConsultantPhone (877-233-8668)packiq@greenpeas.comhttp://packiq.com

Storage - Other

Storage - Silos

Material Handling & Storage Screens-Fines

W E C O N V E Y Q U A L I T Y

SCHADE Stockyard Equipment for Wood Pellets

SCHADE Lagertechnik GmbH Bruchstraße 1 45883 Gelsenkirchen Germany sales@schade-lagertechnik.com www.schade-lagertechnik.com

Material Handling & StorageJeff rey Rader,

SHW Storage &

www.shw-shs.com

Storage – Silo Reclaimer

ANDRITZ

Jeff rey Rader,

SHW Storage &

www.shw-shs.com

Trailer - Moving Floor

Hallco Industries Inc.

PO Box 505Tillamook, OR 97141Ricardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)ricardo@hallcoindustries.comwww.hallcoindustries.com

Transportation - Barge

Ingram Barge Company

4400 Harding PikeNashville, TN 37205Blake Roberson, Senior Business Development AnalystPhone (615-298-7589)blake.roberson@ingrambarge.comwww.ingrambarge.com

Cooper/Consolidated

1127 Highway 190, East Service RoadCovington, LA 70433Brent Mahana, Sales DirectorPhone (985-871-4403)brent.mahana@cgb.comwww.cooperconsolidated.com

Transportation - Rail

Iowa Northern Railway

305 2nd St SESuite 400Cedar Rapids, IA 52401William Rhodes, Director Reload MarketingPhone (3194158150)wrhodes@iowanorthern.comwww.iowanorthern.com

TrinityRail

2525 Stemmons FreewayDallas, TX 75207Gregg Yates, Director, MarketingPhone (214-631-4420) | Fax (214-589-8623)gregg.yates@trinityrail.comwww.trinityrail.com

Transportation - Truck

AAA Cooper Transportation

1751 Kinsey Rd. Dothan, AL 36303Buddy Turner, Director - Bulk ServicesPhone (251-589-2348)buddy.turner@aaacooper.comwww.aaacooper.com

Truck Receiving/Dumpers

Airofl ex Equipment

6001 49th St. SouthMuscatine, IA 52761Andy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)sales@airofl exequipment.comwww.airofl exequipment.com

Vibration Equipment

Martin Engineering

Material Handling & Storage Storage - Silos

Publications

Biodiesel Magazine

308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.biodieselmagazine.com

Biomass Magazine

308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.biomassmagazine.com

Ethanol Producer Magazine

308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.ethanolproducer.com

Pellet Mill Magazine

308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.biomassmagazine.com/pellets

30 | 2014 Biomass Industry Directory Handling a World of MaterialsThe brands comprising TerraSource Global (Gundlach Crushers, Jeffrey Rader and Pennsylvania Crusher) are wholly-owned subsidiaries of Hillenbrand, Inc. (NYSE: HI) © 2014 TerraSource Global. All Rights Reserved.

Proven Solutions for your Biomass Applications

Email: info@terrasource.com Web: www.terrasource.com/bm

Pneumatic &MechanicalBoiler Feeds

ChipThicknessScreening

BiomassMaterialHandling

Storage &Reclaim

Equipment

Crushers,Feeders& Sizers

UnmatchedParts and

ServiceStore, reclaim,

convey and feed biomass and

alternative fuels directly into

boilers and kilns.

Chip screening, air density separation and overthick chip

conditioning or sizing for digester

optimization.

Support for biomass energy generation

from truck/rail receiving through

metered infeed into the boiler.

Open air or enclosed storage

with circular or linear design

your application.

Primary and secondary crushing as well as multiple feeder options to process coal and

biomass.

Replacement parts, OEM

installation,start-up, training

and repair.

3 market-leading brands trusted and recognized throughout the world, 1 source.

Air Pollution Control

ALSTOM Power, Inc-Environmental

Control Solutions

1409 Center Point Blvd.Knoxville, TN 37932Mark Walters, Business Sales ManagerPhone (770-876-1163)mark.walters@power.alstom.comwww.power.alstom.com

Bionomic Industries

777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)sales@bionomicind.comwww.bionomicind.com

NESTEC Inc.

21 Unionville RoadP.O. Box 568 Douglassville, PA 19518Jim Nester, PresidentPhone (610-323-7670) | Fax (610-323-7672)sales@nestecinc.comwww.nestecinc.com

Anguil Environmental Systems, Inc.

8855 North 55th StreetMilwaukee, WI 53223Kevin Summ, Marketing ManagerPhone (414-365-6400) | Fax (414-365-6410)sales@anguil.comwww.anguil.com

Babcock Power Environmental

5 Neponset StreetWorcester, MA 01615 Jennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 5

CLARCOR Industrial Air

11501 Outlook Street, Suite 100Overland Park, KS 66210Tim Stark, Director Aftermarket SalesPhone (816-313-4955)timothy.stark@clarcor.comwww.BHA.com

Media Publications

Process Equipment & Services

Process Equipment & ServicesEcospray Technologies S.r.l.

5 Thawmont DriveSewickley, PA 15143Jo Ann Pacinelli, North AmericaPhone (412-427-0133) | Fax (412-741-8386)pacinelli@ecapitalexchange.comwww.ecospray.eu

Eisenmann

150 E Dartmoor DriveCrystal Lake, IL 60014 John McDowell, Sales EngineerPhone (815-477-5335)john.mcdowell@eisenmann.comwww.eisenmann.us.com

Redecam USA

2125 Barrett Park Drive, Suite 112BKennesaw, GA 30144Rick Davies, Managing Director, V.P. N. America at REDECAM USAPhone (678-909-2342) | Fax (678-909-2359)www.redecam.com

SysTech Design, Inc.

300 North Pottstown PikeExton, PA 19341John Conley , OwnerPhone (800-456-9460)info@systech-design.comwww.systech-design.com

Binders & Surfactants

Emisshield Inc.

2000 Kraft DriveSuite 2600Blacksburg, VA 24060Tim Wilson, Project ManagerPhone (540-961-0999)tim.wilson@emisshield.comwww.emisshield.com

Biogas-Capture

Bionomic Industries

Geomembrane Technologies Inc. (GTI)

370 Wilsey RoadFredericton, AB E3B 6E9 CanadaDarin Evans, Manager, Product DevelopmentPhone (1.506.452.7304) Fax (1.506.452.6625)covers@gticovers.comwww.gticovers.com

Biogas-Purifi cation

Beltran Technologies, Inc.

1133 East 35 StreetBrooklyn, NY 11210Gary Siegel, Marketing DirectorPhone (718-338-3311) | Fax (718-253-9028)gary@beltrantechnologies.comwww.beltrantechnologies.comSEE OUR AD ON PAGE 32

Bionomic Industries

Clean Methane Systems LLC

19125 SW 125th CTTualatin, OR 97062Timothy Robinson, PresidentPhone (425-420-1979) | Fax (425-491-7740)TimR@methanesys.comwww.methanesys.com

Spencer Turbine Company

600 Day Hill RoadWindsor, CT 06095Chet Adamczyk, Sr Sales Engr - Biogas & WWT Phone (860-688-8361) | Fax (860-688-0098)cadamczyk@spencer-air.comwww.spencerturbine.com

Boilers - Direct Fired

Northwest Manufacturing, Inc./

WoodMaster

600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) | Fax (218-253-4409)tstrem@woodmaster.comwww.woodmaster.comSEE OUR AD ON PAGE 43

Hurst Boiler & Welding Co., Inc.

100 Boilermaker LaneCoolidge, GA 31738Jeff Hurst, Director, Sales & MarketingPhone (229-346-3545)jhurst@hurstboiler.comwww.hurstboiler.comSEE OUR AD ON PAGE 2

Indeck Power

1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)llindell@indeck-power.comwww.indeck.comSEE OUR AD ON PAGE 38

Process Equipment & Services Air Pollution Control

Beltran Technologies, Inc.1133 East 35th St., Brooklyn, NY 11210 USA718.338.3311 • Fax: 718.253.9028info@beltrantechnologies.comwww.beltrantechnologies.com

BELTRANTECHNOLOGIES, INC.

FROM WASTE TO WATTS:THE BELTRAN BIOMASS GASIFICATION SYSTEM

Ask for our free TECH REPORT, From Waste to Watts.

Beltran’s advanced technology convertscarbon-based waste into profitablebioenergy, biofuels and co-products your company can use now!

• Biomass feedstock-flexible system can use low-value agricultural, animal, industrial, wood or municipal wastes.

• Produces clean-burning, multi-use synthesis gas, combined heat & power (CHP), biofuels, hydrogen, marketable chemicals.

• Advanced gasification reactor, wet electrostatic precipitator and engine-generator are closely integrated for optimum efficiency.

• Scalable, adaptable solution for harvesting safe, renewable energy, reducing pollution and CO2, and turning costly waste into sustainable profit.

Boilers - Firetube

Indeck Power

Boilers - Fluidized Bed

Valmet, Inc.

3430 Toringdon WaySuite 201Charlotte, NC 28277Kerry Flick, Director, TechnologyPhone (704-541-1453)kerry.fl ick@valmet.comwww.valmet.com

ANDRITZ

Indeck Power

Outotec Energy Products

3568 W Industrial LoopCoeur d’Alene, ID 83815Kent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)cda.sales@outotec.comwww.outotec.com

Boilers - Hot Water

WoodMaster

Biomass Heating Solutions

201 East 12th StreetAlturas, CA 96101Terry Olson, OwnerPhone (530-640-1072) | Fax (530-233-3450)haciendamotel@frontiernet.net

Biomass Systems Supply

P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) | Fax (530-893-2444)info@biomasssystemssupply.comwww.biomasssystemssupply.com

Indeck Power

Viessmann Manufacturing Company

(U.S.), Inc.

45 Access RoadWarwick, RI 02886Lee Gustafson, MarketingPhone (401-732-0667) | Fax (401-732-0590)gusl@viessmann.comwww.uncompromise.us

Webiomass Inc.

16 Washington St (mail)56 Howe St (plant)Rutland, VT 05701George Robbins, PresidentPhone (802-772-7563) | Fax (802-772-7564)george@webiomass.comwww.webiomass.com

Boilers - Parts & Service

Boiler Tube Company of America

506 Charlotte HighwayLyman, SC 29365Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/boiler-tube-co-of-americaSEE OUR AD ON PAGE 5

EquipNet, Inc.

5 Dan RoadCanton, MA 02021Emily Coleman

Phone (781-821-3482) | Fax (617-671-1269)sales@equipnet.comwww.equipnet.com

Process Equipment & Services Boilers - Firetube

Rotary Cascading Bed

Combustor Boiler (RCBC)

• Combust gases, MSW, sludge and liquids

• Produce steam and electricity

• No health and environmental hazards

• Ash co-product for fertilizer and land reclamation

• ASME Approved

Revolutionary New

Process Turns

Garbage into Energy

info@rcbcglobalinc.com

www.RCBCglobalinc.com

800-696-2110

Process Equipment & ServicesIndeck Power

1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) Fax (847-541-9984)llindell@indeck-power.comwww.indeck.comSEE OUR AD ON PAGE 38

Riley Power Inc.

5 Neponset StreetWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 5

Welding Technologies

2330 Centennial DriveGainesville, GA 30504Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/welding-technologiesSEE OUR AD ON PAGE 5

Boilers - Solid Fuel

WoodMaster

600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) Fax (218-253-4409)tstrem@woodmaster.comwww.woodmaster.comSEE OUR AD ON PAGE 43

P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) Fax (530-893-2444)info@biomasssystemssupply.comwww.biomasssystemssupply.com

EcoHeat Solutions LLC

153 Washington StBox B 9East Walpole, MA 02032George Whiting, PresidentPhone (877-317-0700)gwhiting@ecoheatsolutions.comwww.ecoheatsolutions.com

GARN Wood Heating

3425 33rd Ave. NEMinneapolis, MN 55418 USMartin Lunde, PresidentPhone (612-326-1104)martin@garn.comwww.GARN.com

Boilers - Steam

Babcock Power Services

5 Neponset StWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)jpasquariello@babcokpower.comwww.babcockpower.com/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 5

P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) Fax (530-893-2444)info@biomasssystemssupply.comwww.biomasssystemssupply.com

Indeck Power

Boilers - Waste Heat

Recovery

Indeck Power

RCBC Global Inc.

401 North Main St., Suite 201Hendersonville, NC 28792Doug King, VP MarketingPhone (828-696-2111)recycle@a-o.comwww.rcbcglobalinc.com

Centrifuges

Dedert Corporation

Hydro-Thermal Corp.

