Post on 28-Mar-2016
description
transcript
Port Townsend & Jeff erson County Leader 2012 Local • 1
Lake Leland
Fort Worden Fort Worden State Park
Mystery Bay
Dosewallips State Park
Dosewallips State Park
Dosewallips
Little Quilcene River
GardinerGardiner
Protection
Marrowstone Island
Nordland
Coyle
QuilceneQuilcene
Four CornersCorners
Silverdale
Irondale
ToToTandos
Peninnsususl a
entntn
Da Da D
C e R
y
ayayaRdRdR .
yRdRdR.
Port TownsendCoupeville Ferry
Ferry to San Juan Islands
Visitor Center
Visitor Center
Corners
Little Quilcene River
Port Townsend
CapeGeorge
Visitor Center
The
INSIDE:Thousands of dollarsin coupon savings!
State Park
Mystery Bay State Park
Mystery Bay State Park
Mystery Bay
Fort Flagler Fort Flagler State Park
Fort Flagler State Park
Fort Flagler
Fort Townsend Fort Townsend State ParkState Park
Marrowstone Island
Naval Naval Magazine Magazine
Indian Indian Island Island
Nordland
Port TownsendCoupeville Ferry
Fort Townsend Fort Townsend
Visitor Center
Coyle
BrinnonVisitor CenterVisitor CenterVisitor Center
Crocker Lake
GibbsLake
Sandy Shore Lake
Sandy Shore Lake
Sandy Shore
mountntn RdRdR .
QuilceneVisitor CenterVisitor Center
d
Ludlow
R
Ludlow
R
Ludlowd Ludlowd Ludlow
RdR.
R
Bridgehaven
INSIDE:
Anderson Lake Anderson Lake Anderson Lake State ParkState ParkState Park
H.J. Carroll Park
Chimacum
Port Hadlock
Irondale
DiscoveryBay
E
OaOaO kakaBa
CentntnerRdRdR
Wesesetsts
Va Va Vlleyeye
HadlockHadlockThe
Mystery Bay State Park
Mystery Bay State Park
Mystery Bay
GibbsLake
Eaglemo
d.ll
Your passport toYour passport toYour passport toLake LelandYour passport toLake LelandYour passport to
n
Your passport to
nt
Your passport to
tntn
Your passport to
ntneYour passport toerYour passport torRYour passport toRdYour passport todRdRYour passport toRdR.Your passport to.
D
Your passport to
D
Your passport toYour passport toVisitor
Your passport toVisitor CenterYour passport toCenterYour passport to
Local bargains,
C
bargains,
Ce
bargains,
e a
bargains,
ab
bargains,
bo
bargains,
ob bargains,bR bargains,Rd bargains,dRdR bargains,RdR. bargains,.
from from from from LocalC
LocalCo
Localoy
Localyl
Localle
Locale
businesses, Shine businesses, ShineR
businesses, Rd businesses, dRdR businesses, RdR . businesses, .
for for Local people.
SUPPLEMENT TO THEPORT TOWNSEND & JEFFERSON COUNTY LEADER
PaPaP rarar dada idid seBaBaB yaya
Visitor Center
Ludlowd Ludlowd Ludlow.
Your passport toYour passport toCenterYour passport toCenter
businesses, Shine businesses, Shine
2 • 2012 Local Port Townsend & Jefferson County Leader
Learn more > ourfirstfed.com 800.800.1577
Member FDIC
How Local is Your Bank?
First Federal, the only truly local bank on the Olympic Peninsula.
Bank Headquarters
Bank of America Charlotte, North Carolina
Chase Bank New York, New York
Columbia Bank Tacoma, Washington
KeyBank Cleveland, Ohio
Kitsap Bank Port Orchard, Washington
Sound Community Bank Seattle, Washington
Sterling Savings Bank Spokane, Washington
Union Bank San Francisco, California
US Bank Minneapolis, Minnesota
Wells Fargo San Francisco, California
First Federal Port Angeles, Washington
Port Townsend & Jefferson County Leader 2012 Local • 3
901 Ness’ Corner RoadPort Hadlock, WA
Building partnerships since 1984.Building partnerships since 1984.
360-385-1771
/HadlockBuildingSupplyhadlockbuildingsupply.com
family owned & operated since 1984
4 • 2012 Local Port Townsend & Jefferson County Leader
$5 offYOUR $20.00 PURCHASE
Does not apply to the purchase of tools, lumber or sale items. Limited to stock on hand. Do not combine with any other o� er. See store for details. Expires 10/31/13.
901 N
ess’ C
orne
r Roa
d • Po
rt Ha
dloc
k 36
0-38
5-17
71 • h
adlo
ckbu
ildin
gsup
ply.c
om
Building partnerships since 1984
$10 off$YOUR $50.00 PURCHASE
Does not apply to the purchase of tools, lumber or sale items. Limited to stock on hand. Do not combine with any other o� er. See store for details. Expires 10/31/13.
901 N
ess’ C
orne
r Roa
d • Po
rt Ha
dloc
k 36
0-38
5-17
71 • h
adlo
ckbu
ildin
gsup
ply.c
om
Building partnerships since 1984
$20 off$YOUR $100.00 PURCHASE
Does not apply to the purchase of tools, lumber or sale items. Limited to stock on hand. Do not combine with any other o� er. See store for details. Expires 10/31/13.
901 N
ess’ C
orne
r Roa
d • Po
rt Ha
dloc
k 36
0-38
5-17
71 • h
adlo
ckbu
ildin
gsup
ply.c
om
Building partnerships since 1984
$40 off$YOUR $200.00 PURCHASE
Does not apply to the purchase of tools, lumber or sale items. Limited to stock on hand. Do not combine with any other o� er. See store for details. Expires 10/31/13.
901 N
ess’ C
orne
r Roa
d • Po
rt Ha
dloc
k 36
0-38
5-17
71 • h
adlo
ckbu
ildin
gsup
ply.c
om
Building partnerships since 1984
Port Townsend & Jeff erson County Leader 2012 Local • 5
Ajax Cafe . . . . . . . . . . . . . . . . 15Bonita’s Four-Legged
Friends . . . . . . . . . . . . . . . 45Brickhouse Bistro . . . . . . . . . 19Chandlery c/o NWMC. . . . . . . 3Circle & Square Auto Care . . 47Creative Union Fabrics. . . . . . 7Derr Jewelry . . . . . . . . . . . . . 42Don’s Pharmacy &
Soda Fountain. . . . . . . . . 15Dos Okies Barbeque. . . . . . . 13El Sarape . . . . . . . . . . . . . . . . 45Elevated Ice Cream . . . . . . . 19Face of Grace. . . . . . . . . . . . . 15Fins Coastal Cuisine . . . . . . . . 3First Federal . . . . . . . . . . . . . . 2Four Sisters . . . . . . . . . . . . . . 41Frameworks . . . . . . . . . . . . . 43Gardens at Four Corners . . . 19Gudlife. . . . . . . . . . . . . . . . . . 13Hadlock Building Supply. . . . 3Homer Smith Insurance . . . 21Je� erson Transit. . . . . . . . . . 13Jordini’s On The Water . . . . . 29Khu Larb Thai Restaurant . . 37Leader . . . . . . . . . . . . . . .27, 33Lulu’s B&B for Dogs . . . . . . . 41Maricee Fashions . . . . . . . . . 43McDonald Insurance Group. . 41Mean Bean Co� ee Co. . . . . . 21Muskan Indian Restaurant 29
Naturalist Carpet Cleaning 27Nourishing Life Acupuncture 10Olympic Art & O� ce . . . . . . 13Pane d’Amore . . . . . . . . . . . . 29Perfect Dreams Cupcakes . . 29Pet Town . . . . . . . . . . . . . . . . 35Petals Flower Shop . . . . . . . 27Port Townsend Farmers
Market . . . . . . . . . . . . . . . 35Pourhouse. . . . . . . . . . . . . . . 45Printery Communications. . 11PT Shirt Co. . . . . . . . . . . . . . . 45Public House Grill. . . . . . . . . 43Quimper Mercantile Co . . . . 37Remax First. . . . . . . . . . . . . . 11Seams To Last . . . . . . . . . . . . 27Solar Hot Water . . . . . . . . . . 43SOS Printing . . . . . . . . . . . . . 10Sport Townsend . . . . . . . . . . 19Sweet Laurette Cafe
& Bistro . . . . . . . . . . . . . . . 3United Good Neighbors. . . . 48Uptown Nutrition . . . . . . . . 19Wandering Wardrobe . . . . . 15Water Street Creperie . . . . . 37Weddings by Design . . . . . . 24Wine Seller . . . . . . . . . . . . . . 41
Index to
PUBLISHERScott Wilson
EDITORAllison Arthur
DESIGN & LAYOUTChris Hawley
PRODUCTIONJohn StangerMarian RohKathy Busic
WRITERSAllison ArthurMegan Clafl inTristan HieglerViviann Kuehl
COPY EDITORSRobin Dudley Lynn Nowak
Sunny Parsons
ADVERTISINGSara RadkaTami HewittCarla Patton
Catherine Brewer
THE LEADER226 Adams Street
Port Townsend, WA 98368
360.385.2900website:
ptleader.com
Weddings by DesignWine Seller . . . . . . . . . . . . . .
