Post on 24-May-2020
transcript
The Function of t h e Qcr7 Protein
of the Mitochondrial Ubiquinol-cytochrome c
Oxidoreductase of Saccharomyces cerevisiae
by
Suzann Malaney
A thesis submitted in conformity with the requirements for the
degree of Doctor of Philosophy
Graduate Department of Biochemistry
University of Toronto
OCopyright by Suzann Malaney 1997
National Library 1*1 of Canada Bibliothèque nationale du Canada
Acquisitions and Acquisitions et Bibliographic Services services bibliographiques 395 Wellington Sireet 395. me Wellington ÛtÎaiaiva ON K1A O N 4 OttawaON KtAON4 canada Canada
The author has granted a non- exclusive licence dowing the National Library of Canada to reproduce, loan, distribute or sell copies of this thesis in microform, paper or electronic formats.
The author retains ownership of the copyright in this thesis. Neither the thesis nor substantial extracts fiom it may be printed or otherwise reproduced without the author's permission.
L'auteur a accordé une licence non exclusive permettant à la Biblioîhèque nationale du Canada de reproduire, prêter, distribuer ou vendre des copies de cette thèse sous la forme de rnicrofiche/film, de reproduction sur papier ou sur format électronique.
L'auteur conserve la propriété du droit d'auteur qui protège cette thése. Ni la thèse ni des extraits substantiels de celle-ci ne doivent être imprimés ou autrement reproduits sans son autorisation.
The Function of the Qcr7 Protein
of the Mitochondrial U biquinol-cytochrome c
Oxidoreductase of Saccharomyces cerevisiae
Doctor o f Philosophy, 1997
Suzann Malaney
Department of Biochemistry, University of Toronto
ABSTRACT
The respiratory chain enzyme ubiquinol-cytochrome c
oxidoreductase (also termed b c l complex or complex III) o f
Saccharomyces cerevisiae contains 1 0 subunits and resides in the
inner mitochondrial membrane (IMM). This multisubunit enzyme
complex is involved in the transfer o f electrons from ubiquinol t o
cytochrome c and in the establishment of an electrochemical
gradient by translocation of protons across the IMM. A previous
study has shown that inactivation of the yeast nuclear gene QCR7,
which encodes subunit 7 (also referred to as Qcr7 protein or 14 kDa
subunit) of the bci complex leads to an inactive enzyme. The bel
complex of the mutant strain lacks holocytochrome b and has
reduced levels of apocytochrome b, the Rieske iron-sulfur protein
(ISP), and the 1 1 kDa subunit. Although this study showed that the
Qcr7 protein is essential for respiration, the exact role of this
subunit is not known.
In the present study 1 have shown by circular dichroism that an
amino-terminal peptide of subunit 7 is a-helical. I have also
studied the effect of mutations in the amino-terminus o f - - th is
protein on mitochondrial targeting, assembly of the bel complex, and
proton translocation. Mu tan t proteins were analyzed by
overexpression of mutated qcr7 genes in the strain YSM-qcr7A,
which contains a disrupted chromosomal QCR7 gene, and by
comparison t o Qcr7 protein from a YSM-qcr7A strain in which the
wild type QCR 7 gene is overexpressed. Respiration proficiency and
the activity of the bci complex were monitored. Based on these
preliminary data, strains expressing mutated proteins that lacked
the N-terminal 7, 10, 14, and 20 residues (after Met-1) of subunit 7
referred to as Qcr7p-~7, -AI 0, -a14, and -a20, respectively, and
strains expressing versions o f Qcr7p-A7 that contained point
mutations RI OK, D l 3V, and R i OI /G lZV were chosen for further
study.
Al1 the mutated versions of the Qcr7 protein, with the
exception of Qcr7p-al0 and Qcr7p-a7(D13V), are present in the
mitochondria (frorn cells grown a t 300C) a t reduced levels of
approximately 55% when compared to Qcr7 protein from the strain
overexpressing wild type QCR7. In contrast, Q c r 7 p - ~ l O is not
detectable and Qcr7p-~7(013V) is present a t wild type levels. This
may implicate the Qcr7 protein amino-terminus in import or in
conferring stability t o the protein. The activity of complex III in
mitochondria from strains with Qcr7p-a7 and Qcr7p-a7(Rl OK) was
normal. In contrast, strains overexpressing qcr7 genes encoding
Q c r 7 p - ~ l O, Qcr7p-A14, Qcr7p-~20, Qcr7p-~7(D13V), and Qcr7p-
A ~ ( R 1 OVG12V) were respiration-deficient. Western blot analyses
from this latter group of mutants indicate that the bcl complex in
respiration-deficient cells displays a significant variation of
i i i
reduced levels of the 11 kDa subunit, as well as combined
intermediate and mature ISP and cytochrome cl . Spectrophotometric
analyses indicate that the amount of holocytochrome b was reduced
in the strain containing Qcr?p-~7(RlOI/G12V) and lacking in the
strain with Qcr7p-d7(D13V). ATP synthesis (an indirect measure of
proton translocation) in mitochondria was comparable t o the wild
type in al1 respiration-proficient strains tested, including the strain
with Qcr7p-A7.
Based on the results of this work, I concluded that the amino-
terminus of the Qcr7 protein is essential for the functional
assembly of ubiquinol-cytochrome c oxidoreductase. In addition to
the proposed function in assernbly, the N-terminal seven residues
may facilitate import into rnitochondria.
DEDICATION
This work is dedicated to my two little daughters Maxine and
Michelle. May it be an inspiration to them throughout their lives.
This work is also dedicated to my husband Robert for his love.
ACKNOWLEDGEMENTS
I would like to thank my supervisor, Dr. Brian H. Robinson.
While in his laboratory for five years I have learned a tremendous
amount about science and life. He has always been supportive,
encouraging, and full of ideas. I thank him for always having an open
door no matter how busy he was. I also thank him for accepting me
into his laboratory and giving me the opportunity to accomplish this
work.
I would like to thank my CO-supervisors Dr. Charles Deber and
Dr. David Williams for al1 their encouragement, support, and
constructive criticism. I would also like t o acknowledge
contribution t o the thesis by Dr. Jacqueline Segall. I am very
grateful to Dr. Bernard L. Trumpower from Dartmouth Medical School
from whom I have gained much knowledge over the years. I would
also like to thank Dr. Peter Lewis, Dr. Reinhart Reithrneier, and Dr.
Shelagh Ferguson-Miller (outside examiner from Michigan State
University) for critically proofreading this manuscript and for many
useful comments.
Somebody who deserves special mention is my husband Robert.
A scientist himself (Astrophysicist), he has been an inspiration and
a hero t o me from the second year of my undergraduate degree.
Without him this work would have never been accomplished. His
dedication as a father and a husband has made it possible for me t o
complete my research.
I would like t o thank rny fellow graduate students and CO-
workers, some of whom deserve special mention. Dr. Frank Merante
and Dr. Sandeep Raha were never too busy t o help out, talk about
science, or play practical jokes. Thank you to Tomoko Myint for her
endless friendship and encouragement. I would also like to thank Dr.
Sandeep Raha, and Dr. Mingfu Ling for critically proofreading this
dissertation and for many useful comrnents. Thank you to Maureen
Waite, our administrative assistant, for easing my work on many
occasions.
I would like to thank my family, especially my mother, for her
never-ending support and for believing in me. Her encouragement
has given me strength. 1 also thank my mother as well as my sister-
in-law Linda for coming from abroad t o babysit.
Thank you Maxine and Michelle for brightening up even those
days on which none of my experiments worked.
TABLE of CONTENTS
DEDIUTON ............................ .. .................................................................................... v
ACKNOW LEDGEM ENTS.. ................... .... . .. .......................................................... .vi
a..
TABLE of CONTENTS.. ............................................................................................ .viit
a.*
UST of FIGURES ....................................................................................................... XIII
......... LIST of TABLES ............. ,... .............................................. .. ............ .. m*
ABBREVWONS ................................................................................................. xvii
CtIAFl€R 1 : Introduction ................................................................................... 1
Components of the mitochondrial respiratory chain .............. ......... 1 O
1. NADH dehydrogenases ....... .. ............................................................................. 1 0
II. Succinate-ubiquinone reductase ............................................................... 1 1
................................................. III. Ubiquinolcytochrorne c oxidoreductase 1 2
vi i i
............................................................... The Rieske ironsulfur protein 1 7
........... What about the supernumerary subunits of complex [Il? 19
................ ................ The supernumerary subunits of complex III .. 20
...................... Subunit 6 may regulate the activity of complex III 20
.................................... Subunit 7: the protein of the current study 21
....................................... Subunit 8: a ubiquinone-binding protein ? 23
Subunit 9 .......................................................................................................... 24
Subunitl O ........................................................................................................ 25
The core proteins .......................................................................................... 25
...................................................... Functional assembly of complex III 26
N . Cytochrome oxidase .......................................................................................... 29
...................................................................................................... V . ATP synthase 31
................................... ...... ............ N ucleo-rnitochondrial interactions ....., .... 33
................. How do mitochondria and the nucleus communicate ? 34
The expression of many complex III subunits is dependent on
........... ....................................... the need for oxidative metabolism .. 36
Do mitochondria exert regulation on nuclear gene
..... products ? ................. ... .... .................................................................. 38 ......................... .................................... Protein import into mitochondria ........ 39
............................................... Import into the mitochondrial matrix 40
The targeting sequence .............................................................................. 43
Cytoçolic chaperones .................................................................................. 44
Receptors in the outer mitochondrial membrane ......................... 46
Pase
The translocation channel and the mitochondrial
....................................................................................................... chaperones 48
.. ............................... lmport into the intermembrane space (IMS) .... 49
................ lmport into the inner mitochondrial membrane (IMM) 5 1
............... lmport into the outer mitochondrial membrane (OMM) 5 2 . . ................................................................................... Objectives of the research 52
................................. CHAPTER 2: Inactivation of the QCR7 gene .... 54
2.1 . INTROOUCTiON .................................................................................................... S S
2.2. MATERIALS AND METHODS ............................................................................. 57
.................................................................................................................... Materials 57
2.2.1 . Disruption of the chromosomal copy of the QCR7 gene ............... 58
2.2.2. Confiming inactivation of the QCR7 gene ......................... .. .......... 60 . . Selection of diploids ............... ... ......................................................................... 60
Northem and Southem bbtting .......................................................................... 60
Isolation of yeast mitochondria ....................................................................... 61
Western analysis ............................... ... ..................................................................... 62
.......... 2.2.3. Raising an antibody in chicken against the Qcr7 protein 63
................... Isolation of anti-Qcr7 antibody from rabbit and chicken -63
2.3. RESULTS .................. .. .................................................................................. 65
Disruption of the QQP7 gene ..................... ..... .................................................. 65 ................. .......*.......*.......... Confirmation of the qcr7 gene inactivation .. 69
2.4. DISCUSSION .................. ... ........................................................................ 73
CHAPTER 3: Mutagenesis of the QCR7 gene ..................................... 74
3.1 . INTRODUCTION ......... .. ........ ....... ...................................................... -75 3.2. MATERIALS AND MmK)DS ............... .... ................................................... 85
Materials ............................................................................................................ ........... 85
...................... .................. .............................. Mutagenesis by PCR ........ ...... 85
Sitedirectecd mutagenesis using the M 1 3 phage ................. .... ............ 88 .
............................................................................................ Enzyme assays ... ....... 89
........................................................................................................... Growth studies 89
............................................................................................... .. ... 3.3. RESULTS ..... ... 91
Characterization of mutants by growth ....................... .. ....................... 91 . . . ................................................................................................. Enzyme activi ties 95
3.4. DISCUSSION ....................................... .. ................................................................ 99
CHAPTER 4: The role of the amino-terminus of the
Qcr7 protein in rnitochondrial targeting. complex III
asse mbly. and proton pumping ........................................................... 102
.................................................................... 4.1 . INTRODUCTION .............. ... 1 03
4.2. MATERUILS AND METHODS ........................................................................ 1 04
Materials ............................................................................................................... 104
Isolation of yeast rnitochondria and Western analyses ........................ 104
.............................................................. ATP synthesis assays ................. ...... 105
............................................................................ Circular Dichrosm spectra 105
Spectra of the cytochrornes .............................................................................. 106 . . . .................................................................................... Co-immunoprecipitation 106
Buffers ............ ... ............................................................................................ A07
Procedures ..................................... ,., ........................................................... 107 . .