400 Pilot CourtWaukesha, WI 53188Sales Department

Phone (262-548-8900) Fax (262-548-8908)info@hydro-thermal.comhttp://www.hydro-thermal.com

Pick Heaters, Inc.

730 S. Indiana Ave.PO Box 516West Bend, WI 53095Sales Dept.

Phone (262-338-1191) Fax (262-338-8489)info1@pickheaters.comwww.pickheaters.com

Cleaning

Seneca Companies

7241 Gaines Street CourtDavenport, IA 52806Chris Biellier, Waste Solutions General ManagerPhone (563-343-4679)cbiellier@senecaco.comwww.senecaco.com

Combustion Equipment

Detroit Stoker Company

1510 East First StreetMonroe, MI 48161Tim Loviska, Director - Contract SalesPhone (734-241-9500) Fax (734-241-7126)sales@detroitstoker.comwww.detroitstoker.comSEE OUR AD ON PAGE 34

Condensors

Thermal Engineering Int’l (USA)

10375 Slusher DriveSanta Fe Springs, CA 90670Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 5

Control Systems

Beijer Electronics

1865 West 2100 SouthSalt Lake City, UT 84119Jeff Hayes, Product ManagerPhone (801-466-8770)jeff .hayes@beijerinc.comwww.beijerinc.com

Process Equipment & Services Boilers-Parts & Service

Process Equipment & Services4B Components Ltd.

Cogent Industrial Technologies

Suite 180 - 13091 Vanier PlaceRichmond, BC V6V 2J1 CanadaBijan Shams, PresidentPhone (604-207-8880)bijan.shams@cogentind.comwww.cogentind.com

SoftPLC Corporation

25603 Red BrangusSpicewood, TX 78669Cindy Hollenbeck, VPPhone (512-264-8390)cindy@softplc.comsoftplc.com

Cooling Towers

Tower Performance, Inc.

4031 BroadwayHouston, TX 77087Jalene Fritz, Parts ManagerPhone (970-593-8637) | Fax (970-472-1304)jfritz@towerperformance.comwww.coolingtowercomponents.com

Digester-Covers

Geomembrane Technologies Inc. (GTI)

370 Wilsey RoadFredericton, AB E3B 6E9 CanadaDarin Evans, Manager, Product DevelopmentPhone (1.506.452.7304) | Fax (1.506.452.6625)covers@gticovers.comwww.gticovers.com

Dust Control - Baghouses

Scientifi c Dust Collectors

4101 W. 126th StreetAlsip, IL 60007Andrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)arutherford@scientifi cdust.comscientifi cdustcollectors.com

Dust Control - Inertial Separators

Bionomic Industries

Process Equipment & Services Control Systems

Process Equipment & ServicesKoger Air Corporation

Pinnacle Air Pollution Control

1177 Pittsburgh RoadSuite 203Valencia, PA 16059-3137Anthony Brajdic, Director of OperationsPhone (724-898-1220) | Fax (724-898-2229)pinnacleair@hotmail.compinnacleair.qpg.com

Dust Control

- Unit Collectors

Martin Engineering

Dust Control - Wet

Scrubbers

Bionomic Industries

Energy Management

SABIA Inc

10911 Technology PlSan Diego, CA 92127Paul Iverson, Product ManagerPhone (858-217-2232) | Fax (858-217-2203)piverson@sabiainc.comwww.sabiainc.com

Environmental Testing

Air Compliance Testing, Inc.

10060 Brecksville RoadSuite 1120Cleveland, CA 44141Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comhttp://www.montrose-env.com/

Avogadro Environmental Corporation

1350 Sullivan TrailSuite AEaston, CA 18040Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comhttp://www.montrose-env.com/

Bighorn Environmental Air Quality, LLC

1324 N Liberty Lake Road #266 Liberty Lake, WA 99019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Class One Technical Services, Inc.

3500 Camanche Rd NESuite GAlbuquerque, NM 87107Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Delta Air Quality Services, Inc.

1845 North Case Street Orange, CA 92865Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Eastmount Environmental Services, LLC

2 New Pasture RoadUnit #5Newburyport, CA 01950Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Emission Testing Services, Inc.

10461 Mammoth AveBaton Rouge, LA 70814Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

MEC Entec Services, LCC

30 Monroe DriveP.O. Box 1059Pelham, AL 35124Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Montrose Air Quality Services, LCC

4210 Resnik CourtSuite 200Bakersfi eld, CA 93313Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Montrose Environmental Group, Inc.

2 Park Plaza Suite 1120Irvine, CA 92614Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935) | Fax (925-429-9042)emirabella@montrose-env.comwww.montrose-env.com

1582-1 N. Batavia StreetOrange, CA 92867Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comhttp://www.montrose-env.com/

South Florida Environmental

Services, LLC

2257 Vista ParkwayUnit 25West Palm Beach, FL 33411Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

The Air Compliance Group, LLC

5075 Hollins RoadRoanoke, VA 24019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

The Avogadro Group, LLC

2825 Verne Roberts CircleAntioch, CA 94509Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

AirPro Fan & Blower Co.

PO Box 543Rhinelander, WI 54501Keith White, Sales EngineerPhone (715-365-3267)sales@airprofan.comwww.airprofan.com

Jenkins & Brandt

PO Box 80609Atlanta, GA 30066Rick Brandt, PartnerPhone (770-650-7295) | Fax (678-594-0825)sales@jenkinsandbrandt.comwww.jenkinsandbrandt.com

Spencer Turbine Company

600 Day Hill RoadWindsor, CT 06095Chet Adamczyk, Sr Sales Engr - Biogas & WWT Phone (860-688-8361) | Fax (860-688-0098)cadamczyk@spencer-air.comwww.spencerturbine.com

Filters

Orival, Inc.

213 S. Van Brunt StreetEnglewood, NJ 47352Marcus Allhands, Vice President of Business DevelopmentPhone (201-568-3311) | Fax (201-568-1916)ma@orival.comwww.orival.com

Fire Protection

FLAMEX, Inc

4365 Federal DriveGreensboro, NC 27410Allen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)fl amex@sparkdetection.comwww.sparkdetection.com

CV Technology

15852 Mercantile CourtJupiter, FL 33478Nicholas Licht, Sales Engineer Phone (561-694-9588) | Fax (561-694-9585)nlicht@cvtechnolgoy.comwww.cvtechnology.com

GreCon Spark Detection

15875 SW 74th Ave.Tigard, OR 97224Terry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)sales@grecon-us.comwww.grecon-us.com/spark-detection/SEE OUR AD ON PAGE 37

Furnaces

WoodMaster

Process Equipment & Services Dust Control - Inertial Separators

Process Equipment & ServicesFurnaces

REBL Refractories Evaluations

Laboratory, ULC

#109, 8484 162nd StreetSurrey, BC V4N 1B4 CanadaBryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)bryce.jardine@rebl.comwww.rebl.com

Generator-Diesel / Biodiesel

Indeck Power

Generator-Natural Gas /

Biogas

Generator-Steam Turbine

Elliott Group

901 North Fourth StreetJeannette, PA 15644Phil Rutkowski, Sales ManagerPhone (303-503-1134)PRutkows@elliott-turbo.com

Triveni Turbine Ltd.

12A, Peenya Industrial AreaBangaloreBangalore, 560058 IndiaDeepak Nayak, Asst. Gen. Manager-International Sales & MarketingPhone (918022164000) Fax (918028395945)deepakpnayak@triveniturbines.comwww.triveniturbines.com

Vogt Power International

13551 Triton Park BoulevardSuite 2000Louisville, KY 40223Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/heat-recovery-systems/vogt-power-internationalSEE OUR AD ON PAGE 5

Heat Exchangers-Direct

Contact

Bionomic Industries

Direct Contact LLC

2555 34th Street NECanton, OH 44708Curt Rothman, CEOPhone (330-437-0444)crothman@dciheat.comwww.dciheat.com

Hydro-Thermal Corp.

Phone (262-548-8900) | Fax (262-548-8908)info@hydro-thermal.comhttp://www.hydro-thermal.com

Pick Heaters, Inc.

730 S. Indiana Ave.PO Box 516West Bend, WI 53095Sales Dept.

Phone (262-338-1191) | Fax (262-338-8489)info1@pickheaters.comwww.pickheaters.com

Heat Exchangers-Phase-

Change

AMSEnergy Corp.

1111 Bear Creek PikeColumbia, TN 38401Michael Sams, President & CEOPhone (615-852-8412)info@amsenergy.comwww.amsenergy.com

Heat Exchangers-Shell &

Dedert Corporation

17740 Hoff man WayHomewood, IL 60430Dale Stenning, V.P. Manager Evaporator DivisionPhone (708-747-7000)d.stenning@dedert.comwww.dedert.com

Indeck Power

Thermal Engineering Int’l (USA)

10375 Slusher DriveSanta Fe Springs, CA 90670Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 5

Heat Exchangers-Waste

Heat Recovery Unit

Bionomic Industries

Indeck Power

Hoppers

Instrumentation

Conveyor Components Company

130 Seltzer RoadPO Box 167Croswell, MI 48422Rich Washkevich, Sales ManagerPhone (810-679-4211) | Fax (810-679-4510)info@conveyorcomponents.comwww.conveyorcomponents.com

Levelese, Inc.

326 Steele StDenver, CO 80206Sallyanne Ofner, PresidentPhone (303-586-1425)info@levelese.comhttp://www.levelese.com

Siemens Industry Inc.

7101 Hollister RoadHouston, TX 77040Customer Service, Phone (713-939-7400)processanalyticssales.industry@siemens.comusa.siemens.com/processanalytics

Sierra Instruments, Inc.

5 Harris CourtBuilding LMonterey, CA 93940Scott Rouse, Product Line DirectorPhone (831-373-0200) | Fax (831-373-4402)s_rouse@sierrainstruments.comwww.sierrainstruments.com

Laboratory Equipment

COSA Xentaur Corp.

84G Horseblock RdUnit GYaphank, NY 11980Colin Mueller, Marketing DirectorPhone (631-345-3434)c.mueller2@cosaxentaur.comwww.cosaxentaur.com

Elementar Americas

520 Fellowship Rd, Ste D-408Mt Laurel, NJ 08054Jean Bernius, Marketing ManagerPhone (856-787-0022)jean.bernius@elementaramericas.comwww.elementaramericas.com

HEMCO Corporation

711 South Powell RoadIndependence, MO 64056Jerry Schwarz, Marketing / AdvertisingPhone (800-779-4362) | Fax (816-796-3333)info@hemcocorp.comwww.HEMCOcorp.com

Team Biogas®

23551 Rose Quartz DrivePerris, CA 92570Fabian Villanueva, Sales ManagerPhone (951-943-9697)fabian@seahold.comwww.teambiogas.com

Laboratory Services

Twin Ports Testing

1301 North 3rd StreetSuperior, WI 54880Stephen Sundeen, Laboratory ManagerPhone (800-373-2562) | Fax (715-392-7163)stephen.sundeen@twinportstesting.comwww.twinportstesting.com

Associated Laboratories

806 N. Batavia St.Suite 1120Orange, CA 92868Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Process Equipment & Services Furnaces

Biomass Energy Lab

1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)info@biomassenergylab.combiomassenergylab.com

Celignis Limited

T1-014 Tierney Building, University of LimerickLimerick, L111 IrelandDaniel Hayes

Phone (353894555582)dan@celignis.comwww.celignis.com

R. W. Heiden Associates LLC

1026 New Holland AvenueP O Box 5001Lancaster, PA 17601Richard Heiden, Chief Science and Technology Offi cerPhone (717-299-6860) | Fax (717-299-6868)Rwheidenphd@supersleuthchemists.comwww.supersleuthchemists.com

SciTech Group

Tekniikantie 12Espoo, 02150 FinlandJarno Hartikainen, ChemistPhone (358503411998)jarno.hartikainen@scitech.fi www.scitech.fi

Timber Products Inspection

1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)thippchen@tpinspection.comtpinspection.com

Lubricants

Ayalytical Instruments

2701 W. Fulton St. #5SChicago, IL 60612Juan Ayala, Managing DirectorPhone (312-622-7520)juan@ayalytical.comwww.ayalytical.com

Mixers/Agitators

Hydro Dynamics, Inc.