ADVERTISINGSara Radka
Copyright 2012Port Townsend &
Jefferson County Leader
6 • 2012 Local Port Townsend & Jeff erson County Leader
Chamber supports local businesses
Why does it matter that people shop locally?“Every purchase you make locally helps to keepour communities vibrant and economicallysustainable,” says chamber Executive Director Teresa Verraes.
What does the chamber do for local businesses?“The chamber’s vision is to be the leading network fostering the most well-informed, driven, dynamic businesses and professionals in Jefferson County,” says Verraes.
You sponsor a lot of events to support businesses, don’t you? “There’s so much going on to create a more vibrant economy in Jefferson County,” says Verraes, urging businesses to take advantage of programs like the free small business symposium that was offered as well as opportunities with the Young Business Professionals, Team Jefferson and Main Street.
You are in this for the long haul?“The Jefferson County Chamber of Commerce has a commitment to the long-term economic, social and environmental health of our region.”
And your mission then is to build a local economy?“Our mission is to build and serve a large, diverse member network by providing resources and opportunities for connecting with the greater business community, informing members on matters that impact the local economy, promote member businesses throughout the region and advocate for member issues and opportunities to support business growth and well-being.”
Name some of kinds of events you sponsor?“In collaboration with Local 20/20, Main Street, EDC/ Team Jefferson and the Silverwater Café we’re debuting ‘Fixing the Future,’ which is about strengthening our local economy. We put on programs like ‘Marketing in the Real World.’ Check out our website at jeffcountychamber.org. There’s so much going on.”
– Allison Arthur
Jefferson County Chamber of Commerce ambassadors and friends celebrate the expansion of Conservatory Coastal Homes. The business moved this year from a small space to a large corner lot in downtown Port Townsend. Submitted photo
Chamber supports local
Why does it matter that people shop locally?“Every purchase you make locally helps to keep
sustainable,” says chamber Executive Director Teresa Verraes.
Port Townsend & Jeff erson County Leader 2012 Local • 7
Present this coupon in person and receive
20% OffAny Purchase of $25 or more; one time purchase,
not to be combined with any other discounts.
Open 7 Days ~ 10 a.m. -5 p.m.
Located at the end of Water Street • 360.385.3628 ext. 101Located at the end of Water Street • 360.385.3628 ext. 101
The Wooden Boat ChandleryPurveyors of All Things Nautical
Creative Union Fabrics112 Kala Square Place, Port Townsend 360-379-0655
Spend $50 or more & receive$10 Off !Expires 3/31/13
Waterfront views1019 Water Street
360-379-FISH (3474)www.fi nscoastal.com
Nobody prepares seafood like
Sandwiches, steaks, pastas, salads all at
Open 7 days for lunches & dinner at
Now in our 11th year & going strong.
$10OFFpurchase of $40 or more!
Free Dessert!With purchase of 2 entreés
Thursday, Friday & SaturdayDinners 5-9 pm
Café & BistroCafé & BistroSweet Laurette
8 • 2012 Local Port Townsend & Jefferson County Leader
THE WOODEN BOAT CHANDLERYSailing Supplies . Navigational Instuments .
Ships’ Bells & Clocks . Binoculars . Jackets . Vests . Hats & Scarves . Unbreakable Dinnerware . NOAA Charts & Cruising Guides . Maritime Books . Prisms . Port Holes . Lighting . Blocks . Cleats . Oarlocks . Shipmate Stoves . Nautical Gifts & Galleyware . Pirate Gear & Sailor Toys for
Li’l Scuppers.
A hidden paradise . . .right here on the peninsula!
Fabrics • Notions • Thread • Fine ScissorsPatterns & More!
Come see our selection.Happy crafting!
Creative Union Fabrics112 Kala Square Place, Port Townsend 360-379-0655
1019 Water Street • Port Townsend • 360-379-FISH7 days a week • 11 am - 9 pm • www.� nscoastalcuisine.com
Come Enjoy a relaxing meal & a great view!
Tuesday Nights~ half priced bottle of wine ~
Find us. Like us.
Laurette believes in simply fresh, delicious food, which
she often buys at the Farmers’ Market down the street.
Wed., Thur., Fri. • Breakfast / Lunch: 8 am to 2:30 pm
Sat. Brunch: 8 am - 2:30 pmSun. Brunch: 8 am - 2 pm
Thur., Fri. & Sat. Dinner: 5pm-9pmClosed Mondays & Tuesdays
1029 Lawrence St. • 385-4886www.sweetlaurette.com
Port Townsend & Jeff erson County Leader 2012 Local • 9
‘The Local’ bagel evengets recycled
Business: Bob’s Bagels, owned by Bob Larsen
How did you start?“We started by giving away bagels to friends andclients who, in turn, gave them to friends, which startedthe demand for more,” says Larsen. “The fi rst day, we made 68 bagels and sold 40.”
How many are you making today?“We’re making about 1,200 a week and selling all but a handful we save for ourselves.”
You call one sandwich “The Local.” Why?“‘The Local’ is from our fi rst menu. It’s a bagel with Cape Cleare smoked salmon and Mt. Townsend Creamery fromage blanc. With our current menu we could call every sandwich ‘The Local.’ With the exception of cream cheese and butter, all our sandwiches have local ingredients.”
And you do something cool with leftovers?“The leftover toppings that do not stick to our bagels are collected and given to Finnriver Farm to feed their chickens. We then buy eggs from them to make into sandwiches at the [Port Townsend farmers] market. Strange full circle.”
And you are making something new in house?“Our vegetarian pecan sausage is made in house, and it also has local ingredients in it like Pane d’Amore bread crumbs, Mystery Bay chèvre and ricotta, Midori produce and ferments, Colinwood produce, Red Dog produce, Nash’s fl our, to name a few supplies.”
How do you support local businesses?We listen to music a lot, including KEXP in Seattle and KPTZ. We cater both of their pledge drives. We buy several CDs from Quimper Sound each month. All our offi ce supplies come from Olympic Art & Offi ce. We buy kitchen wares from What’s Cookin’ and Green Eyeshade. Because we do so much of our delivering and commuting via bicycle, we try to support all the bike shops in town and slightly out of town. Some others are coffee from Sunrise, soaps from Bunny’s and refueling, after 40 miles of deliveries, with breakfast at the Moose or Goose.”
– Allison Arthur
“The Local” is the name of a bagel sandwich created by Bob Larsen. It includes Cape Cleare Fishery salmon and Mt. Townsend Creamery’s cheese, featured here on an “Everything” bagel. Photo by Allison Arthur
‘The Local’ bagel even
“We started by giving away bagels to friends andclients who, in turn, gave them to friends, which started
10 • 2012 Local Port Townsend & Jefferson County Leader
Nourishing Life Chinese Medicine
Acupuncture & Herbs
www.nourishinglifeacupuncture.com
$30
Community Acupuncture Clinic
$10 initial paperwork fee does apply for New Patients
1233 Lawrence Street 360-379-6798
Mondays4 - 7
Wednesdays1 - 4
Fridays1 - 4
$30 Affordable Acupuncture Treatments!
2319 Washington Street, Port Townsend385-4194 sosprinting.biz sos@olympus.net
Full color, Full service, Design to bindery.
Gr
een Business
ENVIRONMENTAL AW
ARD
My great-grandfather John Huntingford was a county commissioner who built our courthouse as we made the transi-tion from territory to statehood. My father George served for 22 years and my cousin Glen for 12 years. Their tradition of service is a daily inspiration.