Cross-hnking ............................................................................................. 108
4.3. RESULTS ................................... .................. . . . 1 0
Circular Dichroism spectra of amino-terminal peptides ..................... 1 7 0
The amino-terminus of the Qcr7 protein may facilitate import
into mitochondria ................................................................................................... 113
The amino-terminus of the Qcr7 protein is essential for
assernbly of the bel complex ...................................................................... 120 . . .
Co-immunoprecipitations .......... ... .................................................................... 129
Deletion of seven residues from the amino-terminus does not
impair proton pumping ..................................................................................... 131
The strain expressing Qcr7p-~7 is temperature sensitive ................. 132
4.4. DISCUSSION ...........,......................................................................................... 1 3 5
CHAPTER 5: Discussion and Future Directions ........W........... 1 39
DISCUSSION .. ..........,... .............................................................................................. 140
Future Directions ................................................................................................... 158
Confirmation of assembly of the Qcr7 protein N-
terminus with cytochrome b and/or the 11 kDa
subunit and identification of contact sites .................... .. .......... 158
Testing for the involvement of the Qcrï protein
N-terminus in mitochondrial import ............... .... ......................... 161
x i i
LIST o f FIGURES
Figure 1-1
Figure 1-2
Figure 1-3
Figure 1-4
Figure 2-1
Figure 2-2
Figure 2-3
Figure 2-4
High resolution scanning electron micrograph
.................................................................. of a mitochondrion 5
The mitochondrial respiratory chah of S. . . ................................................................................ cerewae. -9
mechanism ............................................................. 1 4
lmport of proteins into the mitochondrial
........................................................ ......................... rnatrix 42
DNA construct for disrupting the QCR7
......................................................................... ...... gene ..... 5 9
Southern blot analysis of the parental strain
W303-1 B and the disrupted strain, qcr7A:LEU2 ...... 68
Northern blot analysis of qcr7d:LEUZ .......... ... ......... 71
Western blot analysis of qcr7A:LEUZ and
qcr7A:LEUZ transformed with the wild type
........................................................................... <Sa77 ge ne.. 72
Figure 3-1 Helical wheelplots and folding pattern of the
13.4 kDa subunit of beef heart mitochondrial
complex III.. ........................................................................ ..77
Figure 3-2 Alignment of yeast Qcr7 protein and its
1 3.4 kDa homolog from beef heart
mitochondrial complex III ................................................. 82
Figure 3-3 Growth on SD agar plate with ethanol/glycerol
and 0.1 % glucose, or SD media plate . -
containing glucose ................................................................ 94
Figure 4-1 Circular Dichroism spectra ..................... .. ......... 1 12
Figure 4-2 Helical wheel projections .................... .. ............... 1 1 4
Figure 4-3 Western blot analyses of mitochondrial
proteins from YSM-qcr7~ strains overexpressing
wild type and N-terminally truncated proteins
Qcr7p-~7, Qcr7p-Al O, Qcr7p-~14.
Qg7pQO .......................................................................... 1 1 6
Figure 4-4 Quantification of complex III subunits in
various Qcr7 mutant strains by densitometry ...... 117
xiv
Figure 4-5 Western blot analyses of mitochondrial proteins
from YSM-qcr7A strains overexpressing
wild type Qcr7, Qcr7p-~7(DI 3V).
Qcr7p-a7(Rl OK), and Qcr7p-~7(RI 01/61 ZV),
respectively .......................................................................... 1 23
Figure 4-6 Difference spectra of the cytoc hromes ................... 1 28
Figure 4-7 Western blot analysis perforrned with
mitochondrial membranes prepared from
YSM-qcr7a (grown a t 37aC) overexpressing
Qcr7p-a7 and the wild type Qcr7
................................................................. ............... protein .. 1 34
LIST of TABLES
Table 1-1
Table 3-7
Table 3-2
Table 4-1
Page
Complex III subunit composition ................................... 13
........................ Prirners used for mutagenesis ..... ........... 87
Sumrnary . Characterization of mutants
according to growth and enzyme activities .............. 98
..................................................................... ATP syn thesis 1 33
xvi
LIST o f A8BREVIATIONS
ATP
BClP
D7-r
EDTA
FlSH
h
IMM
I M S
ISP
kDa
min
mt
NBT
OMM
PAGE
PBS
PMSF
RT
SD media
SDS
adenosine 5'-triphosphate
5-bromo-4-chloro-3-indolyl phosphate-toluidine
ditheiothreitol
ethylenediamine tetraacetate
fluorescence in situ hybridization
hour
inner mitochondrial membrane
intermembrane space
Rieske iron-sulfur protein of complex III
kilodaIton
minute
mitochondrial
p-nitro blue tetrazoliurn chloride
outer mitoc hondrial membrane
polyacrylamide gel electrophoresis
phosphate-buffered saline
phenylrnethylsulfonyl fluoride
room temperature
synthetic def icien t media
sodium dodecyl sulfate
xvi i
CHAPTER 1
Introduction
CHAPTER 1
Introduction
The focus of this study is subunit 7 (also referred to as Qcr7
protein or 1 4 kDa subunit) of ubiquinol-cytochrome c oxidoreductase
(also termed complex III or bc, complex) of the mitochondrial
respiratory chain in Saccharomyces cerevisiae. Complex III is
involved in the establishment of the protonmotive force which is
used to drive ATP synthesis. QCR7, the gene encoding subunit 7, is
nuclear encoded and therefore has to be imported into mitochondria.
Hence, for the functional assembly of complex III, a coordination of
nuclear and mitochondrial genomes is required.
To give a brief account of the topics involved in the study of
the Qcr7 protein, an overview is first given as to where, in the study
of metabolism, mitochondria f i t in. Following this overview is a
general section on mitochondria and a detailed description of the
enzyme complexes in the mitochondrial respiratory chain with an
emphasis on the bc,cornplex and assembly thereof. After that,
nucleo-mitochondrial interactions are discussed and a current
update of mitochondrial protein import is given. The introduction
closes with a brief account of the objectives of this study (a more
detailed account is given a t the beginning of Chapter 3).
If not mentioned otherwise, al1 the information given in this
dissertation and al1 the terminology used are specific t o
Saccharomyces cerevisiae, also referred t o simply as "yeast"
throughout this study.
Ovewie w
Living organisms are not a t equilibrium. Rather, they need a
continuous influx of free energy to maintain order in a universe bent
on maximizing disorder (1). Free energy is derived from the intake of
nutrients, and metabolism is the process that liberates the free
energy so that it can be utilized t o drive the various functions
needed t o sustain life. There are two categories of metabolic
pathways: reactions involved in catabolism and those involved in
anabolism. The driving force for the endergonic reactions involved
in anabolisrn uses ATP and NADPH which are generated by the
exergonic breakdown of a variety of substances during catabolism.
These substances, carbohydrates, lipids, and proteins, are provided
by the nutrient intake of the organism and are catabolized to their
component monomeric units: glucose, gfycerol and fatty acids, and
amino acids, respectiveiy. Subsequently, these metabolites are
converted to the common mitochondrial intermediate acetyl-
coenzyme A which is then further oxidized t o COp by the enzymes of
the citric acid cycle with the concurrent reduction of NAD' and FAD
t o NADH and FADH2. NADH and FADH2 enter the mitochondrial
electron transport chain where they are reoxidized, the final
acceptor of electrons being O*. The complete breakdown of a
substance entering the living system therefore results in the final
products HzO and CO2. The energy generated during this process is
used to drive the synthesis of one of the bioenergetically most
important molecules, ATP. Thus, living organisms are not at
equilibrium, but rather maintain a steady state; despite the intake
of large amounts of water and nutrients, the weight of an adult does
not change significantly over his/her lifetime.
Mitochondria
Mitochondria (Fig. 1-1) constitute the site of eukaryotic
oxidative metabolism. The enzymes of the pyruvate dehydrogenase
complex, the citric acid cycle, as well as those involved in fatty
acid oxidation (in humans), electron transport and oxidative
phosphorylation are al1 located in the mitochondrion. In addition t o
serving as the cell's "power plant", mitochondria, however, also play
roles in the generation of precursors for anabolic pathways and in
calcium homeostasis of the cell (2). Mitochondria, which can occupy
up t o 20% of the cytoplasm of a eukaryotic ceII (31, consist of four
areas, each of which embodies a distinct set of proteins. The
smooth outer mitochondrial membrane (OMM) contains the pore-
forming protein porin which renders the membrane permeable t o
diffusion for a number of molecules. Receptor components involved
in import o f nuclear encoded mitochondrial proteins are also
embedded in this membrane ( 4 - W . The enzymes of the respiratory
chain and oxidative phosphorylation are located in the
intermembrane space (IMS) and the extensively invaginated inner
rnitochondrial membrane (IMM). The number of invaginations
(cristae) in the IMM and sites for oxidative phosphorylation Vary
with the metabolic demand of the cell type. Thus, the surface area
of the inner membrane is larger in a heart muscle cell with a high
Fig. 1-1. High resolution scanning electron rnicrograph of a rnitochondrion (M) typically found in striated rat muscle (x8000).(17*) The cristae are densely packed into the matrix space and show both shelf or plate (short arrow) and tubular (long arrow) morphology. 1, inner mitochondrial membrane (IMM); O, outer mitochondrial membrane (OMM); T, T-tubule.
rnetabolic demand than in a liver cell. The IMM contains more
proteins than the OMM, about 70% by weight, and in beef heart half of
al1 these integral membrane proteins are involved in oxidative
phosphorylation. The remaining 30% of the membrane is lipid in
nature, composed of approximately 1 5 % cardiolipin, 40%
phosphatidylcholine, and 35% phosphatidylethanolamine (1 2 ) . Unlike
the OMM, the IMM is freely permeable only to Op, COZ, and H20 (2).
This limited permeability of the IMM permits the generation of ionic
gradients, but it also calls for a number of transport mechanisms.
The fourth and innermost region of the mitochondrion is the matrix,
a gel-like compartment, that consists of approximately 50% water.
The matrix contains the pyruvate dehydrogenase complex, the
enzymes of the citric acid cycle and fatty acid oxidation, as well as
substrates for the electron transport chain, nucleotide cofactors,
inorganic ions, and the mitochondrial genetic and protein synthetic
machineries (1 3).
Theories as to the origin of mitochondria now favor the
endosymbiosis hypothesis, such that mitochondria contain their own
genetic code, DNA replication and protein synthetic machineries. As
can be seen from fixed sections under the electron microscope,
mitochondrial (mt) DNA may exist in three alternative forrns: closed
circular, linear, or aggregates of large and small circles. The size
of the DNA molecule can Vary extensively from 16 kb in animals to
100 kb in plants (2). Saccharomyces cerevisiae has one of the
largest mt DNA molecules seen in fungi, a circular molecule of 70-
75 kb which is 21 -25 pm long. Yeast m t DNA also contains introns
and intergenic spacers. On the other hand, the circular, 16.5 kb mt
DNA molecule of humans is highly efficiently organized and is
therefore one of the smallest ones, being only 4.8-5.1 pm in length.
Yeast mt DNA encodes 24 tRNAs, as weli as large and small rRNAs;
although yeast mt DNA may encode more than one small and one large
rRNA, only one of each is functional. In addition, yeast rnt DNA also
encodes cytochrome oxidase subunits 1, 11, III, cytochrome b, ATPase
subunits 6, 8 , and 9, RNA maturases, an intron transposition
endonuclease, an RNA component RNase-P-like enzyme and a
ribosome-associated protein (3. '3). The introns of the cytochrome b
gene are believed to encode maturases required for the splicing of
its RNA transcript (14). Some strains of S. cerevisiae have a split
21 S rRNA gene; the intron of this gene encodes a protein, however,
with a function other than RNA splicing ( 2 ) . All genes are
transcribed from the same strand, except for the tRNA for threonine.
Initiation of transcription is marked by the sequence S-atataagta-
3', whereby the last adenosine constitutes the first nucleotide of
the translational initiation codon atg. In yeast, there are 20
different primary transcripts which al1 contain a t least two coding
sequences (1 5).