8 Redmond Court NWRome, GA 30165Douglas Mancosky, VP - Research & DevelopmentPhone (706-234-4111) | Fax (706-234-0702)jdunn@hydrodynamics.comwww.hydrodynamics.com

Moisture Analyzers

GreCon Moisture Meters

15875 SW 74th AveTigard, OR 97224Marshall LLoyd, SalesPhone (503-641-7731) | Fax (503-641-7508)sales@grecon-us.comwww.grecon-us.com/measurement/ infrared-moisture-meterSEE OUR AD ON PAGE 37

Process Equipment & Services Laboratory Services

Moisture Analyzers

MOISTTECH

P O Box 118Tallevast, FL 34270-0118John Fordham, ManagerPhone (941-351-7870)jfordham@moisttech.comwww.moistech.com

NDC Technologies

5314 North Irwindale AvenueIrwindale, CA 91706Ray Shead, Marketing ManagerPhone (626-939-3856) | Fax (626-939-3870)rshead@ndc.comwww.ndc.com

Operations &

Maintenance (O&M)

Imerys

100 Mansell Court E.Suite 300Roswell, GA 30076Emmy Bracoud, Marketing AnalystPhone (678-579-2095)aurora@imerys.comwww.imerys-aurora.com

Pipe-Fittings

Modern Industrial

2012 Highway 160 W, Suite 9Fort Mill, SC 29708Jon Payne, PresidentPhone (888-517-2310)marketing@modernindustrial.comwww.modernindustrial.com

Pipe-Flanges

Gorman-Rupp Company

600 S. Airport Rd.Mansfi eld, OH 44903Scott Derkez, National Sales ManagerPhone (419-755-1011) | Fax (419-755-1251)sderkez@gormanrupp.comwww.GRpumps.com

Safety

Martin Engineering

Exponent

4580 Weaver ParkwaySuite 100Warrenville, IL 60555Mark Fecke, Senior Managing EngineerPhone (630-658-7512)mfecke@exponent.comwww.exponent.com/

IEP Technologies

417-1 South StreetMarlborough, MA 01752John Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)john.shea@IEPTechnologies.comwww.IEPTechnologies.comSEE OUR AD ON PAGE 40

Sensors

4B Components Ltd.

Cornerstone Systems Ltd

Whitebridge WayStone, ST15 8LQ Great BritainGareth Hughes, DirectorPhone (01785818020) | Fax (01785811699)gareth@cornerstonesystems.co.ukwww.CornerstoneSystems.co.uk

Optek-Danulat, Inc.

N118W18748 Bunsen DrGermantown, WI 53022Joe Ferrelli, Product SpecialistPhone (888-901-4288)biotech@optek.comwww.optek.com

Sierra Instruments, Inc.

5 Harris CourtBuilding LMonterey, CA 93940Scott Rouse, Product Line DirectorPhone (831-373-0200) | Fax (831-373-4402)s_rouse@sierrainstruments.comhttp://www.sierrainstruments.com/

Separators

Dedert Corporation

17740 Hoff man WayHomewood, IL 60430Dale Stenning, V.P. Manager Evaporator DivisionPhone (708-747-7000)d.stenning@dedert.comwww.dedert.com

Separators-Magnetic

Puritan Magnetics, Inc.

900 S. Glaspie StreetOxford, MI 48371Andrea Webster, Sales & MarketingPhone (248-628-3808) | Fax (248-628-3844)magnet@puritanmagnetics.comwww.puritanmagnetics.com

Process Equipment & Services Moisture Analyzers

Valves

Asahi/America

655 Andover StLawrence, MA 01843Jeff Baker, Marketing ManagerPhone (781-321-5409)jbaker@asahi-america.comwww.asahi-america.com

Everlasting Valce Company

108 Somogyi CourtSouth Plainfi eld, NJ 07080David Jenkins, General Sales ManagerPhone (908-769-0700) | Fax (908-769-8697)djenkins@everlastingvalveusa.comwww.everlastingvalveusa.com

Modern Industrial

2012 Highway 160 W, Suite 9Fort Mill, SC 29708Jon Payne, PresidentPhone (888-517-2310)marketing@modernindustrial.comwww.modernindustrial.com/

VOC Scrubbers

NESTEC Inc.

21 Unionville RoadP.O. Box 568 Douglassville, PA 19518Jim Nester, PresidentPhone (610-323-7670) | Fax (610-323-7672)sales@nestecinc.comwww.nestecinc.com

Bionomic Industries

Wastewater Treatment

ADI Systems Inc.

370 Wilsey RoadFredericton, AB E3B 6E9 CanadaScott Christian, Vice President, Business DevelopmentPhone (506-452-7107)scott.j.christian@adi.cawww.adisystemsinc.com

SHW Storage &

www.shw-shs.com

Water Treatment

Hydro-Thermal Corp.

Phone (262-548-8900) | Fax (262-548-8908)info@hydro-thermal.comhttp://www.hydro-thermal.com

Process Equipment & Services Valves

Project Development & FinanceAccounting

Christianson & Associates, PLLP

302 SW 5th StWillmar, MN 56201Bradley Pederson, PartnerPhone (320-235-5937) | Fax (320-235-5962)bpederson@christiansoncpa.comwww.christiansoncpa.com

Business Plans

10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)myancey@bbiinternational.comwww.bbiinternational.comSEE OUR AD ON PAGE 13

302 SW 5th StWillmar, MN 56201Sherry Jean Olson, ManagerPhone (320-235-5937) | Fax (320-235-5962)solson@christiansoncpa.comwww.christiansoncpa.com

On The Green, LLC

10116 Daniels Run WayFairfax, VA 22030Mary Valenta, CEOPhone (205-266-3393)mvalenta@onthegreenlllc.netonthegreenllc.net

Debt Financing

Gateway Commercial Finance, LLC

340 SE 1st StreetDelray Beach, FL 33483Marc Marin, Managing DirectorPhone (855-424-2955) | Fax (561-734-2708)gateway@gatewaycfs.comhttp://gatewaycfs.com

MKL Capital LLC

Box 963Bronxville, NY 10708Brian Morrison, Managing DirectorPhone (917-653-3017)bam@mklcapital.com

Due Diligence

Arc5 Environmental Consulting LLC

20 Rockwood LnGroton, MA 01450David Minott, PresidentPhone (978-877-7719)david.minott@arc5enviro.comwww.arc5enviro.com

Luminate, LLC

1801 BroadwaySuite 1620Denver, CO 80202Michael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)mike.robinson@luminatellc.comwww.luminatellc.com

Renewable Strategies, Inc.

PO Box 185Shoreham, VT 05770Douglas Patterson, PresidentPhone (802-989-0476)doug@renewablestrategies.com

Economic Development

Green Science Corporation

www.greensciencecorp.com

Feasibility Studies

10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)myancey@bbiinternational.comwww.bbiinternational.com SEE OUR AD ON PAGE 13

LMC International Ltd

1841 Broadway, 611New York, NY 10023Andrea Kavaler, Executive Vice PresidentPhone (212-586-2427)info@lmc-ny.comwww.lmc.co.uk

302 SW 5th StWillmar, MN 56201Sherry Jean Olson, ManagerPhone (320-235-5937) | Fax (320-235-5962)solson@christiansoncpa.comwww.christiansoncpa.com

Enerion Biomass Solutions

Av. 27 de Febrero n. 233, Torre Corp. Corominas Pepín, 4th Floor Ensanche NacoSanto Domingo, 10150 Dominican RepublicAlessandro Pozzi, Phone (00393470449209)a.pozzi@enerionbiomass.comwww.enerionbiomass.com

General Biomass Company

2906 Central StreetSuite 134Evanston, IL 60201Daniel Gibbs, CEOPhone (847-624-3590)dgibbs@generalbiomass.comwww.generalbiomass.com

Project Development

Formerly Fenwal Explosion Protection

Project Development & Finance

Feasibility Studies Solar Turbines Incorporated

Wood Waste to Rural Heat

110A Slater Road NWCranbrook, BC V1C 5C8 CanadaDavid Dubois, Project CoordinatorPhone (250-489-4356) | Fax (250-489-1886)info@cfek.cawww.woodwaste2ruralheat.ca

Feedstock Pricing

Ecostrat Inc.

60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaBrett Hogarth, Head of Business DevelopmentPhone (416-968-8884 ext. 239) Fax (416-968-8886)brett.hogarth@ecostrat.comwww.ecostrat.com

Insurance

FieldEddy Division of Hub International

New England LLC

PO Box 70996 Shaker RdEast Longmeadow, MA 01028Teresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)teresa.petitdemange@hubinternational.comwww.fi eldeddy.com

Market Data

Bioenergy Insight

124 Middleton RoadMordenSurrey SM4 6RW, Great BritainPeter Patterson, Managing DirectorPhone (442086487082)peter@horseshoemedia.comwww.bioenergy-news.com

LMC International Ltd

1841 Broadway, Rm 611New York, NY 10023Andrea Kavaler, Executive Vice PresidentPhone (212-586-2427)info@lmc-ny.comwww.lmc.co.uk

4 Alfred CircleBedford, MA 01730Seth Walker, Bioenergy EconomistPhone (781-734-8992)swalker@risi.comwww.risi.com

Mergers & Acquisitions

Maas Companies

PO Box 7127Rochester, MN 55903Tyler Maas, Director of Sales and MarketingPhone (507-285-1444) | Fax (507-285-0034)maas@maascompanies.comwww.maascompanies.com

Recast Energy LLC

8730 Stony Point ParkwaySuite 100Richmond, VA 23235Brandon Ogilvie, CFOPhone (804-212-3143)bogilvie@recastenergy.comwww.recastenergy.com

Permitting-Air

Arc5 Environmental Consulting LLC

20 Rockwood LnGroton, MA 01450David Minott, PresidentPhone (978-877-7719)david.minott@arc5enviro.comwww.arc5enviro.com

Air Resource Specialists, Inc.

1901 Sharp Point Drive, Suite EFort Collins, CO 80525Howard Gebhart, Manager, Environmental Compliance SectionPhone (970-484-7941)hgebhart@air-resource.comwww.air-resource.com

RTP Environmental Associates, Inc.

400 Post AveSuite 405Westbury, NY 11590 USJessica Karras-Bailey, PrincipalPhone (516-333-4526) | Fax (516-333-4571)bailey@rtpenv.comwww.rtpenv.com

Project Development & Finance Feasibility Studies

No matter what you’re processing – chemicals, food, pharmaceuticals,

biomass, wood products – if it produces dusts or powders, there’s a high

probability you have an explosion risk. All it takes to interrupt your plant

productivity is a combustible material, oxygen and an ignition source.

For more than six decades, IEP Technologies has provided the right

explosion protection solution for every type of process application.

From cyclone separators and dust collectors to milling equipment and

dryers. We can analyze your challenge, design a protection system and

surround you with 24/7 service and support. Protecting your plant starts

with knowing your explosion risk.

Let’s develop a solution for you

Call the IEP engineering experts with the most experience in explosion protection at 1-855-793-8407 or visit IEPTechnologies.com.

P R O T E C T I N G T H E W O R L D ’ S P R O C E S S E S A G A I N S T E X P L O S I O N

Project Development & Finance

Project Development & Finance Permitting -Other

Permitting-Other

Life Cycle Associates, LLC

884 Portola RoadSuite A11Portola Valley, CA 94028Stefan Unnasch, Managing DirectorPhone (650-461-9048)unnasch@lifecycleassociates.com

Risk Management

ATI Systems

30 Jeff ries St.East Boston, MA 02128Troy Fergus, Business DeveloperPhone (617-567-4969)tfergus@atisystem.comwww.atisystem.com

Valuation and Assets Services

2108 Carroll Creek ViewFrederick, MD 21702K. Boison, PrincipalPhone (301-646-4119)projects@valuationandassets.comhttp://www.valuationandassets.com

Site Selection

Ecostrat Inc.