While SOS Printing has been serving the people and businesses of Jeffer- son County for 35 years, owner Dan Huntingford is a fourth generation native. The Huntingford family have been helping make Jefferson County a better place since 1869. (or thereabouts) So when you need print- ing, why not head on down to the beach, to SOS Printing – National Award winning, one of the finest small print- shops in America.
Port Townsend & Jefferson County Leader 2012 Local • 11
KEVIN MILLER22 Years of Local Service(360) 385-7348kevin@porttownsendwa.com
JEFF ASHMOREReal Estate Professional
(360) 531-4131ashmore.je� @gmail.com
*Some restrictions apply. Contact listing agents for details.
$10000 OFF
Design it. Print it. Copy it. Mail it.631 Tyler Street, Uptown PT M-F 9:00-5:30
800-339-1256 360-385-1256 www. printery.com
Web and Graphic Design for Company Identity Package, Logo, Brochure, Direct Mail or Newsletter
One coupon per customer. Offer expires 11/30/12
Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.
Valid thru 3/30/13 • First 7 coupons only! *
$30,000 potential savings!
Lynnesfield Homes
7 GOLDEN TICKETS10% OFF
$10000 OFF
Design it. Print it. Copy it. Mail it.631 Tyler Street, Uptown PT M-F 9:00-5:30
800-339-1256 360-385-1256 www. printery.com
Web and Graphic Design for Company Identity Package, Logo, Brochure, Direct Mail or Newsletter
One coupon per customer. Offer expires 11/30/12
Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.Design it. Print it. Copy it. Mail it.
12 • 2012 Local Port Townsend & Jeff erson County Leader
Mercantile – a new localanchor downtown
Quimper Mercantile is one of the newestbusinesses in Jefferson County, and it was startedby and for locals. The community-owned business– more than 850 people have bought stock in thecompany – is open in downtown Port Townsend where Swain’s Outdoor and More had been for years. Quimper aims to be an anchor store to downtown.
What’s the aim of Quimper Mercantile?“We want to bring back everyday shoppers, people who would otherwise go online or wait to go to Sequim. Instead, we want people to say, ‘I’m going to go downtown to Quimper, they might have it,’” says Quimper Mercantile CEO Peter Quinn.
You have a motto, don’t you? “My slogan is ‘We just want to buy some socks,’” Quinn says. “We’ll have everyday things at everyday prices.”
How many local products do you have to start?“Fifteen or 20 or more. It’s an ongoing process. We won’t stop adding local products. We’ll be expanding our line.”
And you’re employing local people? “Yes. We have eight people now. We have people from Port Townsend to Brinnon. Everyone lives locally.”
What do you need to be successful?“We need people to shop and we need to sell more stock [in the company]. We’re really pleased with the depth and breadth of what we have, but we have other uses for the money. We could easily put in another 50 to 60 percent of the inventory and all that takes is more investing.”
How excited are you for this for the local economy?“I don’t think there’s a question that this is worth doing. We know how valuable it is to have a vibrant downtown, and you can’t do that without an anchor tenant. People won’t come down every day if they don’t think there’s something for them. They have to have a feeling they are going shopping. It’s essentially the Port Townsend mall.”
– Allison Arthur
Quimper Mercantile assistant manager Holly Mayshark, manager Shelton Spencer and CEO Peter Quinn note that clothing and shares in the store are available. Photo by Allison Arthur
Mercantile – a new localanchor downtown
businesses in Jefferson County, and it was started
Swain’s Outdoor and More had been for years. Quimper aims
Port Townsend & Jeff erson County Leader 2012 Local • 13
J’eet Yet?Your Local BBQ Joint
Since 1999
2310 Washington St., Port Townsend • We Cater!360.385.7669 • www.dosokiesbarbeque.com
Dos Okies BBQGenuine pit-smoked BBQ
(360) 385-4777www.jeffersontransit.com
Car: $15,000, Car Insurance: $300Tank of gas: $40
Texting while driving: $124
Riding Jefferson Transit: $1.50Save your bucks & ride with us!
220 Taylor Street • 385-3141 • fax 379-9784 • Mon. - Fri. 9 - 5:30, Sat. 10 - 5
Why put more miles on old Bessie? We have what you need and we will special order!
220 Taylor Street • 385-3141 • fax 379-9784 • Mon. - Fri. 9 - 5:30, Sat. 10 - 5220 Taylor Street • 385-3141 • fax 379-9784 • Mon. - Fri. 9 - 5:30, Sat. 10 - 5
• Business Supplies• Business Solutions• Real People • Plus Art
Shop with us at www.iteminfo.com
Gudlifewww.Gudlife.com
Social network for the
Homo \ Bi \ Transcommunity of the Olympic Peninsula
Networking E-List • Weekly LunchesMonthly Potlucks • Seasonal Dances
Gay-owned Business/Services Listing
Come on out - it’s all Gud!
14 • 2012 Local Port Townsend & Jeff erson County Leader
Quilcene Village Store juggles local needs
Principals: Tom and Cass Brotherton, Greg andStacey Brotherton, Sage Brotherton and CathyBarsukoffHow long in business: Opened for gas inNovember 2011; food stocked since April 2012
What do you provide that’s different?“We’re trying to take the standard gas station and tweak it to make it a more locally centered grocery,” says Greg Brotherton. “Our goal is to serve the local people. Sometimes they want things from farther afi eld, and we accommodate that.”
How local are you?“The closest local farm whose products we carry is 300 yards away. It’s not the path of least resistance to get local stock. We need to meet people, see what they are producing and in a lot of cases, pick it up.”
What do people like about your store?“People like the friendly atmosphere. We are trying to harken back to the days when Mary ran the Village Store, and I think we are succeeding. She made the store a village center, and she carried whatever people wanted. Our products run the gamut, from standard gas station fare to organic grocery with local produce and fair trade handicrafts. We have Scooby Snacks dog treats, imports, bulk foods and ethanol.”
How do you want to be local?“We love being here. We’ve been here a year already, and I get stressed out going over the Hood Canal Bridge. It feels like home. We want to do everything we can to make it a vibrant community.”
– Viviann Kuehl
Greg Brotherton, along with his parents, wife and daughter, and Cathy Barsukoff keep things going in the store. Here he is caught juggling oranges between the arrays of fresh local produce and meats.
Photo by Viviann Kuehl
Port Townsend & Jeff erson County Leader 2012 Local • 15
O� er expires 6/30/13
Don’s Breakfast
Special
Locally owned since 1962.
$499with this coupon!
SpecialSpecial
633 Water Street Appt: 360.301.5060 Store: 360.385.9294
“I’ve traveled the world, and Julie’s facial
is the best I ever had.”– Marion Kennedy,
Port Orchard
$10 Off any Facial$5 Off Any One Wax Service
*Discount applies for an equal-or-lesser-priced dinner, when paying full price for the � rst. O� er Valid Sun.-Thurs. only. Not valid on holidays. Expires 3/31/13.
PURCHASE ONE ENTRÉE
O� er Valid Sun.-Thurs. only. Not valid on holidays. Expires 3/31/13.Open Tues-Sun at 5pmLower Hadlock on the Waterfront360-385-3450 www.ajaxcafe.com
& receive a second at HALF PRICE!*
Wandering Wardrobe
Visit the ‘Garment District’ on Washington Street!
20% O� One Full-Priced Item936 & 926 Washington Street • Port Townsend
PT Pearl
16 • 2012 Local Port Townsend & Jefferson County Leader
Established in 1962, Don’s Pharmacy Soda Fountain has grown to be a local favorite. We serve delicious home-style meals and snacks, still grating potatoes for hash browns, slow-roasting choice beef and turkey and doing all the baking from scratch. Come try our wonderful soups, treat yourself to the best pie around, or enjoy old-fashioned bread pudding like Grandma made. For cool refreshment indulge in “Olde Time” Soda Fountain specialties such as Green River or Brown Cow or tangy Phosphate. Or bring a friend or the family and take on the biggest Banana Split you’ve ever seen!
Welcome to good food and a piece of Port Townsend history in a friendly atmosphere.
julie hoffmanesthetician • ownerInt’l cert • 20 years
www.faceofgraceskincare.com
Award-winning skin-care products: Eminence Organic, Jan Marini, Jane Iredale Make-up & more!
Complimentary consultations.
