Post on 19-Dec-2015
transcript
Nematodes are extremely abundant and diverse
• Variable size: 0.2 mm to over 3 m• Found in virtually all the ecosystems.• Over 20,000 species have been described.• Numerically extremely dominant, over 80% of
all living animals on earth are nematodes!• Grouped into a phylum “Nematoda”
Figure 2. The relationships of the Nematoda.
Blaxter M (2011) Nematodes: The Worm and Its Relatives. PLoS Biol 9(4): e1001050. doi:10.1371/journal.pbio.1001050http://www.plosbiology.org/article/info:doi/10.1371/journal.pbio.1001050
Feeding Strategy Example Genera Infective Stage Resistant Stage Important hosts Resistant Stage Notes
Ectoparasite BelonolaimusXiphenemaTrichodorus
J2-adultJ2-adultJ2-adult
Citrus, woody plants Vector virusesVector viruses
Semi-Endoparasites RotylenchulusTylenchulus
J4J2
J4J2
Cotton, citrus J4J2
Migratory Endoparasites
PratylenchusRadopholus
J2-adult * Cottton, tobacco, citrus, corn
*
Sedentary Endoparasites
MeloidogyneHeteroderaNaccobus
J2J2J2
Egg/cyst soybean, rice, corn, potato, cotton, cereal, pea, vegetables
Egg/cyst
Stem and Bulb Nematodes
BursaphelenchusDitylenchus
J4J4
J3J4
Coconut, rice J3J4
J4 vectored by insects
Seed Gall Nematodes Anguina J2 J2 Cereal, rice J2
Foliar Nematodes Aphelenchoides J2-adult Adult rice Adult
Plant parasitic nematodes
Sedentary endoparasitesFamily Heteroderidae
Root-Knot Nematodes (Meloidogyne)
Cyst Nematodes (Heterodera & Globodera)
- Extensive endoreduplication
- Increased cytoplasmic density
- Cell wall degradation
- Breakdown of large vacuoles
- Increased numbers of organelles
- High metabolic activity
Feeding SitesSyncytium
• Fused cells
• Dense cytoplasm• Cell wall changes• No nuclear division• No cell division
Giant-Cells
• Discrete and enlarged cells
• Dense cytoplasm• Cell wall changes• Nuclear division
without cytokinesis
• No cell division
Parasitism Genes: Nematode EffectorsThe genetic determinants that enable a nematode to infect plants
Parasitism Proteins
Parasitism Genes
• Parasitome
Construction of gland-specific cDNA libraries
Microaspiration of esophageal gland cell cytoplasm
1-Signal peptide prediction
N-terminal sequence that targets proteins to ER and the secretory pathway
MNWMHYCLIACFSIYYFNTVESSTINSVTVQVNKIENNEKGRQFNLKFTNQVYERVCHVDFRVDLPDTAKLDKYSKMVPIPDTCGQYALPKSLDLLPGETFDAQLTLLGHDGKPNVTVLNTNNIPTSKQCKK-
in situ hybridization
SCN Cellulases
2-Gland-specific expression
Developmental expression profile of CBP in H. schachtii
3-High expression level during parasitic stages
These criteria allowed the identification of more than 50 putative parasitism proteins Huang et al. MPMI Vol. 16, No. 5, 2003, pp. 376–381. Gao et al. MPMI Vol. 16, No. 8, 2003, pp. 720–726.
Evidences for Secretion
-Enzymes without substrates (cellulase and pectinase)
-Enzymes without pathway (chorismate mutase, shikimate pathway) Putative Function Assignment
-Similarities are with other parasitic nematodes, bacteria, fungi or plants but not with proteins from C. elegans
mRNA in situ hybridization of a cellulase probe to transcripts expressed specifically within the two subventral esophageal gland cells
2-in situ hybridization
Detection of 10A7 mRNA in dorsal gland cells
3-In Planta Localization of effector Proteins
Cellulase secretion into root tissue around the head of a J2Wang, et al. 1999; 12:64-67
Secretion of cellulase (green fluorescence) associated with cell wall degradation along the migratory path of the J2
Wang, et al. 1999; 12:64-67
5-Plant Expression of Parasitism Genes
Transgenic Arapidopsis expressing a nematode Clavata3-like gene showing an arrested shoot apical meristem
Expression of a nematode parasitism gene in plant tissues stimulated root growth
CBP C24
Wang et al.,, Molecular Plant Pathology 2005;6:187-191.