60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaBrett Hogarth, Head of Business DevelopmentPhone (416-968-8884 ext. 239) Fax (416-968-8886)brett.hogarth@ecostrat.comwww.ecostrat.com

Software-Accounting

302 SW 5th St Willmar, MN 56201Fred Gould, Business Development ManagerPhone (320-235-5937) Fax (320-235-5962)fgould@christiansoncpa.comwww.christiansoncpa.com

Research & DevelopmentGovernment

Arizona State Forestry Division

3650 Lake Mary RdFlagstaff , AZ 86005Patrick Rappold, Wood Utilization & Marketing SpecialistPhone (928-774-1425)patrickrappold@azsf.govwww.azsf.az.gov

Kentucky Division of Biofuels

500 Mero Street, 6th FloorFrankfort, KY 40601Tim Hughes, DirectorPhone (502-564-7192) | Fax (502-564-7406)TimD.Hughes@KY.Govenergy.ky.gov/biofuels/Pages/default.aspx

Private

Biofuels Technology LLC

1201 Orange StreetSuite 600Wilmington, DE 19801Andrew Laitt, CEOPhone (302-966-9235)alaitt@biofuelstech.comwww.biofuelstech.com

American Science and Technology

1367 W. Chicago Ave.Chicago, IL 60642Ali Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)am@amsnt.comwww.amsnt.comSEE OUR AD ON PAGE 55

Research & Development

Private

Cellulose Pilot and Processing Lab

6445 Packer Dr.Wausau, WI 54401Eric Singsaas, DirectorPhone (715-340-2591)Eric.Singsaas@uwsp.edu SEE OUR AD ON PAGE 55

Centre for Process Innovation

Wilton Centre, WiltonRedcar, TS10 4RF Great BritainLiz Grylls Phone (441642455340)liz.grylls@uk-cpi.comhtt://www.uk-cpi.com

FPInnovations

319, rue FranquetPointe-Claire, QB G1P 4R4 CanadaPhone (418-781-6722)info@fpinnovations.cawww.fpinnovations.comSEE OUR AD ON PAGE 44

Refi ned BioProducts

1718 Pine StreetStevens Point, WI 54481John Leschke, New Business DevelopmentPhone (715-869-7866)jleschke@refi nedbioproducts.comwww.refi nedbioproducts.com SEE OUR AD ON PAGE 55

University

Food & Fuel for the 21st Century

9500 Gilman Dr.MC: 0368La Jolla, CA 92093Travis Johnson, Program CoordinatorPhone (858-534-6383)tlj002@ucsd.eduff 21.ucsd.edu

Iowa State University BioCentury

Research Farm

1041 Food Sciences Bldg.Ames, IA 50011-1061Lawrence Johnson, DirectorPhone (515-294-4365) | Fax (515-294-6261)ljohnson@iastate.eduwww.biocenturyresearchfarm.iastate.edu

Oklahoma State University

Biosystems and Agricultural Engineering214 Agricultural HallStillwater, OK 74078Hasan Atiyeh, Associate Professor, BioprocessingPhone (405-744-8397) | Fax (405-744-6059)hasan.atiyeh@okstate.eduatiyeh.okstate.edu

UMD Natural Resources Research

Institute

5013 Miller Trunk HighwayDuluth, MN 55811June Kallestad, Public Relations ManagerPhone (218-720-4300)jkallest@d.umn.eduwww.nrri.umn.edu

Research & Development Private

For more information on becoming a dealer call 800-932-3629 or visit INFO.WOODMASTER.COM/DEALER

www.woodmaster.com

…in commercial and residential boilers and furnaces.Heat commercial, institutional and agricultural facilities with our Commercial Series line of boilers and furnaces.

Setting TheStandard.

VISION FOREST MACHINE TECHNOLOGY CONFERENCE

AFOR THE

FUTURE

FMTC CONFERENCEAPRIL 21 TO 23, 2015HYATT REGENCY HOTEL, MONTREAL, CANADAfmtc.fpinnovations.ca

REGISTER NOW!And benefit from early bird rates.

FEATURING• Prominent international keynote speakers • Invited technical presentations • Technology forum presentations • Supplier kiosks• Ideation working groups • Networking opportunities

Robots, remote-controlled machines and autonomous vehicles. Imagine all these exciting technologies helping out in the forest for a safer and efficient working environment!

OUR SILVER SPONSORS:

OUR GOLD SPONSORS:

FOLLOW US #FMTC

@ fmtc-ctef@fpinnovations.ca

AD INDEX

Agra Industries 21

American Science & Technology 55

Astec 56

Babcock Power 5

BBI Project Development 13

Beltran Technologies, Inc. 32

Continental Biomass Industries, Inc. 17

CPM Roskamp Champion 18

CPM Wolverine Proctor, LLC 26

Detroit Stoker Company 34

EBM Manufacturing 27

FPInnovations 44

Gray 23

GreCon Inc. 37

Hurst Boiler & Welding Co. Inc. 2

IEP Technologies 40-41

Indeck Power Equipment Co. 38

International Biomass Conference & Expo 12

Lehra Fuel Tech Pvt. Ltd. 20

National Advanced Biofuels Conference & Expo 54

Northeast Wood Products LLC 25

OÖ Energiesparverband

(Energy Agency of Upper Austria)15

Pan American Hydrogen, Inc. 24

ProcessBarron 28

Rawlings Waste Wood Recovery Systems 16

RCBC Global 33

SCHADE Lagertechnik GmbH 29

SWANA 14

TerraSource Global 30

Vecoplan LLC 19

Wolf Material Handling Systems 31

Woodmaster 43

Company Index

4B Components Ltd.625 Erie AvenueMorton, IL 61550

4B SalesPhone (309-698-5611)webmaster-usa@go4b.comwww.go4b.com/usa

A AAA Cooper Transportation1751 Kinsey Rd.Dothan, AL 36303Buddy Turner, Director - Bulk ServicesPhone (251-589-2348)buddy.turner@aaacooper.comwww.aaacooper.com

ADI Systems Inc.370 Wilsey RoadFredericton, AB E3B 6E9 CanadaScott Christian, Vice President, Business DevelopmentPhone (506-452-7107)scott.j.christian@adi.cawww.adisystemsinc.com

Adtec Power gmbhIndustriestrasse 1Hard, 6971 AustriaBernhard Schulz, CEOPhone (00436606489040)b.schulz@adtecpower.comwww.adtecpower.com

Advanced Biofuels USA507 North Bentz StreetFrederick, MD 21701Joanne Ivancic, Executive DirectorPhone (301-644-1395)info@advancedbiofuelsusa.orgwww.AdvancedBiofuelsUSA.org

African Green Developments (Pty)Ltd.80 Milner Rd. MidrandJohannesburg, 1865 South AfricaLeon-Valeri Eremin, CEOPhone (082-264-7781)vgereminl@gmail.comwww.greenpower-worldwide.com.

AGRA Industries1211 West Water StreetMerrill, WI 54452Tim Gruling, Manager of SalesPhone (715-536-9584) | Fax (715-536-9587)sales@agraind.comagraind.comSEE OUR AD ON PAGE 21

AGRA Industries1211 West Water StreetMerrill, WI 54452Pat Hinner, PresidentPhone (800-842-8033)lhans@agraind.comwww.agraind.comSEE OUR AD ON PAGE 21

Agri-Tech Producers, LLC (ATP)116 Wildewood Club CourtColumbia, SC 29223Joseph James, PresidentPhone (803-462-0153) | Fax (803-462-9676)josephjjames@bellsouth.netwww.agri-techproducers.com

Agricultural Fuels Corp5361 Young Pine Rd. Orlando, FL 32829James Meade, CTOPhone (407-234-1788) | Fax (407-380-5188)jmm@agfuels.bizwww.agfuels.biz

Agriculture Law & Consulting LLC16240 Burt StreetOmaha, NE 68118David Bracht, OwnerPhone (402-981-2900)dlbracht@aol.comhttps://www.linkedin.com/pub/david-bracht/1/11b/66

AgriPower, Inc.46 Deepdale DriveGreat Neck, NY 11021Barry Berman, CEOPhone (516-829-2000) | Fax (516-487-3163)bberman@agripower.comwww.agripower.com

Air Compliance Testing, Inc.10060 Brecksville RoadSuite 1120Cleveland, CA 44141Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Air Resource Specialists, Inc.1901 Sharp Point Drive, Suite EFort Collins, CO 80525Howard Gebhart, Manager, Environmental Compliance SectionPhone (970-484-7941)hgebhart@air-resource.comwww.air-resource.com

Air/Compliance Consultants, Inc. 1050 William Pitt WaySuite 1120Pittsburgh, CA 15238Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Airofl ex Equipment6001 49th St. SouthMuscatine, IA 52761Andy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)sales@airofl exequipment.comwww.airofl exequipment.com

AirPro Fan & Blower Co.PO Box 543Rhinelander, WI 54501Keith White, Sales EngineerPhone (715-365-3267)sales@airprofan.comwww.airprofan.com

ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CanadaMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)mike.meagher@aldatasoftware.comwww.aldatasoftware.com

ALSTOM Power, Inc. Environmental Control Solutions1409 Center Point Blvd.Knoxville, TN 37932Mark Walters, Business Sales ManagerPhone (770-876-1163)mark.walters@power.alstom.comwww.power.alstom.com

Amatrol Inc.2400 Centennial Blvd.Jeffersonville, IN 47130Luke Gillenwater, InternPhone (800-264-8285) | Fax (812-283-1584)lgillenwater@amatrol.comwww.amatrol.com

American Property Experts606 Sunnyvale DriveWilmington, NC 28412Bill Waggaman, Business DevelopmentPhone (910-793-1460) | Fax (910-793-6227)bill@tubgrinding.comwww.tubgrinding.com

American Science and Technology1367 W. Chicago Ave.Chicago, IL 60642Ali Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)am@amsnt.comwww.amsnt.comSEE OUR AD ON PAGE 55

AMSEnergy Corp.1111 Bear Creek PikeColumbia, TN 38401Michael Sams, President & CEOPhone (615-852-8412)info@amsenergy.comwww.amsenergy.com

ANDRITZ1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)joanne.turnell@andritz.comwww.andritz.com

ANDRITZ Feed and Biofuel336 West PennMuncy, PA 17756Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)joanne.turnell@andritz.comandritz.com/ft

Andy J. Egan Co.2011 Waldorf NWSuite 200Grand Rapids, MI 49544Rick Atkins, FabricationPhone (616-791-9952)atkinsr@andyegan.comwww.andyegan.com

Anguil Environmental Systems, Inc.8855 North 55th StreetMilwaukee, WI 53223Kevin Summ, Marketing ManagerPhone (414-365-6400) | Fax (414-365-6410)sales@anguil.comwww.anguil.com

Anyang General International GroupRenmin Road, Anyang, ChinaMNancy Yang, Manager AssistantPhone (863725965148)nancyyang012@gmail.comgemcopelletmill.com

Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450David Minott, PresidentPhone (978-877-7719)david.minott@arc5enviro.comwww.arc5enviro.com

Arizona State Forestry Division3650 Lake Mary RdFlagstaff, AZ 86005Patrick Rappold, Wood Utilization & Marketing SpecialistPhone (928-774-1425)patrickrappold@azsf.govwww.azsf.az.gov

Asahi/America655 Andover StLawrence, MA 01843Jeff Baker, Marketing ManagerPhone (781-321-5409)jbaker@asahi-america.comwww.asahi-america.com

ASI-Industrial1300 Minnesota Ave.Billings, MT 59101Matthew Hamlin, Vice President SalesPhone (406-245-6231) | Fax (406-245-6236)mjayhamlin@gmail.comwww.asi-industrial.com

Associated Laboratories806 N. Batavia St.Suite 1120Orange, CA 92868Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Astec, Inc.4101 Jerome AvenueChattanooga, TN 37407Malcolm Swanson, PresidentPhone (423-867-4210) | Fax (423-867-4636)mswanson@astecinc.comwww.astecinc.comSEE OUR AD ON PAGE 56

ATI Systems30 Jeffries St.East Boston, MA 02128Troy Fergus, Business DeveloperPhone (617-567-4969)tfergus@atisystem.comwww.atisystem.com

Avogadro Environmental Corporation1350 Sullivan TrailSuite AEaston, CA 18040Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Ayalytical Instruments2701 W. Fulton St. #5SChicago, IL 60612Juan Ayala, Managing DirectorPhone (312-622-7520)juan@ayalytical.comwww.ayalytical.com

Company Index

BB.I.D. Canada Ltd.171 Hemlock StreetLower Woodstock, NB E7M 4E6 CanadaDerek Lawrence, Sales & Estimating ManagerPhone ((506-328-4381 ext 510)dlawrence@bidcanadaltd.comwww.bidcanadaltd.com

Babcock Power Environmental5 Neponset StreetWorcester, MA 01615Jennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 5

Babcock Power Services5 Neponset StWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 5

Baywood Technologies Inc.5210 Belfort Road, Suite 210Jacksonville, FL 32256Shannon Fitzgerald, Business DevelopmentPhone (904-733-7336) | Fax (904-731-5695)shannon.fi tz@baywoodtech.comwww.baywoodtech.net

BBI Project Development10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)myancey@bbiinternational.comwww.bbiinternational.comSEE OUR AD ON PAGE 13

Beijer Electronics1865 West 2100 SouthSalt Lake City, UT 84119Jeff Hayes, Product ManagerPhone (801-466-8770)jeff.hayes@beijerinc.comwww.beijerinc.com