Mon-Fri 11- 5
Sat 10:30 - 5
• Retail Shop• European facials• Microdermabrasion• Dermaplaning• Oxygen treatments• Manual lymphatic drainage
You will be hard pressed to � nd long-time locals that don’t have a story to tell about the Ajax Café. The Ajax has been a locally
operated café for over 34 years with a long colorful history. It is o� the beaten path but once found, its out of the ordinary character make it hard to forget. The customers, former owners, performers and employees of the Ajax have contributed to the Ajax’s evolution and continue to put it in its own unique class. The Ajax uses as many products as possible including locally grown produce, cheese, � sh and many wines.
operated café for over 34 years with a long colorful history. It is o� the
Local Favoritefor 34 Years and Counting.
Wandering Wardrobe
• vintage boutique• whimsical wear• beautiful things
• 14 years of delight
360.379.4691
PT Pearl• sustainable clothing & gifts• fair trade/US made• a stone’s throw from the Haller Fountain
360.385.1018
936 & 926 Washington Street • Port Townsend
Visit the ‘Garment District’ on Washington Street!
Port Townsend & Jeff erson County Leader 2012 Local • 17
Enanimals jewelryhas a story, history
Name of business: Enanimals, owned byMichele RaneyHow long in business: 30 years
What is unique about your products?“Because of my subject matter – wildlife, marine life, fl ora, Celtic designs and more – I can offer handmade jewelry to a large audience of both men and women,” says owner Michele Raney. “I take inspiration from my life experiences and the places I have visited throughout my travels and my upbringing.”
How do you encourage people to shop local?“By participating in the community both as a business owner and a volunteer it’s only natural that opportunities to shop locally, and to get involved locally, come up in conversation.”
What do you wish people knew about you?“I take the opportunity to educate people about my process every chance I get. It’s one thing to see my jewelry as a fi nished product, but there is a story, a history behind the process that is key to appreciating each piece.”
What do you shop for locally?“Personally I shop locally for groceries; I’ll often purchase fruits and vegetables from the farm stand near my home in Port Hadlock. I also love to shop the local thrift stores for clothing. For my jewelry I get some parts from the local bead shop. I purchase my enamels from a Seattle-based business but I do take advantage of local business for printing and purchase a lot of my offi ce and art supplies locally. I like knowing that what I spend here goes towards supporting others who live here.”
Ever have an “ah-ha moment” about shopping locally?“I’ll often barter and trade locally for products and services that I need, which is really at the root of local economics.”
– Megan Clafl in
Enanimals owner Michele Raney engraves an original design in graphite with traditional tools, then makes a steel-block die of the design with an electrical discharge machine. Submitted photo
has a story, history
“Because of my subject matter – wildlife, marine life, fl ora, Celtic designs and more – I can offer handmade jewelry
18 • 2012 Local Port Townsend & Jeff erson County Leader
Robert Farr holds an antique camelback mantel clock that started his adventure into clock repair, which he does from his home in Port Ludlow. Photo by Allison Arthur
Father Time keeps past presentBusiness: Father Time fi xes clocks of all kinds, specializing in antique clocks.Owners: Robert Farr and Martha McMahon,Port Ludlow
How did the business start? “I inherited a clock from my grandmother and Ialways remembered it chiming,” says Farr, whorecalls he had the clock fi xed to the tune of $500.“While I was driving home, it hit me that I had repaired airplane engines. So when I got it home I took it apart and put it together. It’s still running. It became my evening job while I was working at Horizon Airlines.”
Are there really that many clocks to fi x?“In Port Ludlow and Port Townsend, there is an amazing number of clocks. I’ve repaired clocks from the 1700s. There’s one from 1741 that started its life in Europe. It’s been passed through generations, and every 30 years they’ve had it serviced by some clockmaker. My name is on that clock now, too.”
How far will you go to pick up an old clock?“We go from Silverdale to Port Townsend and all the way out to Port Angeles. We do an average of 150 to 200 clocks a year.”
What’s been the most interesting clock? “For myself, probably the most interesting clock was an 1800s cuckoo clock that I restored myself. It spent 30 years in a barn. It was basically junk, but I’ve restored it and got the birds working. Our cat likes to watch.”
What have you learned about locals from your business?“There’s a lot of good U.S. history here. I was totally amazed. There’s a lot of interesting people here, and they all have these fascinating stories.”
— Allison Arthur
Port Townsend & Jeff erson County Leader 2012 Local • 19
627 & 631 Water Street, Port Townsend
360-385-1156Open at 10 am – see our website at www.ElevatedIceCream.com
or call for seasonal closing times
10%OFF
“Rainy Day”Ice Cream Coupon
10% O� your Ice Cream purchase on any rainy day(even slightly rainy!) With this coupon. Exp. 4/30/13.
• 2 Acres - from protected annuals to large trees• Our prices & quality will make it worth the trip!• 2 Acres - from protected annuals to large trees
Open 7 Days a WeekMon-Fri: 9-6 • Sat & Sun: 9-5
321 Four Corners Rd., PT360-379-0807
• 2 Acres - from protected annuals to large trees15% O� Plant Purchases
Exp. 3/31/13
Save $3 on anyUptown Nutrition
Brand Supplements
1002 Lawrence St. • 360-385-3290 • www.uptownnutrition.com
$3OFF
No valid with any other o� er!Expires 3/31/13
1044 WATER STREET • MON-SAT: 9-8 & SUN: 10-6 • 360-379-9711 • www.sporttownsend.com
hikingbackpackingcampingtravelingswimming
20%OFF
ANY ONEITEM
Excludes sale items.
O� er expires 12/31/12Your Original Outdoor Connection
20 • 2012 Local Port Townsend & Jefferson County Leader
627 & 631 Water Street, Port Townsend
360-385-1156Open at 10 am – see our website at www.ElevatedIceCream.com
or call for seasonal closing times
627 & 631 Water Street, Port Townsend
360-385-1156Open at 10 am – see our website at www.ElevatedIceCream.com
or call for seasonal closing times
10%OFF
“Rainy Day”Ice Cream Coupon
10% O� your Ice Cream purchase on any rainy day(even slightly rainy!) With this coupon. Exp. 4/30/13.
Special Discount! For shopping early in our Candy Shop10% O� your Early Christmas Purchase
Nov. 14-Dec. 13, 2012
10% O� your Early Easter Purchase March 6-21, 2013 (Wed.-Thurs.)
GARDENS AT FOUR CORNERS • Gary and Patti created the Gardens at Four Corners 17 years ago, and their love for this area and the community only grows. They’ve learned that this is “dream country” for gardening if the challenges of soil, water (and deer!) are � rst conquered; so it’s their goal to
educate for success with helpful and knowledgeable sta� and carry quality, reasonably priced soils, mulches and healthy plants (includ-ing larger trees). People say they buy their plants here “because they live!” So, why travel out of the county when you can enjoy all of this on 2 1⁄2 acres, browsing the wonderful gardens at “Four Corners?!”
Locally owned since 1995.Exp. 3/31/13
Vitamins • Herbs • Homeopathics • Skin Care • Gifts1002 Lawrence St. • 360-385-3290 • www.uptownnutrition.com
Your Source for Healthy Living:Education • Lending Library • Reference Library
OPEN 7 DAYS A WEEKAll Your Outdoor Needs
Get a 20%-OFF SHOPPING SPREEonce during your birthday month.
Sign up for our email list
SPORT TOWNSEND
Name _________________________________________
Email _________________________________________Locally owned since 1990
Port Townsend & Jefferson County Leader 2012 Local • 21
Being localmeans helping
locals.
1-800-464-4140 Port Townsend360-385-3711
Sequim360-683-4970
www.homersmith.com
Homer Smith Insurance
“Homer Smith Insurance will match the first $10 you donate
to OlyCAP in 2012.”(Limited to the 1st 200 donors.)
Feel a little
coming on?
MEAN BEAN COFFEE COMPANY1300 W. Sims Way • QFC Parking Lot
$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$
Calm down with OFF your next cup of co� ee.
22 • 2012 Local Port Townsend & Jefferson County Leader
Homer Smith Insurance has offered great service and rapid response since 1950. The firm was launched by Homer Smith Jr. and is today led by Homer Smith III.
We believe in community!Online quotes: www.homersmith.com
Celebrating 60 years!AUTO ❘ HOME ❘ LIFE ❘ BUSINESS
MARINE ❘ HEALTH
From left: Anne Morrison, Joan Sommantico, Homer Smith III, Jim Maupin, Rebecca Beebe, Ryan Smith and May Smith.
MEAN BEAN COFFEE COMPANY1300 W. Sims Way • QFC Parking Lot
$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$$$
$$
The best damn coffee ever!