6-Mutant Complementation
A CM deficient E coli strain transformed with a plasmid containing CM coding region was streaked on the top half of the petri dish The same CM-deficient E. coli strain containing only the plasmid was streaked at the bottom half of the plate (Vector)
Chorismate mutase complementation
Arabidopsis clv3-1 mutant
Arabidopsis wild-type
A fully restored clv3-1 mutant expressing nematode CLV3-like gene
minimal medium without supplemental phenylalanine and tyrosine
CLV3 Complementation
Wang et al.,, Molecular Plant Pathology 2005;6:187-191.
Lambert et al. MPMI, 1999; 12:328–336.
7-Gene Silencing
Expression of 16D10 dsRNA in Arabidopsis resulted in resistance effective against the four major RKN species
Huang et al. (2006)103:14302-14306.
Plant host-derived RNAi is used to silence the expression of the
parasitism genes
8-Determination of Nematode Susceptibility
Enhanced nematode susceptibility in the transgenic plants expressing nematode effectors
10A06 interacts specifically with Spermidine Synthase 2
Bright Field
YFP
Overlay
BiFC assay
Hs-R
FCP L
amin C
Vector
SD/-Leu/-Trp SD/-Leu/-Trp/-Ade/-His
Bait
Vector
Lamin C
10A06
PreySpermidine Synthase (SPDS2)
PreySpermidine Synthase (SPDS1)Bait
Vector
Lamin C
Hs-RFCP
SD/-Leu/-Trp SD/-Leu/-Trp/-Ade/-His
9-Search for Interacting Proteins
Pro-PK
Pro-IAA16
4 dpi 14 dpi7 dpi
10-Characterization of the interacting proteins
Promoter lines, Overexpression, Mutant Lines, …
1- Cell wall-digesting enzymes
Cellulase (Obtained from either bacteria or fungi by HGT)
Pectinase
Cellulose-binding protein
Expansins
Functions of Parasitism Proteins
Nematodes need to penetrate and migrate through the roots !
Nematodes need to change plant metabolism in the infected cells!
2-Metabolic Pathway Enzymes
Chorismate Mutase
Functions of Nematode Effectors
Nematodes need to alter plant cell development?
CLAVATA3-like peptide
Unknown peptide < 3KDa
3-Small bioactive peptides
Functions of Nematode Effectors
CLV1
CLV3
P
P
P
P
PSignal transduction leading to developmental changes
CLV1
CLV3
P
P
P
P
P
Model for CLAVATA3 Action
CLV1
CLV3
Does the cyst nematode use ‘ligand mimicry’ to alter plant cell development?
Functions of Nematode Effectors
SCN SYV46 functions as CLAVATA3
wild-type clv3-1 mutant SYV46 in clv3-1
Does the cyst nematode use ‘ligand mimicry’ to alter plant cell development?
Functions of Nematode Effectors
Cyst nematode effector 19C07 interacts with the Arabidopsis LAX3 auxin influx transporter
4-Auxin signaling
Lee et al., 2011. Plant Physiology
Functions of Nematode Effectors
5-Suppression of host defensesFunctions of Nematode Effectors
Polyamine biosynthesis
An effector 10AO7 specifically interacts and induces SPDS2 activity and alters spermidine level.
Nematodes need to cell cycle activities in parasitized plant cells
6-RanBPM
Secretory protein with high similarity to proteins binding to the small G-protein Ran
Functions of Nematode Effectors
A Meloidogyne incognita effector is imported into the nucleus and exhibits transcriptional activation activity in planta
Molecular Plant Pathology30 JUN 2014 DOI: 10.1111/mpp.12160
http://onlinelibrary.wiley.com/doi/10.1111/mpp.12160/full#mpp12160-fig-0005
7- Control of Transcriptional Machinery
Nematode Resistance Genes
Hs1 pro-1 Sugar beet Sugar beet cyst nematode: Heterodera schachtii
Mi-1 Tomato Root-knot nematodes: Meloidogyne incognita, M. javanica, M. arenaria; Potato aphid: White fly
Hero A Tomato Potato cyst nematode: Globodera rostochiensis Globodera pallida pathotypes
Rhg1 and Rhg4
Soybean Soybean cyst nematode: Heterodera glycines type 0
SM Liu et al. Nature 000, 1-5 (2012) doi:10.1038/nature11651
Functional validation of SHMT by VIGS, RNAi and complementation.
Note: This figure is from a near-final version AOP and may change prior to final publication in print/online
The Rhg4 locus has a gene encoding serine hydroxymethyl transferase (SHMT)
Copy Number Variation of Multiple Genes at Rhg1 Mediates Nematode Resistance in Soybean
Cook et al.,Science 30 November 2012:vol. 338 no. 6111 1206-1209