Beltran Technologies, Inc.1133 East 35 StreetBrooklyn, NY 11210Gary Siegel, Marketing DirectorPhone (718-338-3311) | Fax (718-253-9028)gary@beltrantechnologies.comwww.beltrantechnologies.comSEE OUR AD ON PAGE 32

Biodiesel Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.biodieselmagazine.com

Bighorn Environmental Air Quality, LLC1324 N Liberty Lake Road #266 Liberty Lake, WA 99019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Bioenergy Insight124 Middleton RoadMordenSurrey SM4 6RW, Great BritainPeter Patterson, Managing DirectorPhone (442086487082)peter@horseshoemedia.comwww.bioenergy-news.com

Biofuels Technology LLC1201 Orange StreetSuite 600Wilmington, DE 19801Andrew Laitt, CEOPhone (302-966-9235)alaitt@biofuelstech.comwww.biofuelstech.com

BIOGAS Equity 2, Inc.130 Eleanor Dr.Woodside, CA 94062Mike Muller, COOPhone (650-283-9555)mikemuller@biogas2.comwww.biogas2.com

Biomass Briquette Systems, LLCP.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-893-2444) | Fax (530-893-2444)info@biomassbriquettesystems.comwww.biomassbriquettesystems.com

Biomass Energy Lab1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)info@biomassenergylab.combiomassenergylab.com

Biomass Heating Solutions201 East 12th StreetAlturas, CA 96101Terry Olson, OwnerPhone (530-640-1072) | Fax (530-233-3450)haciendamotel@frontiernet.net

Biomass Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.biomassmagazine.com

Biomass Power Association100 Middle StreetPortland, ME 04104Bob Cleaves, PresidentPhone (207-228-7376) | Fax (207-774-1127)bob@biomasspowerassociation.comwww.biomasspowerassociation.com

Biomass Systems SupplyP.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) | Fax (530-893-2444)info@biomasssystemssupply.comwww.biomasssystemssupply.com

Bionomic Industries777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)sales@bionomicind.comwww.bionomicind.com

Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601Chad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)sales@bliss-industries.comwww.bliss-industries.com

Boiler Tube Company of America506 Charlotte HighwayLyman, SC 29365Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/boiler-tube-co-of-americaSEE OUR AD ON PAGE 5

Brunette Machinery Co.8717 132nd StreetSurrey, BC V3W 4P1 CanadaKirk Forbes, PresidentPhone (604-522-3977)sales@brunettemc.comwww.brunettemc.com

Burns Forest Products LLC17691 Hwy 4Bienville, LA 71008John Russo, COOPhone (318-259-4997) | Fax (318-259-6338)bfpjohn@aol.com

CC&M Baling Systems, Inc.P.O. Box 16309Winston Salem, NC 27115John Gibbs, President & COOPhone (336-723-1838) | Fax (336-761-8695)sales@baling.comwww.baling.com

Celignis LimitedT1-014 Tierney Building, University of LimerickLimerick, L111 IrelandDaniel Hayes, DrPhone (353894555582)dan@celignis.comwww.celignis.com

Cellulose Pilot and Processing Lab6445 Packer Dr.Wausau, WI 54401Eric Singsaas, DirectorPhone (715-340-2591)Eric.Singsaas@uwsp.edu

Centre for Process InnovationWilton Centre, WiltonRedcar, TS10 4RF Great BritainLiz Grylls, Phone (441642455340)liz.grylls@uk-cpi.comwww.uk-cpi.com

Christianson & Associates, PLLP302 SW 5th StWillmar, MN 56201Sherry Jean Olson, ManagerPhone (320-235-5937) | Fax (320-235-5962)solson@christiansoncpa.comwww.christiansoncpa.com

Christianson & Associates, PLLP302 SW 5th St Willmar, MN 56201Fred Gould, Business Development ManagerPhone (320-235-5937) | Fax (320-235-5962)fgould@christiansoncpa.comwww.christiansoncpa.com

Christianson & Associates, PLLP302 SW 5th StWillmar, MN 56201Bradley Pederson, PartnerPhone (320-235-5937) | Fax (320-235-5962)bpederson@christiansoncpa.comwww.christiansoncpa.com

CLARCOR Industrial Air11501 Outlook Street, Suite 100Overland Park, KS 66210Tim Stark, Director Aftermarket SalesPhone (816-313-4955)timothy.stark@clarcor.comwww.BHA.com

Class One Technical Services, Inc.3500 Camanche Rd NESuite GAlbuquerque, NM 87107Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Clean Methane Systems LLC19125 SW 125thTualatin, OR 97062Timothy Robinson, PresidentPhone (425-420-1979) | Fax (425-491-7740)TimR@methanesys.comwww.methanesys.com

Cogent Industrial TechnologiesSuite 180 - 13091 Vanier PlaceRichmond, BC V6V 2J1 CanadaBijan Shams, PresidentPhone (604-207-8880)bijan.shams@cogentind.comwww.cogentind.com

Commodity Talent LLC349 Fifth Ave., 7th Flr.New York, NY 10016George Stein, Managing DirectorPhone (646-205-3557)ghstein@commoditytalent.comwww.CommodityTalent.com

Continental Biomass Industries, Inc.22 Whittier St.Newton, NH 03858Art Murphy, Marketing ManagerPhone (603-382-0556)amurphy@cbi-inc.comwww.cbi-inc.comSEE OUR AD ON PAGE 17

Company Index

Conveyor Components Company130 Seltzer RoadPO Box 167Croswell, MI 48422Rich Washkevich, Sales ManagerPhone (810-679-4211) | Fax (810-679-4510)info@conveyorcomponents.comwww.conveyorcomponents.com

Cooper/Consolidated1127 Highway 190, East Service RoadCovington, LA 70433Brent Mahana, Sales DirectorPhone (985-871-4403)brent.mahana@cgb.comwww.cooperconsolidated.com

Cornerstone Systems LtdWhitebridge WayStone, ST15 8LQ Great BritainGareth Hughes, DirectorPhone (01785818020) | Fax (01785811699)gareth@cornerstonesystems.co.ukwww.CornerstoneSystems.co.uk

COSA Xentaur Corp.84G Horseblock RdUnit GYaphank, NY 11980Colin Mueller, Marketing DirectorPhone (631-345-3434)c.mueller2@cosaxentaur.comwww.cosaxentaur.com

Cousineau Forest Products1310 Old Concord RdHenniker, NH 03242Jon Baker, Operations & Wood Procurement ManagerPhone (603-428-7155) | Fax (603-428-7839)jon@cousineaus.comwww.cousineaus.com

CPM Roskamp Champion2975 Airline CircleWaterloo, IA 50703Tim Gilbert, North American ManagerPhone (800-366-2563)gilbertt@cpmroskamp.comwww.cpmroskamp.comSEE OUR AD ON PAGE 18

CPM Wolverine Proctor, LLC251 Gilbraltar RoadHorsham, PA 19044Chris Law, Industry ManagerPhone (215-443-5200) | Fax (215-443-5206)lawc@cpmwolverineproctor.comwww.cpmwolverineproctor.comSEE OUR AD ON PAGE 26

CTI3845 Cypress Creek Parkway, Ste. 420Houston, TX 77068Jalene Fritz, Membership CommitteePhone (970-593-8637) | Fax (970-472-1304)jfritz@tpitx.comwww.cti.org

Curran Renewable Energy, LLC20 Commerce DriveMassena, NY 13662Patrick Curran, President / OwnerPhone (315-769-2000)pcurran@twcny.rr.comwww.curranpellets.com

CV Technology15852 Mercantile CourtJupiter, FL 33478Nicholas Licht, Sales Engineer Phone (561-694-9588) | Fax (561-694-9585)nlicht@cvtechnolgoy.comwww.cvtechnology.com

DDavenport Dryer301 2nd StRock Island, IL 61204Rob Feller, Sales ManagerPhone (309-283-1134)rfeller@davenportdryer.comwww.davenportdryer.com

Dedert Corporation17740 Hoffman WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)c.crankshaw@dedert.comwww.dedert.com

Dedert Corporation17740 Hoffman WayHomewood, IL 60430Dale Stenning, V.P. Manager Evaporator DivisionPhone (708-747-7000)d.stenning@dedert.comwww.dedert.com

Delta Air Quality Services, Inc.1845 North Case Street Orange, CA 92865Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Detroit Stoker Company1510 East First StreetMonroe, MI 48161Tim Loviska, Director - Contract SalesPhone (734-241-9500) | Fax (734-241-7126)sales@detroitstoker.comwww.detroitstoker.comSEE OUR AD ON PAGE 34

DI PIÙ - Sunomi LLC608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)gchecchi@sunomi-llc.comwww.sunomi-llc.com

Direct Contact LLC2555 34th Street NECanton, OH 44708Curt Rothman, CEOPhone (330-437-0444)crothman@dciheat.comwww.dciheat.com

DYNATEK Loading Systems200 North Harrison StNorth Prairie, WI 53153Gary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)garyk@dynatekloadingsystems.comwww.dynatekloadingsystems.com

E E3CoalRissener Landstrasse 255Hamburg, 22559 GermanyChristopher StonePhone (0012022156201)business-development@e3coal.comwww.e3coal.com

Eastmount Environmental Services, LLC2 New Pasture RoadUnit #5Newburyport, CA 01950Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comhttp://www.montrose-env.com/

EBM Manufacturing1014 Sherwood RdNorfolk, NE 68701Tiffany Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)tiffany@ebmmanufacturing.comwww.gentleroll.comSEE OUR AD ON PAGE 27

EcoHeat Solutions LLC153 Washington StBox B 9East Walpole, MA 02032George Whiting, PresidentPhone (877-317-0700)gwhiting@ecoheatsolutions.comwww.ecoheatsolutions.com

Ecospray Technologies S.r.l.5 Thawmont DriveSewickley, PA 15143Jo Ann Pacinelli, North AmericaPhone (412-427-0133) | Fax (412-741-8386)pacinelli@ecapitalexchange.comwww.ecospray.eu

Ecostrat Inc. 60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaBrett Hogarth, Head of Business DevelopmentPhone (416.968.8884 ext. 239) Fax (416.968.8886)brett.hogarth@ecostrat.comwww.ecostrat.com

Ecostrat Inc. 60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaJordan Solomon, PresidentPhone (416.968.8884 ext. 222)Fax (416.968.8886)jordan.solomon@ecostrat.comwww.ecostrat.com

Eisenmann150 E Dartmoor DriveCrystal Lake, IL 60014John McDowell, Sales EngineerPhone (815-477-5335)john.mcdowell@eisenmann.comwww.eisenmann.us.com

Elementar Americas520 Fellowship Rd Ste D-408Mt Laurel, NJ 08054Jean Bernius, Marketing ManagerPhone (856-787-0022)jean.bernius@elementaramericas.comwww.elementaramericas.com

Elliott Group901 North Fourth StreetJeannette, PA 15644Phil Rutkowski, Sales ManagerPhone (303-503-1134)PRutkows@elliott-turbo.com

Emisshield Inc.2000 Kraft Drive Suite 2600Blacksburg, VA 24060Tim Wilson, Project ManagerPhone (540-961-0999)tim.wilson@emisshield.comwww.emisshield.com

Emission Testing Services, Inc.10461 Mammoth AveBaton Rouge, LA 70814Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Enerion Biomass SolutionsAv. 27 de Febrero n. 233, Torre Corp. Corominas Pepín, 4th Floor Ensanche NacoSanto Domingo, 10150 Dominican RepublicAlessandro Pozzi, Phone (00393470449209)a.pozzi@enerionbiomass.comwww.enerionbiomass.com

EquipNet, Inc.5 Dan RoadCanton, MA 02021Emily ColemanPhone (781-821-3482) | Fax (617-671-1269)sales@equipnet.comwww.equipnet.com

ESP1075 Progress CircleLawrenceville, GA 30043Jim Batten, V.P. of SalesPhone (770-682-8259) | Fax (770-277-5524)jbatten@espatl.comwww.espatl.com

Ethanol Producer Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.ethanolproducer.com

Evergreen Engineering, Inc.1740 Willow Creek CircleEugene, OR 97402Aaron Edewards, Business Development DirectorPhone (541-484-4771) | Fax (541-484-6759)aedewards@eeeug.comwww.evergreenengineering.com

Everlasting Valve Company108 Somogyi CourtSouth Plainfi eld, NJ 07080David Jenkins, General Sales ManagerPhone (908-769-0700) | Fax (908-769-8697)djenkins@everlastingvalveusa.comwww.everlastingvalveusa.com