Voted BEST COFFEE in Jeff erson County
5 years in a row and counting!
Port Townsend & Jeff erson County Leader 2012 Local • 23
In Brinnon, McKay Shrimp and Crab Gear has been a vital part of sport fi shery since the 1970s. Production manager Tony Wihley and owner Fay Beck pose by the custom sign made by a friend. Photo by Viviann Kuehl
McKay captures craband shrimp
Business: McKay Shrimp and Crab Gear, ownedby Fay Beck; production manager, Tony WihleyHow long in business? Current owner, eightyears; business established around 1972
How do you encourage people to shop with you?“A lot of our business comes through word of mouth, through recommendations,” says Beck. “It’s our quality that encourages people. We are right here on Hood Canal, and we do business over the Internet, put ads in specialty newspapers, and in the Fish & Wildlife regulations booklet.”“Some people get 10 to 15 years’ use out of their pots, some come every year for new pots, and some throw them overboard with nothing attached. We can’t help that, but it might be good for business.”
What do people like about your products?“The pots are lightweight, made out of quality wire and materials. They’re all handmade here, and we have three good designs,” notes Beck. “We sell most of the products you need for shellfi shing: ropes, weights, pulleys, electric and gas pullers, fl oats, and bait, in pellets and fi sh oil.”
What do you provide that’s different?“There are not too many places that make the pots and sell them retail. Commercial pots are so big and heavy, and they are sold wholesale. Ours are light and they fi sh really well. Our customers come from as far away as Bellingham to Oregon, and we supply to some California stores.”
What do you shop for locally?“Gas and groceries. I wish it was different, but there’s not much I can get locally for my business. I get some things from Henery’s Hardware in Quilcene, but that’s only about $1,000 a year.”
— Viviann Kuehl
24 • 2012 Local Port Townsend & Jefferson County Leader24 • 2012 Local Port Townsend & Je� erson County Leader Port Townsend & Je� erson County Leader 2012 Local • 25
PERSONALDETAILEDCOMPLETE
WEDDINGS BY DESIGN
Wedding Planningand
Coordination Services
full-service&planningcoordination
Karle CoppenrathMember of the Association of Certi� ed
Professional Wedding Consultants
• Weddings By Design o� ers professional services, expert advice, and is the best resource for individuals wanting to create a memorable celebration that re ects their personal style and distinct tastes.
• � e initial complimentary consultation gives us an opportunity to discuss how you envision your wedding, address epectations regarding our services, and provide insight on local services available.
• Services include:
• Complete Wedding Package
• Wedding Day Management Package
• � e best part is that YOU decide how much (or how little) service you need.
P.O. Box 408, Port Townsend, WA 98368Phone: 360.385.6416
www.porttownsendweddings.com
Port Townsend & Jefferson County Leader 2012 Local • 2524 • 2012 Local Port Townsend & Je� erson County Leader Port Townsend & Je� erson County Leader 2012 Local • 25
PERSONALDETAILEDCOMPLETE
WEDDINGS BY DESIGN
Wedding Planningand
Coordination Services
full-service&planningcoordination
Karle CoppenrathMember of the Association of Certi� ed
Professional Wedding Consultants
• Weddings By Design o� ers professional services, expert advice, and is the best resource for individuals wanting to create a memorable celebration that re ects their personal style and distinct tastes.
• � e initial complimentary consultation gives us an opportunity to discuss how you envision your wedding, address epectations regarding our services, and provide insight on local services available.
• Services include:
• Complete Wedding Package
• Wedding Day Management Package
• � e best part is that YOU decide how much (or how little) service you need.
P.O. Box 408, Port Townsend, WA 98368Phone: 360.385.6416
www.porttownsendweddings.com
26 • 2012 Local Port Townsend & Jeff erson County Leader
Hans and Mia Frederickson have purchased Frederickson Electric, a family enterprise started by his father. Lola, 5, and Rowan, 8, joined their parents at the business in Glen Cove. Photo by Allison Arthur
Next generation takes helm at Frederickson Electric
Business: Frederickson Electric,owned by Hans and Mia Frederickson
How did you get started? “We bought [the business] in January 2012 from Erik Frederickson, who had been in business 33 years in Port Townsend,” says Mia Frederickson, referring to husband Hans, son of the founder.
What does “shopping” locally mean to your business? “For me, doing business locally is how we strengthen our community,” says Hans. “We care for our customers, and they care for us. We have stronger connections when we see the people we do business with around the community.”
Do you hire locally? “Including myself, we have eight full-time and three part-time employees. We all live in Jefferson County. Many of us were born and raised here.”
What service do you provide that you think people don’t know about?“In addition to our core electrical contracting business, we’ve been doing a lot of work around energy-effi cient lighting and solar electric systems over the past few years.”
Do you shop locally as well? “Yes! I’ve always hated driving to Silverdale to get stuff that isn’t available here. I remember when the Food Co-op was in that little space Uptown with a very limited selection. I love going there now and seeing all of the food produced by local farmers. I’m also looking forward to the opening of Quimper Mercantile.”
Are you ever surprised by what you fi nd here?“The ‘City of Dreams’ is an appropriate name for Port Townsend. I’m always excited and hopeful when I see a new and creative business starting up. I’ve seen several like that this year.”
— Allison Arthur
Next generation takes helm at Frederickson Electric
“We bought [the business] in January 2012 from Erik
Port Townsend & Jeff erson County Leader 2012 Local • 27
Present this coupon and add
ONE FREE PHOTOto your print classifi ed ad!
Leader Classifi eds226 Adams Street, Port Townsend360-385-2900 • classifi eds@ptleader.com
Single insertion. Offer expires 10/31/13.Limit one per customer.
Two room minimum. • Not combined with any other offer.
$30* Carpet Cleaning
Serving Jefferson County Free Phone Estimates
360 385-7755www.NaturalistCarpetCleaning.com
Free Air Duct Video Inspectionand/or 10% Off Air Duct Cleaning
*$30 per room (200 sq. ft. max)
SEAMS TO LASTSpecializing in
hand-crafted clothing10% Off
Purchaseof non-sale items, with this ad
1034 Water StreetPort Townsend360-385-5899
Established in 1985
Whimsical, Sweet, Elegant or FormalWhimsical, Sweet, Elegant or Formal
10% Off Any One Item(Excluding consignment items)
Mon-Fri: 10-5, Sat: 10-41031 Lawrence St., Port Townsend, WA • 360 385-5289
28 • 2012 Local Port Townsend & Jefferson County Leader
Present this coupon and get
15% OFFa celebration display ad!
Person-to-person, single insertion, minimum 4 column inches. Offer expires 10/31/13. Limit one per customer.
Wish someone a happy birthday, anniversary or congratulations with an announcement in The Leader!
Naturalist Carpet Cleaning is a family-owned and operated carpet, upholstery, and air duct cleaning business. We take pride in our customer service and outstanding cleaning. We were established in
2002 and serve all of Clallam, Jefferson, and Kitsap Counties. Naturalist Carpet Cleaning provides a drier and healthier way of cleaning, using minimal water and all-natural cleaners. Our non-toxic, enzyme-based solutions contain a stain-remover, deodorizer, and a sanitizer. Craig and Alison are a father/daughter team joined by Ron, Area Manager and Tamie, Customer Service.
Sweet P.T.1034 Water St.
360-385-6700sweetpt1@hotmail.com
10% OffStorewide!
SWEET P.T.• Unique candy gifts
• Ten different fudge fl avors• Old-fashioned candy, taffy & caramels
and much, much more!
Petals Flower Shop is located in beautiful Uptown Port Townsend. Nestled in a refurbished historical 1920s gas station, Petals is a floral studio and a French-feeling home and garden shop. We craft custom floral designs in collectible containers with love.
www.ptpetals.com
Port Townsend & Jefferson County Leader 2012 Local • 29
Muskan Indianrestaurant & bar
Authentic Indian Cuisine
Free Vegetable Pakoras
when you purchase2 Dinner Entreés
LunchBuff et$8.99
2330 Washington St. • Port Townsend, WA (across from Aladdin Motor Inn) 360-379-9275Open 7 Days a Week www.muskanpt.com
Vegan & Vegetarian Options
Pane d’AmoreArtisan Bakery
For bread only at Port Townsend store onlyOpen 7 days a week
Buy one loaf, get the second 50% Off!