The simple and highly organized mitochondrial genome of
humans encodes only two rRNAs, 22 tRNAs, and a small number of
proteins o f the respiratory chain and oxidative phosphorylation. The
human mitochondrial genome does not contain any introns or
intergenic spacers, nor does it encode any regulatory elernents. In
al1 animal mitochondria, both strands are transcribed from a single
promoter and the prirnary transcripts contain al1 the information
encoded in each of the two strands. There are no 5' leaders in the
transcripts; however the tRNA genes which are present between
most genes signify the s ta r t and end of a gene (15). From the small
mitochondrial genome in animals it is evident that only a few of the
hundreds of mitochondrial proteins are encoded by mitochondrial
DNA. Hence, most of the respiratory chain enzymes as well as most
of the components of the mitochondrial genetic system such as
mitoc hondrial DNA polyrnerase, mitochondrial RNA polymerase,
ribosomal proteins, and translation factors are encoded by nuclear
DNA (3).
The mitochondrial respiratory chain consists of five enzyme
complexes which are ernbedded in the inner mitochondrial membrane
(Fig. 1-2). Electron transport through complexes III (also referred to
as ubiquinol-cytochrome c reductase or bc, complex) and IV
(cytochrorne oxidase) in S. cerevisiae and complexes I (NADH-
ubiquinone reductase), III, and IV in humans is coupled to vectorial
proton translocation into the IMS, resulting in the establishment of
a proton gradient and subsequent membrane potential. The energy
from this gradient is then used as the driving force for ion
translocation and protein import into mitochondria, as well as for
ATP synthesis, which is catalyzed by complex V, the F,F, ATPase (2.
12).
There are some differences between the mitochondria of yeast
and those of humans and many of these differences are the result of
H I H+ "extemal" NADH H+ H+ H+
dety dmgenzse H+ H+ 1 MS NADH kf +
"internai" NADH drhydrognase f
FADH2
Fig. 1-2. The mitochondrial respiratory chain of S . cerevisiae. Sketch of the four complexes of the mitochondrial respiratory chain in yeast: succinate dehydrogenase (complex II), u biquinol-cytochrome c oxidoreductase (complex III or bc, complex), and cytochrome oxidase (complex IV), as well as the ATPase (complex V). Arrows indicate the order of electron flow and concurrent proton ejection into the IMS by complex III and the final electron acceptor, complex IV. Protons are transported back across the IMM against the electrochemical gradient by the ATPase, complex V.
regulation of the mitochondrial and cytosolic redox balance as
expressed by the NAD/NADH and NADP/NADPH redox ratios. For
example, unique to yeast mitochondria are the L-lactate:cytochrome
c oxidoreductase, cytochrome c peroxidase, and the external and
internal NADH dehydrogenases. These NADH dehydrogenases are
involved in the oxidation of cytosolic NADH and thus there is no need
for shuttle systems which transfer NADH from the cytosol t o the
mitochondria. Furthermore, aspartate arninotransferase is only
present in the cytosol, hence yeast do not have a functional malate-
aspartate shuttle; this, also, is probably a result of their ability t o
oxidize externally added NADH. A fatty acidhalate-citrate shuttle
is not necessary, because of the absence of p-oxidation of fat ty
acids in most yeast mitochondria (2. '6. ' 7 ) .
Components of the mitochondrial respiratory chain
1. NA DH dehydrogenases
In humans, respiratory chain complex I is the largest of al1 the
enzyme complexes and consists of at least 42 subunits (18) with
many of the subunits having been discovered in recent years. In S.
cerevisiae on the other hand, this enzyme complex does not exist.
However, yeast have two NADH dehydrogenases which are located in
the IMM. One of these is an "external" type of mitochondrial NADH
dehydrogenase, which can oxidize externally added NADH. This is a
function that mammalian cells do not possess. The other is an
"internal" NADH dehydrogenase. This enzyme consists of one subunit
(mw=53000) which contains FAD and reacts with ubiquinone. This
molecule carries out the oxidation of NADH which is generated in the
matrix by the citric acid cycle. Both types of NADH dehydrogenases,
unlike the human NADH-ubiquinone reductase, are insensitive t o the
inhibiton rotenone and piericidin and neither one of them is coupled
t o proton translocation across the IMM (16, 17). Under conditions of
stawation for carbon and nitrogen, however, S. cerevisiae is capable
o f synthesizing a NADH dehydrogenase that is involved in the
establishment of a proton gradient. This dehydrogenase oxidizes
intramitochondrial NADH and is insensitive to rotenone (2. 16).
The yeast S. cerevisiae also contains a flavoprotein-containing
NADH dehydrogenase that is embedded in the OMM. This enzyme,
which is antimycin insensitive, catalyzes the oxidation of
cytoplasmic NADH and is overexpressed in a ubiquinone-deficient
mutant (1% 20). This NADH dehydrogenase is a component of an outer
membrane electron transfer chain in which electrons flow via a
cytochrome b5.to cytochrome c.
II. Succina te-ubiquinone reduc tase (complex II)
Succinate-ubiquinone reductase, also known as complex II, is
located on the matrix side of the IMM and catalyzes the oxidation of
succinate and the reduction of ubiquinone to ubiquinol (Fig. 1-2). In
humans, complex II is composed of four subunits: a 70 kDa
flavoprotein that contains covalently bound FAD, a 27 kDa iron-
sulfur protein (ISP) with three iron-sulfur clusters, as well as a
15.5 and a 13.5 kDa subunit which are membrane-bound and contain
b-type hemes. This enzyme complex, which consists solely of
nuclear encoded subunits, does not transfer protons into the IMS and
is thus not involved in the establishment of the proton gradient.
This is probably why this complex has not been studied as
extensively as complexes III and IV in yeast and complexes 1, III, and
IV in humans (21).
Ill. Ubiquinol-cytochrome c oxidoreductase (complex 111, bc, complex)
Complex III, a homodimer (1621, accepts electrons from
complexes I and II via the electron shuttle ubiquinol and catalyzes
the reduction of cytochrome c (Fig. 1-2). In human and beef heart
mitochondria, complex III consists of 11 subunits (228 23) and a
recent documentation on the preliminary crystallization of the beef
heart mitochondrial complex predicts 1 3 transrnembrane helices for
each monomer (162). SO far, only 10 subunits have been discovered
for yeast complex III (Table 1-1 ) (2. 24). Hence, these complexes
contain six to eight additional polypeptides than the homologous
enzyme complexes of some other organisms. The chloroplast and
cyanobacterial bsf complexes have four subunits and the complex
from P. denitrificans has a mere three polypeptides (25-27). Although
the number of subunits varies widely in al1 these comparable enzyme
complexes, they al1 contain the same number and kinds of prosthetic
groups. There is a b-type cytochrome which contains two hemes, a
cytochrome c l or f which contains one heme, and the Rieske iron-
sulfur protein (ISP) which contains a [ZFe-2S] ferredoxin. The
subunits containing prosthetic groups are also referred to as the
catalytic core. The mode of electron transfer is believed to be
according to the Q-cycle mechanism (28-30) (Fig. 1-3). In addition to
the subunits containing redox centers (cytochrome b, cytochrome c,,
I Table 1 -1 . COMPLEX III SUBUNIT COMPOSITION
I - -
I YEAST BEEF HEART Subunit Daltons
Core 1 Core 2
Subunit Daltons
Core Proteins 48,225 38,714
Core 1 Core 2
Catalytic Su bunits C Y ~ b 43,633 CYt Cr 27,419 ISP 23,349
Supernumenry Subunits
Cyt b CYt G ISP
17 kDa (QCR6) 14,513 1 4 kDa (QCRT) 14,561 1 1 kDa (QCRB) 1 1,000
7.2 kDa (QCR9) 7,262 8.5 kDa (QCR70) 8,492
Hinge 9,175 13.4 kDa 13,389 9.5 kDa 9,507 DCCD 7,998 7.2 kDa 7,189 6.4 kDa 6,363
Center
Center
Fig. 1-3. Q-cycle rnechanism as adapted from Trumpower (28).
The scheme shows the pathway of electron transport through the bc, complex with the reaction order through the four redox centers indicated by numbers (1) through (4). In step (1) ubiquinol is oxidized a t center P whereby one electron is transferred from ubiquinol t o the iron-sulfur protein (ISP). The newly generated ubisemiquinone anion a t center P immediately reduces the cytochrome b-566 heme in what is referred to as oxidant-induced reduction. This first step results in the deposition of two protons on the positive side of the membrane, center P. In step (2) the electron from the ISP is transferred to cytochrome c l which subsequently transfers it to cytochrome c of complex IV. In step (3) the electron from the b-566 heme is transferred to the higher potential b-560 heme against the membrane potential. In step (4a) ubiquinone is reduced to the relatively stable ubisemiquinone anion a t center N. Step (4b) occun in the second round o f the cycle and in this round the b-560 heme reduces the ubisemiquinone anion to ubiquinol with the consumption of two protons from the matrix side of the membrane. Thus one complete Q-cycle deposits four protons ont0 the positive side of the membrane, and transfers two electrons to complex IV, thereby reducing two molecules of cytochrome c.
and ISP), there are two core proteins and five so-called
supernumerary subunits (encoded by the genes QCR6, QCR7, QCRB,
QCRS and QCR 70 in yeast).
vtochrome b
Cytochrome b, the only mitochondrially encoded subunit of
complex 111 ( 3 4 represents the Iiydrophobic core of the complex with
eight predicted membrane-spanning a-helices. Its primary structure
is well conserved among various organisms. The two hemes, b566
and b562? are located on opposite sides of the membrane, one at the
positive side, center P (also referred to as center "O" for proton
output), and one towards the negative matrix side, center N (also
called center "i" for proton input). This is in agreement with the Q-
cycle mechanism and the eight membrane-spanning helix structure
is therefore the accepted model, as opposed to the nine membrane-
spanning helix structure proposed in earlier studies (2). The eight
membrane helix model is also consistent with a number of studies
involving mutants that are resistant to inhibitors (31). Two pairs of
conserved histidine residues are the ligands to the two heme groups;
each heme is bound to one histidine in the second helix and one in the
fourth helix. Mutants that lack cytochrome b are devoid of complex
III enzyme activities and display low steady-state levels of the ISP
as well as of the 14 kDa and 1 1 kDa supernumerary subunits. The
rate of synthesis of these three subunits is not affected in
cytochrome b mutants. Rather the low steady-state levels are
believed to be the result of a faster turnover rate since cytochrome
b, the 14 kDa and the 11 kDa subunits have been shown to form a
subcomplex for which the ISP has a high affinity (2.31-34).
Cytochrome b has been shown to be involved in ubiquinone-
binding by photoaffinity labeling of inhibitors. lnhibitors of complex
III such as hydroxy quinoline N-oxide (HQNO), diuron, 6-undecyl-5-
hydroxy-2,3-dioxobenzothiazole (UHDBT), stigmateIIin, and
myxothiazol which are ubiquinone, ubiquinol, or ubisemiquinone
analogs bind cytochrome b a t center P or N. Cytochrome b by itself
is believed t o form the binding site for ubiquinone at center N;
therefore inhibitors of this site, such as antimycin, block the
reoxidation of cytochrome b and destabilize the bound
ubisemiquinone. On the other hand, the ubiquinone binding site a t
center P is formed jointly by cytochrome b and the ISP; hence,
inhibitors of this site, such as myxothiazol, block reduction of the
ISP and also prevent reduction of cytochrome b in the presence of
antimycin (281 32) (see Fig. 1-3).
çytochrome c,
Cytochrome c i , a protein with a molecular weight of 27,419 is
another heme-containing subunit of the bc, complex. All cytochrome
cl proteins studied so far contain the consensus sequence CXXCH a t
residues 40-44 of the mature protein. This is a characteristic of
protoporphyrin IV proteins in which the heme is liganded to a
histidine residue (2. 35). In addition, a conserved methionine a t
position 164 has been proposed as the sixth ligand t o the heme iron.
Although cytochrome c l is overall hydrophilic, it has a nonpolar
stretch of 15-20 amino acids near the carboxy terminus. It has been
suggested that this region forms an a-helix which anchors the
protein in the membrane (35). The remaining part of the protein,
including the catalytic center, is believed t o be located in the IMS
(162). Cytochrome cl is a nuclear encoded subunit that is synthesized
with a bipartite signal sequence (two amino-terminal leader
sequences arranged in tandem), 61 amino acids long. Two different
mechanisms have been suggested to explain the targeting of this
protein into its final destination in the IMS (36 .37) (see below).
The Rieske iron-sulfur protein
The Rieske ISP with a calculated molecular mass of 23,349
daltons and a length of 215 amino acids is the third subunit of
complex III containing a redox center. Just like cytochrome c l , the
ISP is nuclear encoded and synthesized with a bipartite signal
sequence 3 0 residues long (MLGIRSSVKTCFKPMSLTSKRLISQSLLAS)
(381 39). Its catalytic center is located in the aqueous environment of
the IMS (162) and is linked to the inner membrane by a hydrophobic
anchor. Proteolytic cleavage a t a site just downstream from the
putative membrane spanning helix of the ISP in E. coli and R.
sphaeroides renders the protein water-soluble (40).