Exponent4580 Weaver ParkwaySuite 100Warrenville, IL 60555Mark Fecke, Senior Managing EngineerPhone (630-658-7512)mfecke@exponent.comwww.exponent.com

Company Index

F Fagen, Inc.501 W. Hwy 212Granite Falls, MN 56241Richard Cantor, Vice President, Business DevelopmentPhone (864-430-5338)rcantor@fageninc.comwww.fageninc.com

FieldEddy Division of Hub International New England LLC PO Box 70996 Shaker RdEast Longmeadow, MA 01028Teresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)teresa.petitdemange@hubinternational.comwww.fi eldeddy.com

FLAMEX, Inc.4365 Federal DriveGreensboro, NC 27410Allen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)fl amex@sparkdetection.comwww.sparkdetection.com

Food & Fuel for the 21st Century9500 Gilman Dr.MC: 0368La Jolla, CA 92093Travis Johnson, Program CoordinatorPhone (858-534-6383)tlj002@ucsd.eduff21.ucsd.edu

Foster BrothersPO Box 249Auxvasse, MO 65231Steve Foster, VPPhone (573-386-2271) | Fax (573-386-2676)steve@fosterbros.comwww.fosterbros.com

FPInnovations319, rue FranquetPointe-Claire, QC G1P 4R4 CanadaPhone (418-781-6722)info@fpinnovations.cawww.fpinnovations.comSEE OUR AD ON PAGE 44

G GARN Wood Heating3425 33rd Ave. NEMinneapolis, MN 55418Martin Lunde, PresidentPhone (612-326-1104)martin@garn.comwww.GARN.com

Gateway Commercial Finance, LLC340 SE 1st StreetDelray Beach, FL 33483Marc Marin, Managing DirectorPhone (855-424-2955) | Fax (561-734-2708)gateway@gatewaycfs.comhttp://gatewaycfs.com

General Biomass Company2906 Central StreetSuite 134Evanston, IL 60201Daniel Gibbs, CEOPhone (847-624-3590)dgibbs@generalbiomass.comwww.generalbiomass.com

Geomembrane Technologies Inc. (GTI)370 Wilsey RoadFredericton, AB E3B 6E9 CanadaDarin Evans, Manager, Product DevelopmentPhone (506-452-7304) | Fax (506-452-6625)covers@gticovers.comwww.gticovers.com

Global Clean Energy Holdings2790 Skypark Drive Suite 105Torrance, CA 90505Richard Palmer, President and CEOPhone (310-641-4234)info@gceholdings.comwww.gceholdings.com

Gorman-Rupp Company600 S. Airport Rd.Mansfi eld, OH 44903Scott Derkez, National Sales ManagerPhone (419-755-1011) | Fax (419-755-1251)sderkez@gormanrupp.comwww.GRpumps.com

Gray10 Quality StreetLexington, KY 40507Alex De Martini, Manager, Business DevelopmentPhone (859-281-5000) | Fax (859-252-5300)ademartini@gray.comwww.gray.comSEE OUR AD ON PAGE 23

GreCon Moisture Meters15875 SW 74th AveTigard, OR 97224Marshall LLoyd, SalesPhone (503-641-7731) | Fax (503-641-7508)sales@grecon-us.comwww.grecon-us.com/measurement/infrared-moisture-meterSEE OUR AD ON PAGE 37

GreCon Spark Detection15875 SW 74th Ave.Tigard, OR 97224Terry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)sales@grecon-us.comwww.grecon-us.com/spark-detectionSEE OUR AD ON PAGE 37

Green Science Corporationwww.greensciencecorp.com

Gulf Stream Fuels, LLCP.O. Box 147Markham, TX 77456Truman Neuman, VP of MarketingPhone (512-745-6940)tjneuman2010@live.com

HH.T. PROF Clean Tech575 N. Patterson Ave. Suite 444Winston-Salem, NC 27101Todd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)tsporter@htprof.comwww.htprof.com/clean-tech.htm

Hallco Industries Inc.PO Box 505Tillamook, OR 97141Ricardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)ricardo@hallcoindustries.comwww.hallcoindustries.com

Hartpence FarmsPO Box 155Moscow, PA 18444Larry Hartpence, OwnerPhone (570-842-6464)larry@hartpencefarms.com

Hawkeye Process Technology Systems3000 Old Alabama RdSte 119-198Atlanta, GA 30022Bill Schafer, Director Business DevelopmentPhone (614-747-1737)bschafer.hawkeye@gmail.comwww.gogreendevelopment.net

Heat Transfer International4720 44th Street SEKentwood, MI 49512Project Development, Sales ManagerPhone (616-551-5420)sales@heatxfer.comwww.heatxfer.com

HEMCO Corporation711 South Powell RoadIndependence, MO 64056Jerry Schwarz, Marketing / AdvertisingPhone (800-779-4362) | Fax (816-796-3333)info@hemcocorp.comwww.HEMCOcorp.com

HerBasant IndustriesAt Sanjivani BuildingFarm Road, Modi Para,Sambalpur, 768002 IndiaL K Agrawal, General ManagerPhone (09438631539)herbasant@gmail.comhttp://www.herbsantextracts.com/

Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106Sales Dept., Phone (412-788-9810) | Fax (412-788-9822)info@heylpatterson.comwww.heylpatterson.com

Hoffmann, Inc.6001 49th St. SouthMuscatine, IA 52761Paul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)sales@hoffmanninc.comwww.hoffmanninc.com

Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738Jeff Hurst, Director, Sales & MarketingPhone (229-346-3545)jhurst@hurstboiler.comwww.hurstboiler.comSEE OUR AD ON PAGE 2

Hydro Dynamics, Inc.8 Redmond Court NWRome, GA 30165Douglas Mancosky, VP - Research & DevelopmentPhone (706-234-4111) | Fax (706-234-0702)jdunn@hydrodynamics.comwww.hydrodynamics.com

Hydro-Thermal Corp.400 Pilot CourtWaukesha, WI 53188Sales Department, SalesPhone (262-548-8900) | Fax (262-548-8908)info@hydro-thermal.comwww.hydro-thermal.com

Hyer Industries-Thayer Scale91 Schoosett St. PO Box 669Pembroke, MA 02359Peter Sirrico, Regional Sales ManagerPhone (781-826-8101) | Fax (781-826-0072)psirrico@thayerscale.comwww.thayerscale.com

IICS, Inc. (Industrial Contract Services, Inc.)PO Box 13158Grand Forks, ND 58208-3158David Dangerfi eld, Project DevelopmentPhone (701-775-8480) | Fax (701-775-8479)ddangerfi eld@icsgf.comwww.icsgf.com

IEP Technologies417-1 South StreetMarlborough, MA 01752John Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)john.shea@IEPTechnologies.comwww.IEPTechnologies.comSEE OUR AD ON PAGE 40

Imerys100 Mansell Court E. Suite 300Roswell, GA 30076Emmy Bracoud, Marketing AnalystPhone (678-579-2095)aurora@imerys.comwww.imerys-aurora.com

Indeck Power1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)llindell@indeck-power.comwww.indeck.comSEE OUR AD ON PAGE 38

Ingram Barge Company4400 Harding PikeNashville, TN 37205Blake Roberson, Senior Business Development AnalystPhone (615-298-7589)blake.roberson@ingrambarge.comwww.ingrambarge.com

Iowa Northern Railway305 2nd St SESuite 400Cedar Rapids, IA 52401William Rhodes, Director Reload MarketingPhone (319-415-8150)wrhodes@iowanorthern.comwww.iowanorthern.com

Iowa State University BioCentury Research Farm1041 Food Sciences Bldg.Ames, IA 50011-1061Lawrence Johnson, DirectorPhone (515-294-4365) | Fax (515-294-6261)ljohnson@iastate.eduwww.biocenturyresearchfarm.iastate.edu

International Biomass Conference & ExpoPhone (866-746-8385)service@bbiinternational.comwww.biomassconference.comSEE OUR AD ON PAGE 12

Company Index

International Fuel Ethanol Workshop & ExpoPhone (866-746-8385)service@bbiinternational.comwww.fuelethanolworkshop.com

JJeffrey Rader, a brand of TerraSource Global215 Parkway East, Suite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)tgentile@terrasource.comwww.jeffreyrader.comSEE OUR AD ON PAGE 30

Jenkins & BrandtPO Box 80609Atlanta, GA 30066Rick Brandt, PartnerPhone (770-650-7295) | Fax (678-594-0825)sales@jenkinsandbrandt.comwww.jenkinsandbrandt.com

KKenco Engineering, Inc.2155 PFE RoadRoseville, CA 95747Ron Brajkovich, Regional ManagerPhone (800-363-9859) | Fax (916-783-3494)ronb@kencoengineering.comwww.kencoengineering.com

Kentucky Division of Biofuels500 Mero Street, 6th FloorFrankfort, KY 40601Tim Hughes, DirectorPhone (502-564-7192) | Fax (502-564-7406)TimD.Hughes@KY.Govenergy.ky.gov/biofuels/Pages/default.aspx

Kilpatrick Townsend & Stockton LLP607 14th Street, NWSuite 900Washington, DC 20005Mark Riedy, CounselPhone (202-508-5823) | Fax (202-318-4087)mriedy@kilpatricktownsend.comwww.kilpatricktownsend.com

Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)mabull@kogerair.comwww.kogerair.com

Komptech Americas10855 Dover Street, Suite 1000Westminster, CO 80021Brandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)b.lapsys@komptechamericas.comwww.komptechamericas.com

Konza Renewable Fuels2953 SW Wanamaker DrTopeka, KS 66614Josh Thompson, MemberPhone (785-286-7390)Josh.Thompson@konzaRF.comwww.konzarf.com/Contact.aspx

L Lehra Fuel Tech PVT LTDVPO Nanakpur Jagera-141117, Opp Dera Sacha SaudaNear Shanti Tara College, Distt. LudhianaPunjab, 141117 IndiaSarabjit Singh, DirectorPhone (919815200337)info@lehrafuel.comwww.lehrafuel.com

Levelese, Inc.326 Steele St.Denver, CO 80206Sallyanne Ofner, PresidentPhone (303-586-1425)info@levelese.comwww.levelese.com

Lewis & Raulerson, Inc.1759 State StreetWaycross, GA 31501Casey Hall, Executive AssistantPhone (912-283-5951) | Fax (912-283-8281)chall@lewisandraulerson.comwww.lewisandraulerson.com

Life Cycle Associates, LLC884 Portola RoadSuite A11Portola Valley, CA 94028Stefan Unnasch, Managing DirectorPhone (650-461-9048)unnasch@lifecycleassociates.comwww.lifecycleassociates.com

LMC International Ltd1841 Broadway, 611New York, NY 10023Andrea Kavaler, Executive Vice PresidentPhone (212-586-2427)info@lmc-ny.comwww.lmc.co.uk

Luminate, LLC1801 BroadwaySuite 1620Denver, CO 80202Michael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)mike.robinson@luminatellc.comwww.luminatellc.com

MMaas CompaniesPO Box 7127Rochester, MN 55903Tyler Maas, Director of Sales and MarketingPhone (507-285-1444) | Fax (507-285-0034)maas@maascompanies.comwww.maascompanies.com

Martin EngineeringOne Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)chelseab@martin-eng.comwww.martin-eng.com

MEC Entec Services, LCC30 Monroe DriveP.O. Box 1059Pelham, AL 35124Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Miron Construction Co., Inc.1471 McMahon DriveNeenah, WI 54956Dan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004) | Fax (920-969-7393)dan.goymerac@miron-construction.comwww.miron-construction.com

MKL Capital LLCBox 963Bronxville, NY 10708Brian Morrison, Managing DirectorPhone (917-653-3017)bam@mklcapital.com

Modern Industrial2012 Highway 160 W, Suite 9Fort Mill, SC 29708Jon Payne, PresidentPhone (888-517-2310)marketing@modernindustrial.comwww.modernindustrial.com

MOISTTECHP O Box 118Tallevast, FL 34270-0118John Fordham, ManagerPhone (941-351-7870)jfordham@moisttech.comwww.maoisttech.com

Montrose Air Quality Services, LCC4210 Resnik CourtSuite 200Bakersfi eld, CA 93313Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Montrose Environmental Group, Inc.2 Park Plaza Suite 1120Irvine, CA 92614Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935) | Fax (925-429-9042)emirabella@montrose-env.comwww.montrose-env.com

Morbark, Inc. 8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896John Foote, Vice President, Sales and MarketingPhone (800-831-0042) | Fax (989-866-2280)john.foote@morbark.comwww.morbark.com

Morbark, Inc. 8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896Casey Gross, Sales Manager, Tree CarePhone (800-831-0042) | Fax (989-866-2280)casey.gross@morbark.comwww.morbark.com