617 Tyler Street
Box of 6 Cupcakes
$5 OffRestrictions apply • expires 5/31/13
Perfect Dreams CupcakesCUPCAKES FOR ALL OCCASIONS
909 Water Street • 360-385-2332
Buy 1 Sandwich
get 2nd 1/2 Off*11 Years
BestSandwich
Award
929 Water St.,Port Townsend360.385.2037
50%OFF*
* of equal or lesser value
Homemade Soups
& Desserts, Too!
CHIC
AGO
STY
LE S
UBS
• BEE
R • W
INE
COFFEE • SALADS • SOUPS • DECK DINING
Call Us for Catering!929 Water St.,Port Townsend
30 • 2012 Local Port Townsend & Jefferson County Leader
Muskan Indianrestaurant & bar
Thank you for supporting Port Townsend’s only authentic
Indian Restaurant!We are pleased to present delicacies from the Punjab region of northwestern India. Indian food, like Indian culture, is both diverse and distinctive. Every corner of India offers a vast range of culinary delights and has been influenced by many different cultures. Indian food is comprised of six basic tastes: sweet, sour, salty, spicy, bitter and astringent. A well balanced Indian meal contains many of these flavors. This principle explains the use of numerous spice combinations and depth of flavor. Thank you for supporting us in our second year!
Deepika and Manoj Kumar
Pane d’AmoreWe built a bakery because we love good bread, hard work, and our community. Feeding people the very best product we can make, using the very best ingredients we can find, never gets old or uninteresting. We continually strive for a better product, a kinder approach to using our resources and keeping our tra-
dition of sharing a priority.
www.panedamore.com
Perfect Dreams CupcakesCUPCAKES FOR ALL OCCASIONS
909 Water Street • 360-385-2332
Free local Sunrise Coffee & Free Seasonal Cupcake Samples
Cupcake Happy Hour last 1/2 hr. of every day!
Open Mon-Sat: 10-4
Port Townsend & Jeff erson County Leader 2012 Local • 31
A taste of localwine, history
Name of business: Ajax CaféHow long in business: Ajax Café has been in operating since 1977. Kristan McCary took ownership in 2004.
How do you encourage people to shop locally?“Supporting locals is our value system,” McCary says. “We purchase as many of our menu items locally as possible and make a point to educate our customers on the abundance and truly amazing quality of ingredients grown and raised here in Jefferson County.”
What do you provide that’s special?“Ajax is a piece of the area’s history, having been in the same Port Hadlock location for more than 30 years. The restaurant was founded by a group of gentlemen so that their band, and the community, would have a place to gather and play music. We keep this tradition alive with live performances by local artists every weekend.”
What do you like about The Local coupons?“In the summertime we see a lot of new faces, and in the winter it’s our regulars, but everyone enjoys a good deal.”
What do you want people to know about your business that you don’t think they know?“We put on a special wine dinner each month with the night’s menu highlighting a local food producer,” McCary says. “We also have events where a portion of the evening proceeds are donated to a local nonprofi t, or nights where customers are encouraged to bring in donations for the food bank.”
What do you shop for locally?“What don’t we shop for locally? Produce, cheese, beef and seafood whenever possible – you name it.”
– Megan Clafl in
Kristan McCary and her son Grady at the Ajax Café. Submitted photo
A taste of localwine, history
Ajax Café has been in operating
Submitted photo
32 • 2012 Local Port Townsend & Jeff erson County Leader
Spinning, expanding alocal business
How long have you been in business?Kevin Hansen built the fi rst electric miniSpinnerprototype, “Mark 1,” for his wife and businesspartner, Beth, in 2003. Originally based in Glen Cove,the Hansens recently opened a new manufacturing space in the Port Townsend Business Park.
How do you encourage people to shop locally?“All of our retail business is based online, as we sell our spinners worldwide, but we regularly host spinners’ workshops, which bring people from all over the U.S. and Canada to Port Townsend. We put these folks up at the Bishop Hotel and give each of them a goody bag that includes items from several local businesses. We also regularly collaborate with other local businesses like Taylored Fibers and Diva Yarns through the WSU Jefferson County Extension Fiber Farm Tour.”
What do you provide that’s special?“Great for spinners who travel, the one-of-a-kind miniSpinner is as powerful, yet as quiet, as a conventional treadle-drive wheel. With an improved speed controller, the newest design of the miniSpinner is prettier and more sophisticated.”
What do you want people to know about your business that you don’t think they know?“We started as a cottage industry right about the time of the recession. Despite a challenged economy, we were able to identify a niche and our company blossomed and grew.”
What do you shop for locally?“We are fortunate to work with the great staff at Edensaw Woods, where we purchase traditional cherry and maple woods as well as more exotic varieties like bloodwood and lacewood.”
– Megan Clafl in
Beth and Kevin Hansen take a break at their new 5,000-square-foot facility in the Port Townsend Business Park. Photo by Megan Clafl in
partner, Beth, in 2003. Originally based in Glen Cove,the Hansens recently opened a new manufacturing space in the
Port Townsend & Jeff erson County Leader 2012 Local • 33
Website DesignChoose from a variety of template options to create an online presence for your business. Just provide us with the content, and we can take care of the rest!
Print Subscriptionto the Leader(52 weeks in-county)
Je� erson County’s only home-owned newspaper –also a digital marketing company.
Subscription to the Leader E-editionA digital replica of the Leader, available anywhere online, every Wednesday at 5:00 a.m.
$5OFF
OFF
$10
OFF
$20
O� er expires 10/31/13226 Adams St. • Port Townsend
360-385-2900
Reg. $149/page; $129/page with coupon.Does not include domain and hosting fees.
Social MediaPro� le SetupEngage in the online conversation! We will tailor a pro� le that best represents your business on a social media platform, including personalized page layout and features, images relevant to your business, and descriptions and captions tailored for social media.
Facebook Page: Reg. $129; $99 with couponGoogle Place Page: Reg. $99; $79 with coupon
Twitter pro le: Reg. $49; $39 with coupon
OFF
MORETHAN
20%
O� er expires 10/31/13226 Adams St. • Port Townsend
360-385-2900
O� er expires 10/31/13226 Adams St. • Port Townsend
360-385-2900
O� er expires 10/31/13226 Adams St. • Port Townsend
360-385-2900
34 • 2012 Local Port Townsend & Jefferson County Leader
The Leader – Locally operated since 1889, the Leader is devoted to telling Jefferson County’s story every week. No relic, the Leader also builds websites, does social media marketing, e-newsletters and other marketing graphic materials.
The a
ll-lo
cal L
eade
r cre
w, fr
om le
ft: D
onna
Ros
mai
er, S
cott
Wils
on, C
hris
Hawl
ey, S
teve
Pete
rs, M
aria
n Roh
, Jen
nife
r Jam
es-W
ilson
, Nan
cy Fi
tch, F
red O
bee,
Trist
an H
iegle
r, Lyn
n No
wak,
Sar
a Ra
dka,
Car
la P
atto
n, R
obin
Dud
ley, M
egan
Cla
� in,
Dre
w Eli
cker
, Cat
herin
e Br
ewer
, Sun
ny P
arso
ns, J
ohn
Stan
ger,
Susa
n Ja
ckso
n, Ta
mi H
ewitt
, Pat
rick
Sulli
van,
M
eliss
a Bixb
y. No
t pict
ured
: Alli
son A
rthur
, Kat
hy B
usic,
Felic
e Tho
mps
on, F
reez
e Luo
lla, C
hrist
ophe
r Ove
rman
, Eliz
abet
h Lai
ng, B
etty
Gre
well.
Phot
o by J
im M
aupin
Be Local. READ LOCAL.
Call or email!(360) 385-2900
ads@ptleader.com
Port Townsend & Jefferson County Leader 2012 Local • 35
$2OFF*
Pet TownMon-Sat 9-6 • Sun 10-5
2427 Sims Way (Old Dollar Store) 360-379-3262
With purchase of $20 or more
Expires 3/31/13
Winter MarketNovember 3- Dec 21
Saturdays 10-1
buy a market tote and get a $5 token to start filling it
20 years
in 2012
Tyler St, Uptown
ptfarmersmarket.org
BuyLocaL EatSEaSonaL
3 timES a wEEk at thE JEffErSon county farmErS markEtS
Saturdays Sundays WednesdaysOpens April 6th!
9-2 Tyler St. UptownOpens July 3rd!
2-6 Polk St. UptownOpens June 2nd!