The ISP contains a [2Fe-ZS] ferredoxin with a very high
midpoint potential which is liganded to the two histidines and two
of the cysteine residues in the following conserved sequences: CPCH
and CTHLGC. Due to its high redox potential the ISP is the primary
electron acceptor during hydroquinone oxidation and is thus involved
in what is often referted t o as "oxidant-induced reduction" of the
lower potential heme of cytochrorne b (refer t o the Q-cycle
mechanism, Fig. 1-3). Like cytochrome b, the ISP binds stigmatellin
and ubiquinone analogs. Hence, it has been suggested that both
cytochrome b and the ISP interact to form the binding site for these
inhibitors (2, 28,38, 39,41,42).
Results from mutational analyses of the ISP suggest that
substituting the conse~ed residues that constitute the ligands to
the [ZFe-2S] cluster does not prevent processing of the precursor to
the mature polypeptide, although a slight increase of incompletely
processed iron-sulfur apoprotein can be detected in the mutants.
Mutagenizing the ligands, however, prevents the [ZFe-2S] cluster
from being inserted into the apoprotein and, although it does not
prevent assembly of the bc, complex, the iron-sulfur apoprotein is
more easily lost upon purification of the complex. Earlier studies
indicated that when the gene encoding the ISP is deleted the
cytochrome b hemes are distorted (39) . However, a mutational
anaiysis performed by Graham and Trurnpower (42) seems to indicate
that the simple presence of the iron-sulfur apoprotein is sufficient
to stabilize the environment of the b-hemes resulting in near wild
type levels of this holoenzyme. Based on these results it was
suggested that the insertion of the [2FeW2S] cluster is the final step
in the biosynthesis of complex III. Furthermore, it was suggested
that the iron-sulfur apoprotein itself is involved in stabilizing the
heme environment of cytochrome b and that the [ZFe-2S] cluster is,
in turn, invoived in stabilizing the attachment of the ISP t o the
complex (42).
What about the supernurnerarv subunits of com~lex III?
When comparing eukaryotic and prokaryotic bclcomplexes, it
becomes evident that some bacterial isoenzymes that only contain
the three catalytic subunits (cytochrome b, c,, and the ISP) perform
the same function as their eukaryotic counterparts that contain as
many as 11 subunits. This raises the question as to the functional
importance of the so-called supernumerary subunits. Two models
are used t o rationalize their presence. In the first model, a11
primordial organisms are believed t o have contained supernumerary
subunits. Subsequently, as bacteria and mitochondria branched off
from one another during the course of evolution, bacteria, being
more efficient, lost these subunits whereas mitochondria retained
them. From this model it follows that the supernurnerary subunits
are redundant and probably do not serve any function. The second
model States that none of the primordial organisms contained
supernumerary subunits, but rather that they were acquired during
the course of evolution by mitochondria as a result of morphological
differences between bacteria and mitochondria. This latter model
implies that the supernumerary subunits serve a function since why,
otherwise, would they have been acquired during the course of
evolution? All the yeast genes encoding the supernumerary subunits
of complex III have been inactivated and found to be necessary for
the integrity and functioning of the compiex (see below). Hence, the
knowledge that is available today supports the second model
according to which the supernumerary subunits are believed to serve
a function.
The SuDernurnerary subunits of com~lex III
abun i t 6 may reglate the activity of complex III
QCR6 is the yeast gene that encodes the well-conserved, highly
acidic polypeptide of 14.5 kDa that is actually referred to as the 17
kDa subunit due to its migration on SDS-PAGE (it is also known as
subunit 6). This nuclear encoded subunit is the only polypeptide of
the supernumerary subunits that is synthesized with a cleavable, N-
terminal targeting sequence, 25 amino acids long (2. 43). The Qcr6
protein contains an acidic stretch of 24 amino acids, is largely a-
helical. and has a domain which resembles the Ca2' binding domain of
yeast calmodulin (44). However, an involvement of this protein in
Ca2' binding has not been demonstrated to date. The only hydrophobic
region of the protein is at the carboxy-terminus and this region is
postulated to anchor the subunit to the inner membrane. Subunit 6 is
homologous to the "hinge protein" of the bcl complex in beef heart
which has been implicated in promoting ionic interactions between
cytochrome c and cytochrome c l , thereby facilitating electron
transfer f rom the bc, cornplex to cytochrome oxidase (45).
Deleting the QCR6 gene gives rise to a strain that has 50%
residual ubiquinol-cytochrome c reductase activity and maintains
the ability t o grow on non-fermentable carbon sources (46). Schmitt
e t al. have suggested that this deletion causes a conformational
change of the complex that results in "silencing" half of the
reduction sites of the bel dimer. This led t o the belief that the 17
kDa protein is involved in regulating the activity of the complex in
vivo during conditions when the requirement for ATP is low. Hence,
under such conditions a signal must therefore be present in vivo that
rnirnics the action of the deletion. In summary, these gene deletion
studies have shown that subunit 6 is not necessary for assembly of
complex 111 (46). On the other hand, studies performed in which the
QCR6 gene was disrupted, rather than deleted, resulted in a complex
that lacked any detectable enzyme activity and holocytochrome b
(47). This was believed to be due to the existence of an aberrant copy
of the 17 kDa protein that was being synthesized. This non-
f unctional polypeptide supposedly prevented the complex from
assembling by binding either to cytochrome cl or the Qcr9 protein
thereby removing these subunits from the assembly pathway and
preventing further assembly. Overexpressing the Qcr9 protein could
partially correct for this defect by binding the aberrant Qcr6 protein
and preventing it from removing cytochrome c l from the assembly
pathway. From these results it was concluded that subunits 6 and 9
interact with cytochrome cl to form a subcomplex (47).
Subunit 7: the protein of the current studv
QCR7 is the nuclear gene encoding the so-called 14 kDa subunit
(also referred to as subunit 7 or Qcr7 protein) which has a molecular
weight of 14,561 and is the focus of the current study. Subunit 7 is
a largely hydrophilic protein with a hydrophobic stretch from
residues 19-38. The QCR7 gene has been cloned and sequenced; the
deduced protein was found to be homologous to the 13.4 kDa subunit
6 o f the beef heart mitochondrial bc, complex (23s 339 48). The
upstream sequence of this gene has elements similar to a CAAT and
TATA box, which are important for transcription initiation in
humans. However, this promoter region lacks motifs for high level
expression in yeast leading to a low abundance RNA transcript (48).
Previous inactivation of the gene encoding subunit 7 indicated
that the 14 kDa subunit is crucial for complex III function (33). The
mutant strain is respiration-deficient and does not grow on non-
fermentable carbon sources. The mutant displays low steady-state
levels o f the 11 kDa and ISP subunits. In addition,
spectrophotornetric analyses indicate that holocytochrome b cannot
be detected and Western blot analyses show that apocytochrome b
levels are far below those in the wild type. As RNA transcripts of
the 11 kDa subunit and the ISP are present at wild type levels, the
results indicate that the low steady-state levels of the above
proteins are likely to be due to a post-transcriptional effect. Hence,
the pet- phenotype (the phenotype resulting from a respiratory chain
defect) seen in the mutant in which the QCR7 gene has been
inactivated, is most iikely due to an inability of the bci complex t o
assemble, which in turn results in degradation of the subunits
associated with the Qcr7 protein. Based on these results Schoppink
e t al. suggested that the 14 kDa subunit associates with cytochrome
b, the 11 kDa subunit, and possibly the ISP t o form a subcomplex
before further assembling into a functional enzyme complex. A
study performed by Hemrika e t al. (494 in which the C-terminal 12
residues were replaced by the 3 residue segment L-A-D, resulted in
complex III activity that was reduced by approximately 60% when
compared to the wild type, whereas the turnover number was normal.
This mutant also displayed lowered levels of holocytochrome b, the
11 kDa subunit, and the ISP. In the same study, a mutant was
constructed in which the C-terminal 31 residues were replaced by
the sequence D-L-Q-P-S-L-L-1-D. This mutant displayed a phenotype
similar t o the strain in which the QCR7 gene is inactivated. The
authors concluded from this study, that the C-terminus of the 14
kDa subunit is involved in the formation of a functional enzyme
complex. However, as the authors did not have an antibody that
recognized the truncated 14 kDa subunits, it cannot be ruled out
from this study that the decreased levels of assembly are in fact a
secondary effect resulting from decreased import of the 14 kDa
su bunit.
Subunit 8: a ubiauinone-bindina rotei in? QCR8 is the nuclear gene encoding a polypeptide of 11 .O kDa
which is usually referred to as the 11 kDa subunit (also referred t o
as subunit 8) of the bc1 complex (50, si). The amino acid sequences of
this subunit and its 9.5 kDa beef heart mitochondrial counterpart,
which has been implicated in ubiquinone-binding (521, are not
significantly similar, however their predicted secondary structures
are very similar (53). Mutagenesis of an aromatic region of the 11
kDa subunit has indicated that this region may be involved in the
assembly of a functional enzyme and in ubiquinone-binding a t center
P (50, 54, 55). Deletion of the QCR8 gene leads to low steady-state
levels of the 14 kDa subunit as well as the ISP and cytochrome b, the
latter being detected by absorption spectra. These results are in
agreement with the gene deletion studies of subunit 7 and further
strengthen the hypothesis of a subcomplex consisting of the 11 kDa
and 14 kDa subunits, and cytochrome b. Since deletion of the gene
encoding the ISP does not affect assembly of the bel complex, it is
not understood a t which stage the ISP associates with the above-
mentioned subunits, and whether it is indeed an inherent part of this
su bcomplex.
Subunit 9
QCR9, the gene encoding subunit 9 has a molecular weight of
7,300 and displays 56% identity to its beef heart counterpart.
Deletion of this gene results in a strain that is respiration deficient
with a residyal activity of less than 5% although complex III is still
assembled ( 5 6 ) . Upon further examination, the level of cytochrome cl
was found to be normal; holocytochrome b levels were found to be
decreased in the mutant strain when compared to the wild type.
Mature ISP was present although without the [ZFe-2S] cluster and,
as a consequence, the pre-steady-state rate of reduction of
cytochrome c l was decreased. Based on these results, it was
suggested that subunit 9 interacts with the ISP and the cytochrome
b domain involved in binding the lower potential b-566 heme at
center P. The absence of subunit 9 is therefore believed to invoke a
conformational change of the ISP which prevents the insertion of the
[ZFe-ZS] cluster. This conformational change of the ISP would then
cause a distortion of the b-566 heme environment and thereby alter
the interaction of the ISP with this low potential cytochrorne b
heme. This is so far the only described case in which the absence of
a supernumerary subunit results in respiration deficiency with the
bel complex still being assembled (44.56).
ubunit 10
The most recent subunit that has been discovered is the 8.5
kDa subunit 10 (8,492 daltons) that is encoded by the nuclear gene
QCRIO (24). This polypeptide is the homologue of the 6.4 kDa subunit
11 in the beef heart bcl complex. The two proteins display similar
secondary structures and their amino acid sequences are 51%
similar. Deletion of the QCRlO gene alone does not affect growth on
non-fermentable carbon sources and the mutant strain has a residual
complex III enzyme activity o f 40%. However, deleting both QCR 7 O
and QCR6 gives rise to a strain with a decreased growth rate on non-
fermentable carbon sources. Furthermore, when the bcl complex of
the QCRl O deletion mutant is purified, the ISP is lost. From these
results it was suggested that subunits 6 and 10 rnay be genetically
linked, and that the Q C R 7 O protein may contribute to a tighter
association of the ISP with cytochrorne b (24).
The core proteins
Core proteins 1 and 2 are the largest subunits of ubiquinol-
cytochrome c oxidoreductase and account for 50% of al1 the protein
in the complex. They are both encoded by nuclear genes and have
cleavable N-terminal signal sequences 17 and 16 amino acids long,
respectively. In contrast t o al1 the other subunits of the complex
the core proteins are nearly always present at wild type levels in
strains in which the other subunits of complex III are absent as a
result of gene inactivations. Deletion of the gene encoding core
protein 1 results in a pet- phenotype. The mutant strain does not
grow on non-fermentable carbon sources. Core protein 1 of
Neurospora crassa bc1 complex has been found to be the previously
identified processing enhancing protein (PEP) which stimulates the
activity of the matrix processing peptidase (MPP) in N. crassa (57).