NNAES Corporation1180 NW Maple StreetSuite 200Issaquah, WA 98027Jeanette Carroll, Marketing ManagerPhone (425-961-4700)jeanette.carroll@naes.comwww.naes.com

National Advanced Biofuels Conference & ExpoPhone (866-746-8385)service@bbiinternational.comwww.advancedbiofuelsconference.com

NDC Technologies5314 North Irwindale AvenueIrwindale, CA 91706Ray Shead, Marketing ManagerPhone (626-939-3856) | Fax (626-939-3870)rshead@ndc.comwww.ndc.com

NESTEC Inc.21 Unionville RoadP.O. Box 568 Douglassville, PA 19518Jim Nester, PresidentPhone (610-323-7670) | Fax (610-323-7672)sales@nestecinc.comwww.nestecinc.com

Neutopia ecoSOLUTIONS Inc.2045 Lakeshore Boulevard WestSuite 411, Toronto, ON M8V 2Z6 CanadaRobert Laporte, President & CEOPhone (905-581-6333)rlaporte@neutopia.cawww.neutopia.ca

New Holland Agriculture500 Diller AvenueNew Holland, PA 17557Jarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)jarrod.angstadt@newholland.comwww.newholland.com/na

NH Wood Energy Council2 Airport RoadUnit 1Gilford, NH 03249Rick DeMark, CoordinatorPhone (603-527-2093)rdemark.ncrcd@metrocast.netwww.nhwoodenergycouncil.org

Northeast Wood Products, LLC13 Crow Hill RoadUncasville, CT 06382Mike Reid, SVP-Business DevelopmentPhone (855-324-9621)mreid@northeastwoodproductsllc.comwww.thermaglo.comSEE OUR AD ON PAGE 25

Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) | Fax (218-253-4409)tstrem@woodmaster.comwww.woodmaster.comSEE OUR AD ON PAGE 43

Novatos RE Agro-Industrial24 Dollar St., CGPV, Felix Ave, Cainta, Rizal 1400 PhillippinesRoberto Alip, PresidentPhone (639192359694)bobet.alip@gmail.comwww.facebook.com/novatos.re

NRG Farm Consulting, LLC3813 HabershamSchertz, TX 78154Bud Wylie, PresidentPhone (210-725-1756)budwylie8@gmail.com

Company Index

OOklahoma State UniversityBiosystems and Agricultural Engineering214 Agricultural HallStillwater, OK 74078Hasan Atiyeh, Associate Professor, BioprocessingPhone (405-744-8397) | Fax (405-744-6059)hasan.atiyeh@okstate.eduatiyeh.okstate.edu

Olson Search International, Inc.PO Box 3127Redmond, WA 98073Jon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)jon@olsonsearch.comwww.olsonsearch.com

On The Green, LLC10116 Daniels Run WayFairfax, VA 22030Mary Valenta, CEOPhone (205-266-3393)mvalenta@onthegreenlllc.netonthegreenllc.net

OÖ Energiesparverband (Energy Agency of Upper Austria)Landstrasse 45Linz AustriaChristiane Egger, Deputy managerPhone (43732772014386) Fax (43732772014383) offi ce@esv.or.athttp://www.esv.or.at/english/

Optek-Danulat, Inc.N118W18748 Bunsen DrGermantown, WI 53022Joe Ferrelli, Product SpecialistPhone (888-901-4288)biotech@optek.comwww.optek.com

Orival, Inc.213 S. Van Brunt StreetEnglewood, NJ 47352Marcus Allhands, Vice President of Business DevelopmentPhone (201-568-3311) | Fax (201-568-1916)ma@orival.comwww.orival.com

OSDV Engineering Inc.1 Rabbit RunWilmington, DE 19809Charlesl Clerecuzio, Principal / Chief EngineerPhone (856-266-2550)cclerecuzio@osdveng.com

Outotec Energy Products3568 W Industrial LoopCoeur d’Alene, ID 83815Kent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)cda.sales@outotec.comwww.outotec.com

PpackIQ1 American WayAnderson, SC 29621Than Nguyen, ConsultantPhone (877-233-8668)packiq@greenpeas.comhttp://packiq.com

PanAmerican Hydrogen, Inc.5806 E. Grimes St.Harlingen, TX 78550Barbara Martinez, VPPhone (956-365-3773) | Fax (956-365-3739)barbara.guaym@phydrogen.comwww.panent.comSEE OUR AD ON PAGE 24

Pellet Mill Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)service@bbiinternational.comwww.biomassmagazine.com/pellets

PHG Energy3048 Owen DriveAntioch, TN 37013Mike Webb, Director of Business DevelopmentPhone (615-471-9299)mike.webb@PHGEnergy.comwww.phgenergy.com

Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095Sales Dept., Phone (262-338-1191) | Fax (262-338-8489)info1@pickheaters.comwww.pickheaters.com

Pinnacle Air Pollution Control1177 Pittsburgh RoadSuite 203Valencia, PA 16059-3137Anthony Brajdic, Director of OperationsPhone (724-898-1220) | Fax (724-898-2229)pinnacleair@hotmail.compinnacleair.qpg.com

PRM Energy Systems, Inc.504 Windamere TerraceHot Springs, AR 71913Ron Bailey, ChmPhone (501-276-2101) | Fax (501-767-7679)rbaileys@prmenergy.comwww.prmenergy.com

ProcessBarron2770 Welborn St.Pelham, AL 35124Cliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)information@processbarron.comwww.processbarron.comSEE OUR AD ON PAGE 28

Processbio A/SPO Box 34 Romeo, MI 48065Jorgen Lyngso, American RepresentativePhone (586-255-7075)jl@processbio.comwww.processbio.com

Protective Packaging Corp.1746 W. Crosby RoadCarrollton, TX 75006Anita Pinkerton, ConsultantPhone (800-644-4032)protectivepackaging@greenpeas.comwww.protectivepackaging.net

Puritan Magnetics, Inc.900 S. Glaspie StreetOxford, MI 48371Andrea Webster, Sales & MarketingPhone (248-628-3808) | Fax (248-628-3844)magnet@puritanmagnetics.comwww.puritanmagnetics.com

RRCBC Global Inc.401 North Main St. Suite 201Hendersoncille, NC 28792Doug King, VP MarketingPhone (828-696-2111)recycle@a-o.comwww.rcbcglobalinc.com

R. W. Heiden Associates LLC1026 New Holland AvenueP O Box 5001Lancaster, PA 17601Richard Heiden, Chief Science and Technology Offi cerPhone (717-299-6860) | Fax (717-299-6868)Rwheidenphd@supersleuthchemists.comwww.supersleuthchemists.com

Rawlings Waste Wood Recovery SystemsPO Box 4485Missoula, MT 59806John Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)john@rawlingsmanufacturing.comwww.wastewoodhogs.comSEE OUR AD ON PAGE 16

REBL Refractories Evaluations Laboratory, ULC#109, 8484 162nd StreetSurrey, BC V4N 1B4 CanadaBryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)bryce.jardine@rebl.comwww.rebl.com

Recast Energy LLC8730 Stony Point ParkwaySuite 100Richmond, VA 23235Brandon Ogilvie, CFOPhone (804-212-3143)bogilvie@recastenergy.comwww.recastenergy.com

Redecam USA2125 Barrett Park Drive, Suite 112BKennesaw, GA 30144Rick Davies, Managing Director, V.P. N. AmericaPhone (678-909-2342) | Fax (678-909-2359)www.redecam.com

Refi ned BioProducts1718 Pine StreetStevens Point, WI 54481John Leschke, New Business DevelopmentPhone (715-869-7866)jleschke@refi nedbioproducts.comwww.refi nedbioproducts.com

Renewable Strategies, Inc.PO Box 185Shoreham, VT 05770Douglas Patterson, PresidentPhone (802-989-0476)doug@renewablestrategies.com

Riley Power Inc.5 Neponset StreetWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 16

RISI4 Alfred CircleBedford, MA 01730Seth Walker, Bioenergy EconomistPhone (781-734-8992)swalker@risi.comwww.risi.com

Roundtable on Sustainable Biomaterials (RSB)60 North Market Street, Suite C200Asheville, NC 28801Matt Rudolf, Regional Director, AmericasPhone (919-810-2295)matthew.rudolf@rsb.orgwww.rsb.org

RTP Environmental Associates, Inc.400 Post AveSuite 405Westbury, NY 11590Jessica Karras-Bailey, PrincipalPhone (516-333-4526) | Fax (516-333-4571)bailey@rtpenv.comwww.rtpenv.com

Rubb Buildings Inc1 Rubb LaneSanford, ME 04073Chuck Auger, Marketing ManagerPhone (207-324-2877)cauger@rubbusa.comrubbusa.com

RWL Water7135 Madison Avenue WestGolden Valley, MN 55427Nii Mensah, VP of Sales & MarketingPhone (763-746-9277) | Fax (763-746-8408)nmensah@rwlwater.comwww.rwlwater.com

SSABIA Inc10911 Technology PlSan Diego, CA 92127Paul Iverson, Product ManagerPhone (858-217-2232) | Fax (858-217-2203)piverson@sabiainc.comwww.sabiainc.com

SAMSON Materials Handling Ltd.Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA Great BritainAndy Blythe, Managing DirectorPhone (441353665001) Fax (441353666734)sales@samson-mh.comwww.samson-mh.com

SCEC 1582-1 N. Batavia StreetOrange, CA 92867Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

SCHADE Lagertechnik GmbHBruchstrasse 1Gelsenkirchen, 45883 GermanyKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122) Fax (4920950316188)fi egenbaum@schade-lagertechnik.dewww.schade-lagertechnik.comSEE OUR AD ON PAGE 29

Company Index

Schnader Harrison Segal & Lewis LLPSuite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222Megan Harmon, PartnerPhone (412-577-5200)mharmon@schnader.comwww.schnader.com

Scientifi c Dust Collectors4101 W. 126th StreetAlsip, IL 60007Andrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)arutherford@scientifi cdust.comscientifi cdustcollectors.com

SciTech GroupTekniikantie 12Espoo, 02150 FinlandJarno Hartikainen, ChemistPhone (358503411998)jarno.hartikainen@scitech.fi www.scitech.fi

SeaHold LLC23551 Rose Quartz DrivePerris, CA 92570Thomas Hintz, Managing PartnerPhone (951-943-9697)tom.hintz@seahold.comwww.seahold.com

Seneca Companies7241 Gaines Street CourtDavenport, IA 52806Chris Biellier, Waste Solutions General ManagerPhone (563-343-4679)cbiellier@senecaco.comwww.senecaco.com

SHW Storage & Handling Solutions GmbHwww.shw-shs.com

Siemens Industry Inc.7101 Hollister RoadHouston, TX 77040Customer Service, Phone (713-939-7400)processanalyticssales.industry@siemens.comusa.siemens.com/processanalytics

Sierra Instruments, Inc. 5 Harris CourtBuilding LMonterey, CA 93940Scott Rouse, Product Line DirectorPhone (831-373-0200) | Fax (831-373-4402)s_rouse@sierrainstruments.comwww.sierrainstruments.com

Smart E2 Solutions14 Edgewood RoadRumson, NJ 07760George St.Onge, Director of Business DevelopmentPhone (732-801-6828) | Fax (732-758-1169)georgesaintonge@se2sol.comwww.SE2Sol.com

SoftPLC Corporation25603 Red BrangusSpicewood, TX 78669Cindy Hollenbeck, VPPhone (512-264-8390)cindy@softplc.comsoftplc.com

Solar Turbines Incorporated9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)lyons_chris_d@solarturbines.comwww.solarturbines.com

South Florida Environmental Services, LLC 2257 Vista ParkwayUnit 25West Palm Beach, FL 33411Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

Spencer Turbine Company600 Day Hill RoadWindsor, CT 06095Chet Adamczyk, Sr Sales Engr - Biogas & WWT Phone (860-688-8361) | Fax (860-688-0098)cadamczyk@spencer-air.comwww.spencerturbine.com

Sterne, Kessler, Goldstein & Fox P.L.L.C.1100 New York Ave, NWWashington, DC 20005Peter Jackman, DirectorPhone (202-772-8585)PJackman@skgf.comwww.skgf.com

STRATA503 Olympic BlvdSanta Monica, CA 90401Josh Seldner, OwnerPhone (310-739-8243)strata.inc@hotmail.comwww.strata-oil.com

Sustainable Oils2790 Skypark DriveSuite 105Torrance, CA 90505Scott Johnson, PresidentPhone (919-428-1102)sjohnson@susoils.comwww.susoils.com