10-3 Chimacum Corner
IN 2013
36 • 2012 Local Port Townsend & Jefferson County Leader
For all of your pet needs and
wants!Pet Town has
everything for dogs, cats, � sh
and more!
Food, Toys, Treats, Grooming Products –
We Have It All!
(DogsPaw Grooming & Dog Wash is right next door too)
Now Carrying
buy a Port Townsend Farmers Market Tote Bag and get a $5 token to start filling it. Offer good thru Dec 21, 2012!
Only good at the Marketredeem at info booth
buy a Jefferson County Farmers Market T-Shirt or Tote and get a $5 token to start filling it. Offer good only on the Opening Day of each market in 2013. See other side for exact dates.
oPEninG DayS GiVEawayS
Port Townsend & Jefferson County Leader 2012 Local • 37
save50%
Offer expires 3/31/13
AuthenticHomestyle
Thai CuisineBuy one meal & get the
2nd meal1/2 price
of equal or lesser value225 Adams St. • Port Townsend
360385-5023 www.khularbthai.comLocally owned since 1989.
1121 Water Street,Port Townsend360-379-4693
- p o n - p o n - p o n - p o n
- p o n - p o n - p o n - p o n
$5OFF
Any Purchase of $25 or More!
No expiration date.
The Olympic Peninsula’s “Crepe Escape”
espresso • free wi� • gluten & dairy free crepes available
“Crepe Escape”“Crepe Escape”
espresso • free wi� • gluten & dairy free crepes available
CrepesBREAKFAST • SWEET • SAVORY
* O� er expires 3/31/13
360-385-1151• www.waterstreetcreperie.com Open 7 Days a Week • 1046 Water Street • We deliver to downtown locations!
360-385-1151• www.waterstreetcreperie.com
$10 DEAL!1/2 size Crepe, & Cup of Soup(no substitutions)
38 • 2012 Local Port Townsend & Jefferson County Leader
save50%
50% O� Soup with purchase of $5 Lunch Special*(360) 379-9979
227 Adams St. next to Khu Larb Thai
Expires March 31,
2013.
Locally owned since 2008.* 11 am-2 pm only. Closed Tuesday.
Thank you for the support that has created our store. Nearly 900 shareholders have invested over $575,000 in the community corporation to date. This generous vote of confidence has allowed the Quimper Team to take action on the business plan presented in our Prospectus. Our fall 2012 opening is a testament to hard, persistent work inspired by our neighbors’ deep support and happy expectations.
Brandon Ellard & Jim Larson opened the Water St. Creperie in March 2010, in downtown Port Townsend, optimistic about Water
Street’s future. A crêpe is a type of very thin, cooked pancake usually made from wheat � our. Creperies are popping up as a fast
food alternative in other parts of the country.
A LOCAL FAVORITE!“We wanted a creperie because it was unique
to Port Townsend. Come enjoy our comfortable atmosphere and seating, our monthly art
exhibits and free Wi-Fi!”Become a fan on Facebook!
Port Townsend & Jeff erson County Leader 2012 Local • 39
Townsend Bay Soapsuds up service
Business: Townsend Bay Soap Companyowned by Carol and Bob Middelburg andPatricia GraingerHow long in business? 13 years
How do you encourage people to shop with you? “I think the best way we encourage people to shop locally is our customer service. Carol in particular stays in constant contact with the retailers that are here in Port Townsend and makes sure they always have the inventory they want ... and I think customer service is a particularly strong part of the business,” says Grainger.
What do people like about your products? “I think they like that they’re made locally; they like that they say Port Townsend. I hear all the time from people who bring out of town guests to places that carry our products to shop...They get sent all over the country as a way to say thank you or happy birthday,” says Carol Middelburg.
What do you provide that’s different?“We’ve expanded our line within the last fi ve years to include refi lls, liquid soap refi lls,” says Middelburg. “We’ve worked hard to get to zero waste,” agrees Grainger. Townsend Bay Soap Company also donates waste cuts of soap as single-use bars to Dove House, the American Legion, the Port Townsend Food Bank and other charities.
What do you shop for locally? “I buy sandalwood powder for sandalwood soap and I buy it from a woman here. Mountain Spirit Herb Co. is the name of her company. Every chance we get, we buy locally. I buy my peppermint leaves locally. I buy as many essential oils from the Pacifi c Northwest as possible – which is actually quite a few,” says Middelburg.
— Tristan Hiegler
Townsend Bay Soap Company partners Bob Middelburg (left), Patricia Grainger and Carol Middelburg display some of their products. Behind them are racks containing drying soap bars that are waiting to be packaged. Photo by Tristan Hiegler
40 • 2012 Local Port Townsend & Jeff erson County Leader
The Plaid Pepperdoes Facebook
Owners: Debbie and Larry Williams Business: The Plaid Pepper
How long have you been in business?“Three years, started in new location Sept. 15, 2012.”
How do you encourage people to shop with you?“I’m on Facebook a lot and there’s a couple of sites; ‘I’ve Heard of Quilcene’ is one of them on Facebook. So a lot of people go there just to advertise what they have. And we have a knitting group that comes in here every Thursday, which we started at the old place. Then we have a book club that meets once a month.”
What do you provide that’s different?“I make bags, mesh bags. I’ve sold a lot of these, at Christmastime especially. I make spice mats ... you put a hot dish on it that brings the fragrance out.”(Debbie and Larry also run a hot dog cart outside the shop on weekends and added a mobile espresso bar after moving to the new location.)
What do you shop for locally?“Princess Valiant Coffee out of Port Angeles, with a special roast only for The Plaid Pepper called Dabob Bay Roast. A Kingston metal artist, whose work decorates the shop. Lopez Larry’s Gourmet products, out of Lopez Island. Benchmark Woods custom wood pieces out of Chimacum. Keith Lazelle calendars, a Quilcene nature photographer. Members of the knitting group also submit pieces to sell, such as baby clothes and hats.”
Ever had an “ah-ha moment” shopping locally?“The metal workings around the shop, by TecWeld in Kingston, fi t in well with the shop’s celebration of marine life and Quilcene aquaculture.”
– Tristan Hiegler
Debbie and Larry Williams display some of the art pieces and coffee brews available at The Plaid Pepper’s new location at 294963, Highway 101, across from the Quilcene Community Center.
Photo by Tristan Hiegler
Port Townsend & Jeff erson County Leader 2012 Local • 41
10%OFF
Four Sisters122 Harrison St. • Port Townsend • 360-531-1788 • foursistersgbs.com
From painted furniture to garden items, rusty and shiny, new and used.
Tuesday thru Saturday 11:00 am – 5:30 pmAdjacent to the ferry – near Don’s Pharmacy
We also enjoy repurposing itemsin order to breathe new life into them.
One regularlypriced item!
1010 Water Street • Port TownsendOpen 7 Days a Week • 360/385-7673 • Open 7 Days a Week
Buy 1, Get 2nd Wine(s)/Item(s)mix or match of equal or lesser value
25% O� *The “small-town” wine shopwith the “big city” selection!
www.PTWineSeller.com
Wine Not Mix A Case – Even Better Deals! (Special orders, too!) Some restrictions apply. See Store.
Cash & Checks preferred. 3% less discount for Credit Cards.Leonetti & & other rare wines & older vintages
*With this couponthru 10/31/13
Bob Carter, as local as you can get.
I’ve lived here my whole life. I’ve been doing business in
Jefferson County for 34 years.
Bob Carter, Broker (360) 385-9550
2409 Jefferson Street, Suite C Free Portfolio Analysis
LuLu’s B&B for DogsCozy resort for small dogs, the next best thing to home! No cages or kennels, just soft comfy beds, green gardens, fun walks and good food. References furnished.
Also: House calls for any size pets or livestock!
www.lulusfordogs.com • 360 379-5248 or 301-5151 *See back. Exp. 10/31/13
20%off*
42 • 2012 Local Port Townsend & Jefferson County Leader
We are actually four sisters doing this business. We all love going to antique shops, thrift shops, garage and estate sales. We are always on the lookout for a good sale. All four of us also love to decorate our homes. Because we are continually shopping and buying things, our home decor is constantly changing and as a result, things are always moving in and out of our homes. We
thought it was time to share our great finds with you. You will find a variety of items in our inventory, from painted furniture to garden items, rusty and shiny, new and used. We also enjoy repurposing items in order to breathe new life into them.