In S. cerevisiae, core protein 1 is homologous, but not identical to
the PEP of yeast (58. 59). Deletion of the gene encoding core protein 2
results in a strain that grows slowly on non-fermentable carbon
sources. Mutants lacking both core proteins have low residual
enzyme activity, but the turnover number is the same as in the wild
type. Hence, the core proteins are not involved in the catalytic
activity of the bel complex, but rather increase the efficiency of the
assembly process (2).
Functional assemblv of complex III
All the research that has been performed on the bc, complex t o
date suggests that three subcomplexes are formed prior to assembly
of a functional enzyme complex. One of the subcomplexes is
believed to consist of cytochrome b, the 14 kDa and 11 kDa subunits.
The reason for the proposed association of these three subunits is
their post-translational interdependence, which has been
demonstrated by the study of strains in which the respective
subunits were missing or mutated (33. 49. 55, 60-63). Although steady-
state levels of the ISP are also reduced in mutants lacking either
cytochrorne b, the 11 kDa or the 14 kDa subunit, the ISP is not
believed to be a component of the cytochrome b subcomplex. This
conclusion is based on findings that a mutant strain containing a
deletion of the gene encoding the ISP does not contain lowered
steady-state levels of any complex III subunits other than of the
ISP; in addition, the insertion of the ISP is believed t o be the last
step in the biosynthesis of complex 111 (56? 60, 64). Hence, the lowered
steady-state levels of the ISP are more likely t o be a secondary
effect resulting from degradation of this protein when its
neighboring subunits are not present. Two nuclear gene products,
encoded by CBP3 and CBP4 in yeast, have been proposed to be
involved in assembly of the bc, complex or maturation of cytochrome
b (directly or indirectly) (61. 62). More specifically, the Cbp3 and
Cbp4 proteins are suggested to stabilize or assemble the cytochrome
b subcomplex since cbp3 and cbp4 mutants display reduced levels of
cytochrome 6, the ISP, and the 11 kDa and 14 kDa subunits. This
might occur by stabilizing cytochrome b, so that it remains in a
competent state for the insertion of hemes or the association with
the 14 kDa and 11 kDa subunits. This notion is consistent with the
belief that maturation of cytochrome b occurs after the formation of
the cytochrome b subcomplex or even after the assembly of this
subcomplex into a stable quarternary complex of which the
composition is unclear a t this point (60).
A second subcomplex that is formed is believed to consist of
core proteins 1 and 2 (47. 57, 60. 65). Contrary to the cytochrome b
subcomplex, this subcomplex is quite stable ( 2 ) . Hemrika e t al. (49)
have proposed that the charged C-terminus of the 14 kDa subunit
associates with this subcomplex consisting of core proteins 1 and 2
and that this association renders the cytochrome b subcomplex
protease resistant. This model is in agreement with previous
results which show that steady-state levels of the 14 kDa subunit
and cytochrome b are decreased in the absence of core protein 2 due
t o an increased sensitivity t o proteases ( 6 6 ) . The model is
furthermore consistent with the more recent prediction of the
topology of the 14 kDa subunit, that not only the N-terminus of this
subunit faces the matrix (661, but also the C-terminus ( 6 7 ) . This is
important because the core proteins are located on the matrix side
of the IMM with a large fraction protruding into the matrix (57).
The third subcomplex is believed to consist of cytochrome c i ,
the 17 kDa and the 7.2 kDa proteins. The prediction of the formation
of a subcomplex composed of these three subunits is based on
findings that the homologues of the yeast 17 kDa and 7.2 kDa
subunits have been cross-linked t o cytochrome c, in beef heart (6s).
Further evidence for the formation of this subcomplex is given by
studies which indicate that the association of the 17 kDa subunit
with cytochrome c, renders the latter resistant t o proteases and
stimulates the interaction between cytochromes c , and c ( 45 ) .
According to Schmitt and Trumpower (47) the 17 kDa and 7.2 kDa
subunits associate with each other first, before combining with
cytochrome c, into a subcomplex of intermediate stability. This
subcomplex then associates with the partially assembled complex
III, consisting of the cytochrome b and core protein subcomplexes, to
form a stable oligomeric complex without the ISP. Insertion of the
ISP completes the assembiy pathway of ubiquinol-cytochrome c
oxidoreductase ( 4 7 , W
Much of the information that led to the prediction of the three
subcomplexes discussed above was based on the varying steady-
state levels o f the supernumerary subunits of complex III in
different mutant strains. In most cases, it was concluded that
lowered steady-state levels were due to an improperly assembled
subcomplex or bc,complex. Hence, the subunits that are lowered are
believed to assemble with the mutated or absent protein. This
prediction is probably true in most cases. However, it cannot be
ruled out that in some cases, in which a protein is mutated rather
than absent, the mutated protein is more susceptible to proteolysis
and that in these instances the lowered steady-state levels of other
subunits are the result of a secondary effect (68-71). As none of the
proteases (except the one responsible for the turnover of the F,P
subunit of the ATPase) involved in the turnover of the nuclear
encoded subunits o f the respiratory-chain enzyme complexes are
known a t the present time, this subject remains open to speculation
(68).
IV. Cflochrome oxidase
Cytochrome oxidase (also referred to as complex IV and COX),
is the terminal enzyme complex of the mitochondrial electron
transport chain (Fig. 1-2). It catalyzes the oxidation of cytochrome
c and the irreversible reduction of Oz t o HrO. In the crystal
structure of cytochrome oxidase from Paracoccus denitrificans ( l s g ) ,
which contains 22 prirnarily helical membrane-spanning segments,
lwata e t al. have identified two possible proton transfer pathways.
These are for the scalar movement of protons which is involved in
the reduction of Oz t o H20, and the vectorial movement of protons
which is involved in the establishment of the protonmotive force in
the IMS ( '59). In the crystal structure of the 13 subunit beef heart
cytochrome oxidase by Tsukihara e t ai. (1 681, three networks capable
of relaying protons were identified; two for the vectorial movement
of protons and one for the scalar movement of protons. Of the 13
subunits of cytochrome oxidase (721, only the three largest ones are
encoded by mt DNA and these constitute the catalytic core. These
are cox 1, 2 , and 3 and they are strikingly similar in beef heart and
in the three subunit-containing enzyme complex of P. denitrificans
as well as to their counterparts in mitochondria of other organisms.
Although cox 1, 2, and 3 are referred to as the catalytic core, only
cox 1 and 2 contain redox centers. Cox 1, contains Cu.and hemes a
and a3, which in beef heart mitochondria are in perpendicular
orientation t o the plane of the membrane. Herne a3 and Cu.
constitute the binuclear center a t which O2 is reduced to H20. Cox 2,
which contains Cu., and cox 3, of which the function is unknown,
associate with the transmembrane region of cox 1 without any
direct contact with each other (168). In the beef heart mitochondrial
cytochrome oxidase cox 1 is mainly embedded in the membrane with
12 transmernbrane helices, whereby the N- and C-termini o f cox 2
are both located on the cytosolic side. All of the 10 nuclear encoded
subunits of beef heart cytochrome oxidase were found to contain
transmembrane a-helices, most of which are neither vertical t o the
plane of the membrane nor parallel to each other (168). In yeast,
nuclear encoded subunits 7 and 7a have been implicated in assembly
of complex IV (731, while subunits 4 and 8 seem to be involved in the
stability of the enzyme (74, 75) . The order of electron transfer
through cytochrome oxidase is from cytochrome c, the primary redox
center, to the Cu, center, then to heme a, and then t o the binuclear
center.
IL A TP synthase
The ATP synthase or complex V (Fig. 1-2) is the enzyme
complex that catalyzes the phosphorylation of ADP t o ATP (769 77).
The complex is composed of three parts: a water-soluble FI portion
("headpiece"), a detergent soluble Fo portion ("basepiece"), and a
"stalk". The role of the Fo portion is to direct the electrochemical
gradient of protons to the Fi moiety; the role of FI is to bind ADP and
Pi and t o use this electrochemical gradient to drive the synthesis of
ATP. The crystal structure of the FI domain from beef heart
mitochondria has been solved at 2.8 angstroms by Abrahams et al.
(160) and was found to be a fiattened sphere 80 angstroms high and
100 angstroms across. In al1 species in which this complex has been
studied so far, FI is composed of five subunits: a, P, y, 6, E and in
most species the subunit stoichiometry is a3 p g y 6 r. The three a and
p subunits are arranged alternately like segments of an orange
around a central a-helix which is 90 angstroms long and is formed
by the C-terminus of the y subunit. This helical structure protrudes
from the main body in a stem and most Iikely constitutes a part of
the "stalk" between the FI and Fo moiety (160). The a, P, and y
subunits are well conserved with the p displaying 70% similarity
from E. coli to humans. These $ subunits contain the three catalytic
sites and react with di- and triphosphates of purine and pyrimidine
nucleotide substrates. The structures of the three catalytic sites
were found to always differ, whereby each one is believed to pass
through a cycle of "open", "loose", and "tight" States (160). This is in
agreement with the prediction of an earlier, low resolution X-ray
structure, which showed that the FI domain is asymmetrical (161).
The a subunits, which are homologues of the P subunits, do not have
a catalytic role, but they bind ADP and ATP. Hence, there are six
nucleotide binding sites on the FI moiety, one on each a and P subunit. In addition t o the a, P , y, 6, and E subunits, there is an
inhibitor protein, IF,, that associates with FI at low protonmotive
force and inhibits ATP hydrolysis.
The subunit composition of the Fo portion varies among
species; the human one consists of a t least eight different types of
subunits: a, b,, ~~(stoichiornetry varies but does not exceed 12), d, e,
OSCP (oligomycin sensitivity conferring protein), F6 (=Factor 6), and
A6L. In S. cerevisiae, the ATP synthase consists of only three
subunits. In al1 species examined so far, subunit c, which together
with the fourth and fifth transmembrane helices of subunit 6 forms
the proton channel, is involved in proton conduction via a free
carboxyl group ( 7 8 ) . Factor 6 is required for FI binding to Fo, and
OSCP is involved in energy coupling between FI and Fo.
ATP synthesis on the surface of the F1 moiety has been shown
t o need little input of energy. The reaction step that actually
utilizes the energy from the electrochemical gradient is the binding
of substrates and the release of bound ATP from Fi (76. 77). Since the
ATPase complex can also work in reverse, catalyzing the hydrolysis
of ATP, it is important that some kind of regulation exists in order
t o prevent the hydrolysis of the newly synthesized ATP. In humans
this is achieved in two ways: 1) binding of the inhibitor protein IF1
to sites on the a and p subunits and 2 ) binding of ADP to sites on the
a and p subunits. Hence, by occupying these sites, IF1 and ADP
prevent the binding and subsequent hydrolysis of ATP. This model
suggests that under high protonmotive force, when IF, or ADP corne
in contact with the proton gradient, IF1 will be released from the
binding sites whereas ADP will be converted to ATP. Hence, in this
model the substrate-binding site will also be the inhibitory site (77).
Nucleo-mitochondrial in teractions
As previously mentioned, mitochondria are believed to have
evolved from an endosymbiotic relationship. Hence the eukaryotic
cell was assembled by a series of symbiotic events. This means
that nucleus, mitochondria, and chloroplasts were each derived from
a different phylogenetic lineage (1. 3). As a result, mitochondria
contain their own genome, but it encodes only a Iimited number of
proteins necessary for the biogenesis and function of this organelle.
The majority of proteins are encoded by nuclear DNA. Hence, for the
bc7 complex and the other complexes that are composed jointly of
nuclear and mitochondrial gene products, the nuclear encoded
subunits have to be targeted for import into mitochondria where
they are assembled with their partner subunits to form functional,
multisubunit enzyme complexes. For this to occur, there has to be a
coordination of the two separate genetic systems.
How do mitochondria and the nucleus communicate?