Symbiontwww.symbiontonline.com

SysTech Design, Inc.300 North Pottstown PikeExton, PA 19341John Conley , OwnerPhone (800-456-9460)info@systech-design.comwww.systech-design.com

TTAPPI15 Technology Parkway S.Peachtree Corners, GA 30092Raine Hyde, MarketingPhone (770-446-1400)rhyde@tappi.orgwww.tappi.org

Team Biogas®23551 Rose Quartz DrivePerris, CA 92570Fabian Villanueva, Sales ManagerPhone (951-943-9697)fabian@seahold.comwww.teambiogas.com

TEi Construction Services170 Tucapau RdDuncan, SC 29334Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 5

The Air Compliance Group, LLC 5075 Hollins RoadRoanoke, VA 24019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

The Avogadro Group, LLC2825 Verne Roberts CircleAntioch, CA 94509Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)emirabella@montrose-env.comwww.montrose-env.com

The Solid Waste Association of North America (SWANA)1100 Wayne Avenue, Suite 650Silver Spring, MD 20910Meri Beth Wojtaszek, Deputy Executive DirectorPhone (800-467-9262) | Fax (301-589-7068)marketing@swana.orgwww.swana.orgSEE OUR AD ON PAGE 14

Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 5

Thompson Dehydrating Company2953 SW Wanamaker DrTopeka, KS 66614Ted Thompson, CEOPhone (785-272-7722)angiem@thompsondryers.comwww.thompsondryers.com

Timber Products Inspection1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)thippchen@tpinspection.comtpinspection.com

Timberland Associates, LLC2150 CR 750Dumas, MS 38625Tom Busch, OwnerPhone (662-837-0381)tom@timberlandassociates.comtimberlandassociates.com

Top Wood JobsPO Box 4La Center, WA 98629George Meek, RecruiterPhone (360-263-3371)geo@topwoodjobs.comwww.TopWoodJobs.com

Tower Performance, Inc.4031 BroadwayHouston, TX 77087Jalene Fritz, Parts ManagerPhone (970-593-8637) | Fax (970-472-1304)jfritz@towerperformance.comwww.coolingtowercomponents.com

TrinityRail2525 Stemmons FreewayDallas, TX 75207Gregg Yates, Director, MarketingPhone (214-631-4420) | Fax (214-589-8623)gregg.yates@trinityrail.comwww.trinityrail.com

Triveni Turbine Ltd.12A, Peenya Industrial AreaBangaloreBangalore, 560058 IndiaDeepak Nayak, Asst. Gen. Manager-International Sales & MarketingPhone (918022164000) Fax (918028395945)deepakpnayak@triveniturbines.comwww.triveniturbines.com

Twin Ports Testing1301 North 3rd StreetSuperior, WI 54880Stephen Sundeen, Laboratory ManagerPhone (800-373-2562) | Fax (715-392-7163)stephen.sundeen@twinportstesting.comwww.twinportstesting.com

UUMD Natural Resources Research Institute5013 Miller Trunk HighwayDuluth, MN 55811June Kallestad, Public Relations ManagerPhone (218-720-4300)jkallest@d.umn.eduwww.nrri.umn.edu

Urban Renewable H23010 LBJ Freeway, Suite 1200Dallas, TX 75234Ray Gwin, CEOPhone (214-796-4033)r.gwin@urh2.comwww.urh2.com

Valmet, Inc.3430 Toringdon WaySuite 201Charlotte, NC 28277Kerry Flick, Director, TechnologyPhone (704-541-1453)kerry.fl ick@valmet.comwww.valmet.com

Valuation and Assets Services2108 Carroll Creek ViewFrederick, MD 21702K. Boison, PrincipalPhone (301-646-4119)projects@valuationandassets.comwww.valuationandassets.com

Vecoplan Midwest4005 Earnings WayNew Albany, IN 47150Bill Miller, Chief Operating Offi cerPhone (812-923-4992)bmiller@vecoplanmidwest.comwww.vecoplanmidwest.comSEE OUR AD ON PAGE 19

Company Index

Vecoplan, LLCPO Box 7224High Point, NC 27264Yuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)ychocholko@vecoplanllc.comwww.vecoplanllc.comSEE OUR AD ON PAGE 19

Venture Engineering & Construction, Inc. 1501 Reedsdale StreetSuite 505Pittsburgh, PA 15233Bill Slatosky, Sr. Business Development ManagerPhone (412-231-5890) | Fax (412-231-5891)bsslatosky@ventureengr.comwww.ventureengr.com

Verdanté BioEnergy Services626 Harper Ave NWPO Box 2917Lenoir, NC 28645G. David Waechter, OwnerPhone (828-394-1246)david@verdantebioenergy.comwww.verdantebioenergy.com

Victor Pellet MillWenhua Road Zhengzhou, ChinaWales Z, SalesmanPhone (8637156747890)pelletizermill@gmail.comwww.pelletizermill.com

Viessmann Manufacturing Company (U.S.), Inc.45 Access RoadWarwick, RI 02886Lee Gustafson, MarketingPhone (401-732-0667) | Fax (401-732-0590)gusl@viessmann.comwww.uncompromise.us

Vogt Power International13551 Triton Park BoulevardSuite 2000Louisville, KY 40223Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/heat-recovery-systems/vogt-power-international

WWarren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)info@warrenbaerg.comwww.warrenbaerg.com

WastAwayP.O. Box 7116McMinnville, TN 37111 USTerry Moore, Chief Business Development Offi cerPhone (931-815-8520)tmoore@wastaway.comwww.wastaway.com

Waste Environmental Solutions, LLC.437 Linden AveElizabeth, NJ 07202Nestor Vela, COOPhone (732-489-0015) | Fax (732-833-8874)nestorvela@wesinternational.comwww.wesinternational.com

Waterleau1300 Adams Ave, Apt. 32PCosta Mesa, CA 92626Laetitia d’Ursel, Business Development ManagerPhone (714-727-7607)laetitia.dursel@waterleau.comwww.waterleau.com

Webiomass Inc.16 Washington St (mail)56 Howe St (plant)Rutland, VT 05701George Robbins, PresidentPhone (802-772-7563) | Fax (802-772-7564)george@webiomass.comwww.webiomass.com

WebSite Names OnlyBox 304Nanoose Bay, BC V9P 9J9 CanadaGary R CampbellPhone (250-468-7047)mail@siwash.netwww.websitenamesonly.com

Welding Technologies2330 Centennial DriveGainesville, GA 30504 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)jpasquariello@babcockpower.comwww.babcockpower.com/products/boilers-boiler-services/welding-technologiesSEE OUR AD ON PAGE 5

West Oregon Wood Products, Inc.PO Box 249Columbia City, OR 97018Chris Sharron, CEOPhone (503-397-6707) | Fax (503-397-6887)csharron@wowpellets.comwww.wowpellets.com

Western Renewable Technologies310 N Geneva RoadLindon, UT 84042Mel Radmall, CEOPhone (801-785-9330)info@wrtpyrolysis.comwww.wrtpyrolysis.com

Williams Patent Crusher & Pulverizer Company, Inc.2701 North BroadwaySt. Louis , MO 63102Steve Baumgartner, Sales ManagerPhone (314-621-3348) | Fax (314-436-2639)sales@williamscrusher.comwww.williamscrusher.com

Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)sales@wolfmhs.comwww.wolfmhs.comSEE OUR AD ON PAGE 27

Wood Waste to Rural Heat110A Slater Road NWCranbrook, BC V1C 5C8 CanadaDavid Dubois, Project CoordinatorPhone (250-489-4356) | Fax (250-489-1886)info@cfek.cawww.woodwaste2ruralheat.ca

YYongHuawww.briquettemachinecn.com

YongHuaZhengzhouroad 559Zhengzhou, 450042 ChinaJack Zhao, 先生Phone (037167817233)binyazhao123@gmail.comwww.briquettemachinecn.com

directory.biomassmagazine.com

BECOME A SPONSOR Sponsorships Drive Recognition

& Return on Investment

October 26-28, 2015Hilton Omaha, Omaha, NEwww.AdvancedBiofuelsConference.com

Gain Exclusive ExposureBook Your Sponsorship Today for 2015As a sponsor of the 2015 Advanced Biofuels Conference & Expo, you will have an opportunity to position your organization as a leader and supporter of the renewable fuels industry in important international markets. For pricing and additional information, please contact your BBI International Account Executive at (866) 746-8385 or service@bbiinternational.com.

TWO FREE Producer Passes Per Biofuels FacilityEthanol | Biodiesel | Advanced Biofuels | Cellulosic

NETWORK WITH PRODUCERS

RBP is the marketing and sales channel for products and materials produced by CPPL. Current annual capacity is 10t pulp and 10t lignin, increasing to 200t pulp and 100t lignin in Q4 2015.

Private CompanyBio-Based Chemical and Product Sales

info@refinedbioproducts.comwww.refinedbioproducts.com

WIST connects the University of Wisconsin-Stevens Point to business and industry and provides research, laboratory services, and education. Our research includes biofuels, renewably sourced chemicals from biomass, packaging, compostability analysis, paper grade development and value-added uses of agricultural and forestry residuals.

Research InstituteCellulose Processing Lab

Laboratories and Analytical Capabilities Education and Workforce Development Basic and Applied R&D Independent Process and Products Evaluation

www.uwsp.edu/wistwist@uwsp.edu

During 2013-2014, AST procssed a wide variety of biomass to produce over 2 tons of sugar, over 1 ton of pulp for paper, and 1 ton of pure lignin.

Private CompanyPilot Plant Bio-Refinery

Integrated Pilot Plant Biorefinery Applied R&D/Technology Development Product & Process Improvement Manufacturing/Limited Production

www.amsnt.cominfo@amsnt.com

A University - IndustryPartnership

Sugar derivatives Biochemicals Biofuel Bio-oil

Outputs: High quality pulp C5 and C6 sugars Pure lignin Lignin/polymer compound

Inputs: Agricultural waste Forestry products & waste Any other lignocellulosic waste material in any form, from sawdust to woodchips

Biomass to End Product Biomass fractionation Organosolv pre-treatment Lignin extraction and recovery process High pressure and high temperature chemical processes and catalytic conversions Fermentation Metabolic engineering Process simulation

CPPL Technologies

Capabilities include, but not limited to:

Biochemical reactors for up to 400 PSI and 450 F High pressure/high temperature biomass fractionation Solvent recovery Pulp production, washing, drying Acid and enzymatic hydrolysis Sugar purification and dehydration Fast pyrolysis Fermentation Paper making and testing Analytical/experimental analysis Independent process/product development and evaluation Biomass characterization Chemical analysis Current Capacity - 200 Lb biomass processing/day including a 140 G high pressure/high temperature reactor Q4 2015 - 2 Ton biomass processing/day including a 2000 G high pressure/high temperature reactor with a powerful mixer.

CPPL Capabilities

A Unique Integrated Pilot Plant with 2 Ton/Day Processing Capability to Evaluate the Production of Value Added Products from Renewable Resources

PROVIDING PRE-COMMERCIALIZATION PILOT PROCESSING CAPABILITIES TO BIOMASS USERS, BIOMASS OWNERS, AND TECHNOLOGY DEVELOPERS

CPPLCellulose Pilot and Processing Lab

Hazlehurst, Georgia, USA

A S T E CW O O D P E L L E T P L A N T S

Modular design with replicated 20 TPH rated “lines”

One source for equipment and construction

No add-on equipment needed to reduce VOC emissions

Quick setup and startup with guaranteed production

24/7 support, parts and service

Any hard wood or soft wood species

AsAsAsAsAA tetetttetec,c,ccc, IIIIIncncncnc. . isisisisss aaa mmmemememembebebeebeeeerrr r r ofofofff tttttthehehehehehee AAAAAAAAstststsststececeecee IIIIndndndndndddusuusstrtrtrtrieieeeieies,s,s,s,ss IIIIIIncncncncncnnn . . fffffamamamamaaa ililililili yyy y y ofofofoffof ccccomomoommmpapapaap nininin eseses,,a a bibibibillllll ioioioioonnn dododododoollllarar ppppererreree yyyyyeaeaeae r r rr cocorprpppororatatatataa ioioioion n n heheheheeadadadadaa ququuuuuarara teteteteerererereeed dd d ininininnn CCCCCChahahahhahahahhatttttttttananannannnooooooooooooo gagaagggaag ,, TNTNNTNTNTN, , USUSUSUSUSUU A.AA.AAAAAAA

2015 Biomass Industry Directory

Documents