Four Sisters122 Harrison Street, Port Townsend • 360-531-1788 • foursistersgbs.com
LuLu’s B&B for DogsCozy resort for small dogs, the next best thing to home! No cages or kennels, just soft comfy beds, green gardens, fun walks and good food. References furnished.
*Dogs must be under 25 pounds, non-aggressive, and up to date
on innoculations.
www.lulusfordogs.com360 379-5248 or 301-5151
Large Inventory of Estate Jewelry Free Cleaning & Inspection
Jewelry Repair Ring repair & sizing Custom orders
Chain repair Stone setting Watch repair Watch batteries Watch repair
Buyer of gold & silverOpen Daily 10-5, Closed Tuesday
Come and see me at 1017A Water St.,Below Fins • Port Townsend
360-385-0167 • 360-302-0427
Buy 1, Get 2nd Wine(s)/Item(s)mix or match of equal or lesser value
25% O� * Owner Joe Euro has a “big city” selection of wines, champagne, port and beer at competitive prices! The Wine Seller will generally meet, often beat or
come darn close to prices at Costco, Central Market and the supermarkets. (WINEAUX GREGARIOUS members always $AVE BIG!!)You can stop in and custom order by the bottle, case or carload. He has operated his shop in downtown Port Townsend for over 30 years. Browsers welcome!For your wedding or private and corporate parties, Joe Euro is a professional guitarist/recording artist who has played at hundreds of events over the years and would love to play at yours. WINE NOT have Joe provide wine, champagne, beer and live music? Regular wine tastings October trough June.www.PTwineSeller.com Independent/Locally owned since 1982.
Port Townsend & Jefferson County Leader 2012 Local • 43
1/2 O� Entrée!*
* Buy one, get second one of equal or lesser value for 1/2 price. Valid Mon-Thurs.
Expires 3/31/13.
Open @ 11:30am Daily1038 Water St., Port Townsend360-385-9708
Coolant Check –1 hr. service call & 1 gal. glycol
$75 Solar Hot Water
Kenny Schordine360-301-9870
360.385.3809www.frameworksNW.com118 Taylor Street, Downtown P.T.
G a l l e r y o f L o c a l A r t w o r k
www.frameworksNW.com 118 Taylor Street, Downtown Port Townsend
www.frameworksNW.comwww.frameworksNW.comwww.frameworksNW.com
Limit one coupon per customer. Does not apply to previously placed orders.
C U S T O M F R A M I N G15%
OFF
R e a d y - M a d e F r a m e s
O v e r s i z e P r i n t i n g & M o u n t i n g
360.385.3809
15%OFF
Your NextClothingPurchase
(sale items exempt)
Open 7 Days a Week, 10am to 5:30pm913 Water Street • Port Townsend
Casual,unique
clothingfor women of all ages.
44 • 2012 Local Port Townsend & Jefferson County Leader
Over four years ago the six of us bought the Public House Grill. We are happy to be a part of the Port Townsend community and support local farmers and seafood companies whenever possible. We have come to enjoy our “regulars” and meeting the new people in town.
Thanks for supporting our restaurant!The Davis and Conrads families
Locally owned since 2008.
Let the sun pre-heat your waterSunlight, the Earth’s most abundant energy source, can be harnessed to pre-heat water for domestic or commercial uses. Flat-plate or evacuated tube collectors capture heat that is transferred to a storage tank. That heated water then goes to your conventional water heater. You use less energy; 60% less, at least. All for about a dollar-a-watt, installed. A fifty-gallon water heater uses about 5,000 kilowatt/hours per year to serve two people. A $6,000 investment can give those two people an $1,800 Income Tax credit, and the majority of their hot water for the next 20-plus years. A little help from the sun can reduce energy bills for you, and carbon dioxide emissions for all of us.
Kenny Schordine • Solar Hot Water • 360-301-9870
Frameworks is a fun & efficient framing studio known for exceptional custom framing and delightful customer service. Frameworks also offers a wonderful selection of fine art prints, posters, photography and unique ready-made frames! This locally owned favorite has been a part of the Port Townsend arts community for 18 years. Megan was born & raised in Port Townsend (no kidding!) and enjoys helping her customers combine style, color, and artwork with the perfect frame. Come see the gallery at 118 Taylor Street, between About Time and The Surf. Locally owned since 1991.
Megan Foley Proprietor
Maricee Fashions I have run Maricee Fashions with the same faithful employee, Jean Schoessler, for 30 years. We prefer buying American-made or Canadian brand clothing, finding the fit and the quality far superior. The shop is
currently carrying many brands made in the USA and Canada. Local support enables us to be active in community activities & service clubs that give back to the community. Come on in. Our personal service will get you into an outfit that will make you look and feel your best. – Sue Arthur
Locally owned since 1982.
Jean Schoessler and owner Sue Arthur.
Port Townsend & Jefferson County Leader 2012 Local • 45
20%OFFEntire
Purchase!*
Largest Supply of Locally, Regionally and American-made
Products in Port TownsendWe carry the best toys, treats, food,
beds, leashes and accessories.* Excludes pet food. Expires 10/26/13
Bonita’s Four-Legged Friends360-379-0436
1433 W. Sims WayMon-Sat 9:30-12 & 1:00-5:30 pm
50%OFF
Buy one dinner and 2 beverages at regular price getSECOND DINNER of equal or less value
1/2 Price!OPEN FOR LUNCH & DINNER • 7 DAYS A WEEKAll major credit cards accepted • Nonsmoking establishment O�
er e
xpire
s 4/3
0/20
13
360-379-9343 • 628 Water Street, Port Townsend
EXPIRES 10/24/13
Welcome Package
Think • Buy • Be LOCAL
Welcome Package
Think • Buy • Be LOCAL
46 • 2012 Local Port Townsend & Jefferson County Leader
Craig Dotson has over 20 years experience in the pet service industry, and is pleased to be able to carry on Bonita’s exceptional reputation for great customer service.
Free BirthdaySerenade & Dessert!
With your meal.Call us for parties.
Margueritas • Mexican Beer • SodasEL SARAPE • 628 WATER STREET, PORT TOWNSEND
Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free Birthday Free Birthday Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free Birthday Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free BirthdaySerenade & Dessert! Free Birthday Free Birthday
EL SARAPE • 628 WATER STREET, PORT TOWNSEND
Margueritas • Mexican Beer • SodasEL SARAPE • 628 WATER STREET, PORT TOWNSEND
Margueritas • Mexican Beer • SodasEL SARAPE • 628 WATER STREET, PORT TOWNSEND
Margueritas • Mexican Beer • SodasEL SARAPE • 628 WATER STREET, PORT TOWNSEND
Margueritas • Mexican Beer • SodasEL SARAPE • 628 WATER STREET, PORT TOWNSEND
Welcome Package
Think • Buy • Be LOCAL
Port Townsend & Jefferson County Leader 2012 Local • 47
SQUAREdeal
10953 Rhody Drive 385-2070 www.circleandsquare.com
CIRCLEof quality
Home of the 3-year, 30,000 mile
W A R R A N T Y
• We o� er 4-Wheel Alignment, Suspension & Undercar Service and Repair.
• FREE Car Wash and Vacuum with most services• FREE AAA 40-Point Inspection with every visit• Ask about our Loaner Car Program & Shuttle Service
Front row: Zach Stratton, Jana Filli, Reto Filli, and Natalie Rutter. Back row: Drew Shimer, Trevor Ellis, Jaik Martin, Ken McMullen, and Mark Davis.
Our technicians are ASE-certi� ed Master Technicians. We practice Environmental Responsibilityand we treat your car as if it were our own.
#1 Top Shop
48 • 2012 Local Port Townsend & Jefferson County Leader
Please give from the HeartThe Day of Caring on Sept. 14 marked the beginning of the
2012-2013 UGN Campaign to raise $300,000. Over 70 volunteers participated in community service benefitting local non profits.
We are Stronger Together
Donate online at weareugn.org or call 360-385-3797 to find out how you can
help your community.
United Good NeighborsOF JEFFERSON COUNTY
Member of United Ways of Washington
Sponsors: Amy Mook & SOS Printing
benefitting local non profits.
Port Ludlow Associate employees prepare soil at a Habitat for Humanity house at Eddy Street in Port Townsend.
Mike and Judy Blair Campaign Chairs; Debbie
Reandeau UGN Board President; John Cantlon,
recipient of Day of Caring Award, and Port Townsend
Mayor David King.
Bill James, Port Townsend Rotary, making repairs
to OlyCap Haines Street Cottage.