The answer to this question is far from understood, however
there are a number of levels at which regulation can occur. These
are transcription, translation, import into mitochondria, and
assembly. Saccharomyces cerevisiae is a facultative anaerobe that
can tailor the level of mitochondrial biogenesis to its specific needs
in response to its environment; under different conditions of growth
different metabolic pathways are activated ( '3) . Under conditions of
starvation, for example, the enzymes of the gluconeogenesis
pathway become operative. On the other hand, when yeast are grown
on media containing high levels of glucose, many respiration related
proteins suffer from glucose repression, that is the uptake systems
of sugars other than glucose are repressed (a phenomenon also
referred to as catabolite repression) (2. '5). Expression or repression
of certain genes is usually regulated a t the level of transcription
and is dependent on heme, oxygen, "actively respiring mitochondria",
compounds from intermediary metabolism, and other factors. For
example, glucose repression of mitochondrial biogenesis is in part
attributable t o a three- to sixfold decrease in the amount of
transcription of mitochondrial genes (79). Another example of
regulation a t the transcriptional level is the induction of alcohol
dehydrogenase II and other enzymes of the gluconeogenic pathway.
This induction does not occur in respiratory deficient mutants or in
wild type cells grown on minimal media. Conversely, under
conditions when yeast need oxidative metabolism, growth and
division of the cell are matched by an increase in mitochondrial
mass (13). Although yeast seem to "prefer" the anaerobic growth on
glucose, they cannot grow in the complete absence of oxygen since it
is needed for the synthesis of heme, egosterol, and unsaturated fatty
acids. A mutation resulting in a respiration-deficient phenotype or
addition of an inhibitor to the respiratory chain in combination with
depletion of ATP in the mitochondria is lethal to S. cerevisiae.
There are several types of lactate dehydrogenases, specific for
either L- or D- lactate, that can be synthesized depending on the
growth conditions of S. cerevisiae. On high concentrations of
glucose, whether yeast are grown aerobically or anaerobically, an
NAD-linked dehydrogenase is induced. This lactate dehydrogenase
reduces pyruvate t o lactate and thus regenerates NAD, thereby
keeping the NAD/NADH redox couple balanced (2. 80. 81). However,
this lactate dehydrogenase can also be induced a t low glucose
concentrations when the mitochondrial respiratory chain or
mitochondrial protein synthesis are inhibited. There are two other
types of lactate dehydrogenases that are synthesized when yeast are
grown aerobically on lactate: a D-lactate:cytochrome c
oxidoreductase and a L-lactate:cytochrome c oxidoreductase. These
enzymes catalyze the oxidation of lactate to pyruvate and the
electrons from lactate reduce cytochrome c of complex IV in the
mitochondrial respiratory chain. Thus growth on lactate, unlike
growth on ethanol or pyruvate, can often still occur in the presence
of antirnycin since the proton gradient established by cytochrome
oxidase generates enough ATP t o sustain slow growth (2). When
yeast are grown on galactose the majority of mitochondrial enzymes
are derepressed and ATP is derived from the respiratory chain.
The ex~ression of manv cornplex III subunits is dependent on thg
need for oxidative metabolism
Steady-state levels of the subunits of the bel complex and
cytochrome c of complex IV Vary in response to the need for
oxidative meta bolism. For cytochrome c, this response is primarily
governed by the rate of transcription (82-85). The nuclear gene
encoding cytochrome c, CYC 7 , has two upstream activation
sequences, UAS1 and UASZ. An activator protein called HAP1 binds
to UAS1 and increases RNA synthesis 300-fold under aerobic
conditions; this binding of HAP1 t o UAS1 is stimulated by the
presence of heme. Oxidative phosphorylation is therefore regulated
by the intracellular level of heme, which is logical, since the final
stages of heme synthesis occur in the rnitochondrion and are
dependent on the level of oxygen. On the other hand, CYC1 is
affected by glucose repression (86, 87). There is evidence that HAP1
control is also exerted on genes that encode proteins without hemes,
such as core protein 1 of complex 111 (44).
Transcription of the nuclear genes QCRG, QCR7, QCRB, QCR9,
and the genes encoding core protein 2, cytochrome c l , and the ISP are
al1 repressed by glucose (4% 44). Most of these genes contain the
consensus sequence element of UASZ, but it is not known whether
this is involved in the catabolite repression. The QCR9 gene might
also be regulated at the level of mRNA splicing. This gene has an
intron, and since introns are rare in yeast genes, they often serve a
function, such as the intron of the mitochondrial cytochrome b gene.
The intron of the QCR9 gene has some identical sequence elements to
the intron within the COX4 gene; these sequences might regulate the
coordinate expression of the bc, complex and the cytochrome oxidase
complex (44).
Coordination o f the expression of nuclear and mitochondrial
genes encoding subunits of the mitochondrial respiratory chain can
involve the direct regulation of expression of these genes, or the
regulation of genes whose products are involved in the synthesis of
individual mitochondrial products. Examples of the latter include
gene products involved in the S'-end processing and intron excision
of the pre-mRNA of cytochrome b and in its translation (83-85).
Another example is the CBP6 gene, a nuclear gene coding for a
protein that stimulates translation o f cytochrome b mRNA; by
suppressing this gene, synthesis of cytochrome b could be decreased
(88). Furthermore, cytochrome oxidase subunits 1 and 2 require
nuclear gene products for the processing and translation of their
transcripts ( 1 5 ) . An example of a nuclear encoded protein that
regulates mitochondrial function a t the level of assembly is
provided by the RCA 7 gene product. If this gene is mutated,
assembly of the ATPase subunits into a functional complex V is
prevented (89). As can be seen, there are rnany nuclear encoded
enzymes that are necessary for transcription of m t DNA's,
processing of precursor RNA's, and translation of mitochondrial
messages. In addition, RNA polymerase and almost al1 the proteins
that constitute the mitochondrial translational machinery are
encoded by nuclear DNA. An example of possible regulation by the
proton gradient in the IMS is given by the Qcr6 protein of the bc7
complex. In experiments where the QCRG gene was deleted, half of
the reduction sites of the dimeric bc7 complex were silenced.
Results of these studies suggested that under physiological
conditions when concentrations of ADP are low and ATP is abundant,
the increase in the positive charge surrounding subunit 6 may cause
it to regulate the complex so as to silence half of the reduction
sites and thereby downregulate the activity of the bel complex (46).
Do mitochondria exert reaulation on nuclear aene products?
All the above examples include regulation exerted by nuclear
genes on mitochondrial function and biogenesis. What about the
regulation of expression of nuclear genes by mitochondria? An
argument against the existence of such a regulation is that the
synthesis of PET products, nuclear genes required for the
morphogenesis o f respiratory competent mitochondria, is not
dependent on the presence of an intact mitochondrial genome (15).
Expression of many PET gene products is unaltered in p- and p o
strains, strains with large mitochondrial deletions or no mt DNA a t
all, respectively. Mitochondria of po cells can therefore be very
similar to wild type cells and can contain many functional enzyme
complexes.
Although not abundant, there is some non-specific evidence for
the regulation exerted by mitochondria on the nuclear genorne.
Experiments performed in N. massa suggested that treatment of
cells with chlorarnphenicol, an inhibitor of the mitochondrial protein
synthesis apparatus, increases the synthesis of some nuclear
encoded proteins that are part o f the mitochondrial transcription
and translation apparatus. This study may suggest that nit DNA
encodes a repressor protein that regulates nuclear genes (90). This
conclusion seems far-fetched and it is more probable that the
increase in synthesis of nuclear encoded proteins is the reponse t o
the lowered ATP levels in the cell. Another study ernployed
subtractive hybridization and indicated that some transcripts of the
nuclear genome Vary in abundance by a factor of five or more among
derepressed isochromosomal cells depending on whether they were
part of a p -, po, or mit- cell (91).
Pro tein import in to mitochondria
Localization of a protein into its correct compartment of the
cell is essential since mislocalization can lead to severe diseases.
Lysosomal storage disease, for example, in which degradative
enzymes are erroneously secreted into the bloodstream, results in
the accumulation of undegraded products in the lysosome. The
accumulation of glycosaminoglycans or glycolipids in the lysosome
is the cause for 1-cell disease (92). Another example of a disease
that can be caused by a targeting defect is primary hyperoxaluria.
This disease can sometimes be the result of erroneous targeting of
the peroxisomal enzyme L-a1anine:glyoxylate aminotransferase into
mitochondria.
As already mentioned earlier, only a srnall percentage of
mitochondrial proteins are encoded for by the mitochondrial gemme.
Hence, the vast majority of mitochondrial proteins are synthesized
on cytoplasmic ribosomes and must therefore be transported into
one of the four compartments of mitochondria, namely the OMM, IMM,
IMS, or matrix. Of the four final destinations in the mitochondrion,
import into the matrix is the best characterized. However, virtually
al1 mitochondrial precursors are initially imported by the same
machinery (Fig. 1-4; please refer t o this figure throughout this
section).
j m ~ o f t into the mitochondrial matrix
lmport into the matrix is the best characterized pathway. I t
constitutes the route into mitochondria for many precursors. Even
precursors with final destinations other than the matrix are often
imported into this cornpartment first, before being further
transported to their final destinations. The sequence of events is as
follows:
1. Precursors usually have an amino-terminal targeting
sequence (also referred to as signal-, leader-, transit-, or
presequence) that is recognized by cytosolic factors which
escort the protein to recepton in the OMM.
Fig. 1-4. lmport of proteins into the mitochondrial matrix, as adapted from Schatz (93). The precursor protein may bind to a cytosolic chaperone (MSF, mitochondrial import-stimulating factor, or hsp70) and then to the receptor (R) in the OMM which transports it to the protein import channel. Subsequently, the signal sequence of the precursor inserts itself into the protein import channel (which consists of TOM42, 8, and 6 in the OMM and TIM17, 23, and 6 in the IMM) and is pulled across the membrane by the mhsp70-GrpEp-TIM44 complex; translocation across the IMM requires an electrical potential across this membrane, AT. The mhsp70-GrpEp-TIM44 complex resides on the matrix side of the membrane and interacts loosely with the import channel in the IMM. Once in the matrix, the targeting sequence of the precursor is cleaved by the matrix processing peptidase (MPP). The precursor is most Iikely aided by the rnitochondrial chaperone hsp60-cpn10 complex in refolding and assembly in to a rnultimeric enzyme complex, if appropriate.
Precursor Protein
+++ y"'
ATP " "y&
IMM
2. Precunors bind proteinaceous receptors on the surface of
the OMM.
3. Receptors transport precursors t o translocation channels
which are opened by the signal sequence.
4. The precursor is translocated across the IMM by a protein
that is located on the matrix side of the membrane. Transport
across the IMM requires an electrical potential, acp, across the
membrane.
5. The protein folds on the matrix side of membrane with the
help of chaperones and its signal sequence is cleaved off.
Proteins that are part of a multimeric enzyme complex are
aided in their assembly by chaperones.
The taroetino seauence
Many, but not al1 mitochondrial proteins have an amino-
terminal targeting sequence that is cleaved on the trans side of the
membrane (94). Targeting sequences lack a consensus and up to 25%
of randomly generated peptides can function as mitochondrial signal
sequences (95). Nonetheless, there are some general features that
most matrix targeting signals have in common; they are 15-35
residues long, rich in hydroxylated and basic amino acids, and
capable of folding into an amphipathic a-helix (9% 94). Hence, signal
sequences display highly degenerate prirnary sequences, but their
common features result in a similar distribution of charged/polar
and hydrophobic residues. This common distribution of residues
results in the formation of an amphipathic helix which is essential
for the function o f signal sequences and renders them more
effective in targeting than randomly generated peptides.
Experiments in E. coli have shown that targeting sequences have two
functions; t o retard folding of the precursor, and t o recognize the
receptor on the membrane. Removal o f the signal sequence was
found to inhibit targeting by a factor of 100 to 1000 fold (96.97).
Some proteins of the IMS contain composite or bipartite signal
sequences. Cytochrome c l and the Rieske iron-sulfur protein of the
bc7 complex are two such examples. In these proteins the amino-
terminal part o f the leader sequence resembles the hydrophilic
matrix targeting sequence. The carboxyl half of the leader sequence
resembles a bacterial export sequence and is more hydrophobic than
its import counterpart (94).
osolic chaperones
Molecular chaperones are proteins that interact with non-
native conformations of other proteins such as mitochondrial
precursors. This interaction prevents aggregation o f the (often
newly synthesized) proteins until these have either folded correctly
or been transferred to a membrane receptor. There are two groups
of precursors, classified according t o their requirement for
extramitochondrial ATP (7. 9*v 99). The first group does not need ATP
for import into mitochondria and includes precursors of cytochrome
b r , holocytochrome c synthase, mitochondrial hsp60, and
dihydrofolate reductase fusion proteins. Hence, this group is
unlikely to interact with any ATP-requiring chaperones. The second
group of precursors is ATP-dependent and therefore is likely t o bind
to chaperones. This group includes alcohol dehydrogenase III,
cytochrome c l , the Flp subunit o f the ATPase complex V, and the
ADPIATP carrier. Two types of ATP-dependent cytosolic chaperones
have been identified t o date. MSF, or mitochondrial import-
stimulating factor, binds t o the signal sequence of a subset of
precursor proteins that have been released from the ribosome (7# 94).
Since this chaperone interacts specifically wi th mitochondrial
precursors, it most likely functions in escorting precursors to the
receptors in the OMM as well as in preventing aggregation. The
second type of ATP-requiring cytosolic chaperone is the cytosolic
heat-shock protein 70, hsp70 (98. 99). There are a t least two closely
related hsp701s in the cytosol of S. cerevisiae and they function
together with another protein called MAS5 or YDJ1 which stimulates
the release of precunor proteins from hsp70 (100). Hsp70 interacts
not only with mitochondrial precursors, but with a wide spectrurn of
non-native proteins targeted to different organelles and its function
is therefore not t o target but rather t o prevent aggregation and
misfolding (7. 94). Chaperones are important for maintaining proteins
in a partly unfolded state since most membrane systems can only
translocate proteins that are loosely folded (8. 101). Certain small
proteins that can spontaneously adopt a loose conformation, such as
the coat protein of the M l 3 phage, do not need the aid of chaperones
to maintain them in a transport competent state. However, most
large proteins and especially those with hydrophobic interiors
require the assistance of cytosolic factors (102).
Recentors in the OMM
Receptors in the OMM are mobile molecules that move within
the plane of the membrane and interact dynamically with the
translocation channel. Hence, one translocation channel could be
served by several different receptors whereby the function of the
receptors is most probably t o "trapu the precursor protein and to
transport it to a translocation channel. The receptors of the OMM are
integral membrane proteins with cytosolically exposed domains.
Depending on the type of receptor, it recognizes either the signal
sequence of a precursor protein or the precursor bound to a cytosolic
chaperone (94 ) . So far, four integral OMM proteins have been
identified in yeast that function as import receptors; these are
termed MASZO, MAS22, MAS37, and MAS70, consistent with their
molecular weights. MAS20 and MAS22 form a subcomplex that
contains a highly acidic region referred to as acid bristles. These
acid bristles are believed to bind the basic and amphipathic signal
sequence of precursor proteins in an ATP-independent manner.
MAS37 and MAS70 form a subcomplex that recognizes precursors
bound to the cytosolic chaperone MSF. Hence, this subcomplex most
likely recognizes the same features in the mature part of the protein
as the chaperone and this interaction also requires ATP. Due to the
dependency of MAS37-MAS70 on ATP, the group of precursors that is
preferentially imported by this subcomplex is prone to aggregation
and thus bound to cytosolic chaperones. As already mentioned above,
this group includes ADHIII, cytochrome c l , F$, and the ADP/ATP
carrier (7, 9, 103, 104).
It is not known whether the two subcomplexes function
separately or together and there are currently two different rnodels
regarding the association of the two receptor subcomplexes MASZO-
MAS22, and MAS37-MAS70. The first model suggests that they act
independently; hence for a given precursor the majority of that
precursor will bind preferentially to one of the subcomplexes. The
second model States that the two subcomplexes function in a joint
fashion whereby al1 precursors use the same pathway and several of
the receptor subunits are necessary for the recognition of one
precursor. Examples to substantiate the second model include the
irnport of ADHlll and FIP. Studies with these precursors found that
they are bound to both subcomplexes; the signal sequence is bound to
the MAS20-MAS22 subcomplex and the mature part of the protein is
bound to MAS37-MAS70. Another example is given by the ADP/ATP
carrier. Although this protein does not have an amino-terminal
signal sequence, but rather contains the targeting information
within i ts mature region, it was also found to bind to both receptor
subcomplexes. Since the MAS20-MAS22 subcomplex binds
precursors in an ATP-independent fashion, only precursors that are
imported in a manner that does not require extramitochondrial ATP
interact with this subcomplex. The two-hybrid systern was used to
show that the two subcomplexes associate loosely with one another
(los) and that the cytosolic domains of MASZO and MAS70 interact (7).
Deleting the genes encoding the receptors prevents transport
of different precurson to varying extents. Hence, a given precursor
may be presented to the membrane system by different routes
although it may have a preference for a certain receptor or receptor
subcomplex. Deleting the genes encoding receptor subunits MAS20,
MAS37, and MAS70, respectively, results in strains that are still
viable; however, deleting the genes encoding both MAS37 and MAS70
is lethal. MAS22 is the only subunit that is essential for viability
since deletion of this subunit alone is lethal. This finding may
reflect the fact that the acidic domain may bind the presequence,
and the fact that MAS22 spans the OMM and thus constitutes part of
the transport system across the OMM (7,941.
The translocation channel and the mitochondrial chaoerones
W hen conside ring the exposed charges of the mitochondrial
signal sequence and the hydrophilic side chahs of the partially
unfolded polypeptide, one may wonder how the protein can cross the
hydrophobic phospholipid bilayer. The answer is that the
translocating protein passes through a hydrophilic, hetero-
oligomeric transmembrane channel that is composed of integral
membrane proteins. How exactly this translocation takes place is
not understood, however, the channel is opened across the membrane
by the signal sequence. Lateral movement through the membrane is
mediated by the stop-transfer of signal-anchor sequences. lmport
channels span both the IMM and OMM and they are situated at "contact
sites" where the two membranes are in close contact with each
other. The channel in the OMM consists of approximately three
subunits; TOM42 (formerly called ISP42), an essential protein, as
well as TOM6 and TOM8. The channel in the IMM consists of TIM17
(formerly MIM17), TIM23, TIM6 (formerly MASG), and TIM44
(formerly MIM44 or ISP45). TIM44 is bound to mhsp70 on the trans
side of the membrane, and the latter in turn is bound to i ts CO-
chaperone GrpEp. The mhsp70-GrpEp-TIM44 complex interacts
loosely with the import channel in the IMM and operates as a
"translocation motor" that binds the emerging signal sequence and
"pulls" the precursor across the membranes. Translocation across
the IMM membrane requires intramitochondrial ATP and is dependent
on the electrochemical potential for most precursors (1 06-1 0).
Precursors that have been translocated into the matrix are
partially unfolded and have to be refolded in order to be able t o
assume their biological functions. Some small, monomeric proteins
have the ability to fold rapidly by themselves. However, others
require the help of mitochondrial chaperones ( y l l p 112). Hsp60 and
cpnl0 forrn a complex that operates in an ATP-dependent manner to
refold translocated proteins and assemble them into multimeric
enzyme complexes where appropriate. In addition, mhsp70 also aids
in the folding of proteins as well as in binding misfolded proteins
and delive ring them for degradation (1 3-1 6).
lm 1 The import pathway into the IMS, which can be reached by
several possible routes, is not well understood. Cytochrome c of the
cytochrome oxidase complex, for example, spontaneously inserts
itself into the OMM (l17) and is then pulled across the OMM by the
enzyme cytochrome c heme lyase which catalyzes the covalent
attachment of heme to cytochrome c in the IMS (6. 117). This protein
does not require the aid o f chaperones or receptors and is therefore
imported in a manner that requires neither ATP nor a membrane
potential.
A different route is taken by the precursors of cytochrome cl
and cytochrome bt which contain bipartite signal sequences, cieaved
in two steps (118, 119). There are currently two views concerning
how these proteins reach their final destination. In the first one, a
stop-transfer pathway, the proteins are transported across the OMM
and then become anchored t o the outer face of the IMM by their
signal sequence which is subsequently cleaved off. After rernoval of
the amino-terminal part of the leader sequence the proteins remain
bound to the outer face o f the IMM or are released into the IMS. The
carboxy half of the signal sequence thus functions as a sorting
signal that prevents transport of the intermediates into the matrix
and it is cleaved off by a peptidase in the IMS (118. lzo). The second
pathway is referred t o as the conservative route in which the
precursors are first irnported into the matrix where the signal
sequence is cleaved for the first time and where they interact with
hsp60 (1219 122) and mhsp70 (123). In this pathway, the carboxy-
terminal end of the signal sequence functions as an export signal
that resembles that o f bacteria and i t targets the intermediates
from the matrix across the IMM into the IMS. Additionai proteins
that are conservativeiy sorted include the ISP of the bcl cornpiex and
the ATPase subunit 9.
Cytochrome c heme lyase (CCHL) is sorted in yet a different
manner from cytochromes cl and b2. This protein does not contain a
presequence and is translocated selectively across the OMM by using
the import channel (124). CCHL is believed to be loosely folded after
synthesis since it does not require ATP or a membrane potential for
import and therefore does not interact with cytosolic chaperones.
lm-wrt into the IMM
There are two known routes for a protein if its destination is
the IMM, the "direct" route and the "detour" route (101). In the direct
route the protein is transported across the OMM and directly
inserted into the IMM from the IMS side. An example for this import
pathway is the ADP/ATP carrier (125). The import of the ADP/ATP
carrier requires extramitochondrial ATP, hence it probably interacts
with a cytosolic chaperone. lmport across the OMM is dependent on a
proteinaceous component on the surface of this membrane, most
probably a receptor, and the protein import channel. In addition,
insertion into the IMM requires a membrane potential. There is no
requirement for matrix ATP, an indication that the protein does not
pass through the matrix to reach its final destination in the IMM.
The detour route resembles the import pathway into the matrix
or the conservative pathway taken by some proteins of the IMS. In
this pathway, proteins are imported into the matrix first where the
matrix signal sequence is cleaved off; this import into the matrix
occurs in a manner that is dependent on receptor interaction, extra-
and intramitochondrial ATP and the membrane potential. Proteins
are then assembled with their partner subunits, if appropriate, and
inserted into the IMM from the matrix side. Proteins that follow
this indirect route include cytochrome oxidase subunit IV in yeast,
ATPase subunit 9, and the Rieske ISP of the bel complex (101, 1269
127).
jmwn into the OMM
lmport into the OMM is the simplest pathway, however the
mechanism of import is not well understood. Transport into the OMM
is receptor dependent for most proteins and occurs by direct
insertion of the protein into the membrane. Thus import into the OMM
requires extra-, but not intramitochondrial ATP; neither a membrane
potential nor intramitochondrial components o f the import
machinery are required (101. 128). It is therefore not understood how
transport into the OMM is energized. There is some preliminary
evidence t o suggest that proteins are driven across the membrane by
a two-step sequential binding. In the first step the presequence
associates with a receptor on the surface of the OMM and in the
second step, which drives the translocation of the protein across the
membrane, the precursor binds on the trans side of the OMM (lin 129).
Details about the signals that encode the pathway into the OMM are
unknown.
Objectives of the research
Abundant research has been performed on those subunits of
complex III that contain catalytic centers. On the other hand,
knowledge about the functions of the supernumerary subunits is still
limited. The Qcr7 protein was chosen as the focus of this study
based on the knowledge that subunit 7 is crucial for the functioning
of complex 111 (33). In addition, study of this subunit was appealing
because it constitutes the homolog to the fourth polypeptide of
prokaryotic bci complexes which consist of only four subunits: the
three catalytic subunits cytochrome b, cytochrome c or f , the Rieske
ISP, and the homolog t o the Qcr7 protein in yeast.
In this study I focused on the role of the amino-terminal
region of subunit 7. The N-terminus of subunit 7 is thought to face
the matrix side of the IMM in yeast (1301, and in the homologous
subunit of beef heart mitochondria (131). Because proteolysis of the
N-terminal seven amino acids of the beef heart mitochondrial
counterpart leads to a decreased H'/e- ratio, Cocco e t al . (131)
suggested that this subunit is involved in proton uptake from the
matrix w i th subsequent transfer of these protons t o the
hypothetical ubiquinone binding pocket a t center N. Since
proteolysis also resulted in a small amount of cleavage from the
Rieske ISP, it cannot be ruled out that the ISP is in fact responsible
for the decreased H+/e- ratio. Nevertheless, based on the available
information of subunit 7, 1 decided to investigate the function of the
Qcr7 protein with an emphasis on the amino-terminal region.
CHAPTER 2
Inactivation of the QCR7 Gene
A synopsis of the work presented in this dissertation has been accepted
for publication in The Journal of Biologieal Chemistry.
CHAPTER 2
Inactivation of the QCR7 Gene
2.1 . INTRODUCTION
The yeast Saccharomyces cerevisiae is an ideal eukaryotic
microorganism for the study o f biochemical pathways and is
frequently used as a model system for investigating the function of
proteins. Yeast have greater genetic complexity than bacteria.
However, they share many of the technical advantages that have
permitted rapid progress in the understanding of the molecular
genetics of prokaryotes. Some o f these advantages include the
availability of strains with multiple auxotrophic markers, rapid
growth, a well-def ined genetic system, a highly versatile DNA
transformation system, and the ability of the organism to exist both
in the diploid and haploid state. In addition, replica plating in yeast
can be used as a quick preliminary identification of mutants ( i 3 2 ) .
The ability of wild type yeast to grow aerobically and anaerobically
allows for the rapid preliminary identification of mutants defective
in aerobic growth and makes this organism very attractive for the
study of mitochondrial assembly and function.
Many genes have been inactivated in yeast and the resulting
phenotypes have contributed significantly toward understanding the
functions of proteins in vivo. All the genes encoding nuclear
subunits of ubiquinol-cytochrome c oxidoreductase (complex III or
bc, complex), including the QCR7 gene for subunit 7, have been
In this study I attempted to determine the precise function of
subunit 7 (the Qcr7 protein) by the expression of a series of mutated
Qcr7 proteins in the yeast S. cerevisiae. To accomplish this, I had to
first create a strain in which the chromosomal copy of the QCR7
gene was inactivated so that a Qcr7 protein is not synthesized. This
chapter describes the disruption of the QCR7 gene to create the
qcr7A:LEUZ allele-containing respiration deficient strain, YSM-
qcr7A, which was used for the expression studies outlined in the
following chapten.
2.2. MATERIALS AND METHODS
Ma terials
Saccharomyces cerevisiae strain W303-1 B (MA Ta, ade2- 7,
his3-71, 15, ura3-7, leu2-3, 712, trp7-7, can7-700), which was
used as the parent strain throughout this study, and the pJJ250
plasmid were kind gifts from Dr. Jim Friesen's laboratory (Hospital
for Sick Children, Toronto). The rho- strain (MATa, ural [rho-]
[ C X 1 R ES 1401) was purchased from ATCC (strain number 42209;
donated by Dr. L. A. Grivell, University of Amsterdam). Escherichia
coli strain JMED3 was obtained from Promega (Madison, WI).
Restriction enzymes, the T7 sequencing kit, and NlCK gel filtration
columns were purchased from Pharmacia (Montreal, PQ). All
materials for the preparation of yeast and bacterial media were
obtained frorn Difco (Toronto, ON) or ICN (Costa Mesa, CA). The pCR
II vector was purchased from lnvitrogen (San Diego, CA). All
remaining chernicals were purchased from Sigma (St. Louis, MO) or
BDH (Toronto, ON). Alkaline phosphatase-conjugated AffiniPure
rabbit anti-chicken IgY (IgG) (H+L) was obtained from Jackson
lmmuno Research Laboratories, Inc. (West Grove, PA). Random
primed labeling kits were from Boehringer Mannheim (Mannheim,
Germany), and Hybond-N' nylon membranes and radionucleotides
were from Amersham (Arlington Heights, IL). BiomaxTM MS x-ray
film was purchased from Kodak (Rochester, NY). Nitrocellulose
membranes were purchased from Mandel Scientific Company Ltd.
Serocluster vinyl plates used for ELISA assays were obtained from
Costar (Cambridge, MA). NBT (p-nitro blue tetrazolium chloride) and
BClP (5-bromo-4-chloro-3-indolyl phosphate-toluidine) were
purchased from BioRad.
2.2.1. Disruption of the chromosomal copy of the QCR7 gene
The QCR7 gene was amplified from genomic yeast DNA (136)
using primers corresponding to sequences upstream (5'-
c t g t a a t t a a a c g t t c c a g a a a g - 3 ' ) and downstream (5 ' -
cgggttgtgtgttcgtggtga-3') of the coding sequence. Amplification
was perforrned for 35 cycles with a denaturation time of 1 min a t
94<, an annealing time of 1 min a t 65oC, and a 1 min extension a t
720C. The PCR product was subcloned into the pCR II cloning vector
by using the 3' adenylic acid overhang created by Taq DNA
polymerase and giving pCR II-QCR7. Eight clones were used to
confirm the sequence and orientation of the insert by dideoxy chain
termination sequencing.
A Pvull fragment (2300 bp) containing the LEU2 gene was
purified from plasmid pJJ250 and blunt-end ligated into the Hincll
site of pCR II-QCR7 to give pCR Il-Aqcr7 in which the qcr7 gene is
disrupted by the LEU2-containing fragment. The vector pCR Il-dqcr7
was digested with Bgll and Apal to liberate the DNA fragment
containing the disrupted qcr7 gene (Fig. 2-1 ) . Ten micrograms of
digested DNA was used to transform yeast strain W303-1B (137).
Appropriate integrative transformation was confirmed by phenotypic
analyses and by Southern blot analysis of genomic DNA from Leu+
transformants.
1 acr7, LEM qcr7 C
KR II vector
a qcr7codng region
vector pJJ250
LEU-containing fragment
Fig. 2-1. DNA fragment used for disruption o f the chromosomaI QCR7 gene. The triangles represent the direction of transcription.
2.2.2. Confirming inactivation of the QCR7 gene
Selection of diploids
Diploids were obtained by inoculating YPD medium
simultaneously with cells from a rho- strain and cells from a Leu+
transformant containing the putative qcr7 gene disruption. The
culture was grown overnight, cells were washed twice with water,
diluted, and diploids were selected on SD medium lacking leucine and
containing glycerol and ethanol as the sole carbon sources.
Northern and Southern blotting
Total yeast RNA was prepared by growing a 25 mL culture
overnight, harvesting the cells and resuspending the pellet in 2 mL
of AE buffer (50 mM NaOAc, pH 4.8; 10 mM EDTA). The suspension
was vortexed after the addition of 200 pL of 10% SDS, and again
after the addition of 450 pL of phenol saturated with AE buffer. The
suspension was vortexed three times during a five minute incubation
a t 650C. The mixture was extracted with phenol-chloroform (1 : l )
and RNA was precipitated from the aequeous phase with 2.5 volumes
of ethanol. The pellet was washed with 70% ethanol, dried, and
resuspended in TE buffer (pH 7.0). For the Northern analysis, 30 pg
of RNA was precipitated with 2.5 volumes of ethanol-0.1 volumes of
5 M LiCI. The RNA pellet was dissolved in 5 IL of 25 mM EDTA-0.1 %
SDS. A DNA fragment encompassing the entire QCR7 coding region
(48) was amplified by PCR and subsequently radiolabeled with [a-
WPI~CTP using a random primed labeling kit; unincorporated
nucleotides were removed from the labeled probe by gel filtration
through a NlCK column. Northern blotting was performed as
described by Fourney e t al. (1 38). Following hybridization, the
membranes were washed twice a t 650C for 30 min in 2 x SSPE
(20xSSPE: 3 M NaCI, 0.2 M NaH,PO., 0.02 M EDTA, adjusted to pH 7.4
with Na0H)-0.1% SDS and subsequently exposed to x-ray film.
Ten micrograms of yeast genomic DNA, isolated as described
by Strathern and Higgins ( 136 ) , was digested with appropriate
restriction endonucleases and electrophoresed through a 0.6%
agarose gel. The DNA was denatured in 1 M NaOH for one hour and
subsequently transferred in this solution to a Hybond-Ne nylon
membrane as outlined by Sambrook e t al. (139). Prehybridization was
performed a t 420C for a minimum of four hours in 40% formamide-
1% SDS-Sx SSPE-0.5% skim milk powder and 250 rng/mL of
denatured, sonicated salmon sperm DNA. A DNA fragment containing
the QCR7 coding region was radiolabeled with [a-IPI~CTP as
described previously. Hybridization was carried out a t 42oC
overnight in a solution containing 40% formamide-1 % SDS-5x SSPE-
0.5% skim milk powder-10% dextran sulfate. Following
hybridization, membranes were washed twice a t 650C for 30 min in
2x SSPE-O. 1 % SDS and were exposed to x-ray film.
Isolation of yeast mitochondria
Cultures were grown for two days in SD media containing
different carbon sources. Mitochondria were isolated essentially as
outlined by Guthrie and Fink (140) with the substitution of breaking
buffer (0.6 M sucrose, 20 mM HEPES-KOH, pH 6.5, 0.1% BSA, 1 mM
PMSF) for mitochondrial isolation buffer. In short, cells were
pelleted, washed with water, and then prepared for cell wall
digestion by incubation a t 30C in 0.1 M Tris-SOI (pH 9.4)-10 mM DTT
at a concentration of (0.5 g cell wet weight)/mL. After this
preliminary incubation, cells were washed with 1.2 M sorbitol and
incubated again at 30.C for cell wall digestion in spheroplasting
buffer (1.2 M sorbitol, 20 mM KPi, pH 7.4) containing zymolyase
(Img/g cell wet weight) and PMSF ( 1 mM). Spheroplasts were
disrupted by homogenization with a Dounce steel homogenizer in
breaking buffer (0.6 M sucrose, 20 mM HEPES-KOH, pH 6.5, 0.1% BSA,
1 mM PMSF). Following disruption of the spheroplasts, mitochondria
were isolated by differential centrifugation (two rounds of 3,000~9
followed by 10,000xg whereby mitochondria are pelleted a t the high
speed spin). The purity of the mitochondria was determined by
measuring the specific activity of complex IV.
Western analysis
Following SDS-PAGE using gels containing 16% polyacrylamide,
proteins were transferred to nitrocellulose membranes for two
hours a t 5 5 volts a t 40C in l x running buffer (0.025 M Tris, 0.1 9 M
glycine) containing 0.1 % SDS and 20% methanol. Biots were
subsequently blocked for one hour with Blotto (10 mM Tris-CI, pH
7.5; 150 mM NaCI; 0.05% Tween 20) containing 2% gelatin, and then
incubated overnight with primary antibody in Blotto containing 1 %
gelatin. Membranes were washed 4x30 min in Blotto and then
incubated in Blotto containing 1% gelatin for one to two hours with a
rabbit anti-chicken antibody coupled t o alkaline phosphatase.
Membranes were washed 4x1 5 min in Blotto and proteins were
visualized using NBT and BClP as substrates in 0.1 M NaHC0,-1 mM
MgCl,.
2.2.3. Raising an antibody against the Qcr7 protein in
chicken
The following peptide from the carboxy-terminus of the Qcr7
protein was chosen as antigen and synthesized by the Alberta
Peptide Institute:
keyhole limpet hemocyanin-AAKEKDELDN IEVSK-COOH
Isolation of anti-Qcr7 antibody from rabbit and chicken
The above peptide which is conjugated t o keyhole limpet
hernocyanin a t the amino-terminus, was used to raise an antibody in
rabbit (performed by the Centers of Excellence, Canada) and in
chicken. To raise the antibody in chicken, 250 pg of the peptide was
solubilized in 500 p l PBS, mixed with an equal volume of Freund's
Complete adjuvant and injected into the chest muscle of a chicken.
Booster shots containing 250 pg of peptide solubilized in 500 pL PBS
and mixed with an equal volume of Freund's lncomplete adjuvant
were given one and two weeks after the initial injection. Antibodies
were purified from egg yolks starting two weeks after the second
booster injection.
Three egg yolks (50 mL) were aspirated through a syringe
(without needle) and diluted in three volumes of 0.1 M sodium
phosphate buffer, pH 7.6. One volume of a PEG8000 solution (0.1 75 g
PEG8000/mL of 0.1 M sodium phosphate buffer) was added. After 10
min the mixture was centrifuged a t 5000xg for 25 min at RT. The
resultant supernatant was filtered through 3 mm filter paper and
protein was precipitated by the adding PEG8000 (0.085 g/mL) and
incubating for 10 min a t RT. This suspension was centrifuged a t
5000xg for 25 min at RT. The pellet was dissolved in 2.5 volumes of
0.1 M phosphate buffer and proteins were precipitated by adding
PEG8000 (0.1 2 g/mL) and incubating for 10 min at RT. The
precipitate was recovered by centrifugation at 5000xg for 25 min at
RT and the pellet was dissolved in 0.25 volumes of 0.1 M phosphate
buffer and cooled to OoC on ice. After the addition of an equal
volume of cold 50% ethanol, the mixture was left on ice for
approximately four hours and then centrifuged a t 10,000xg for 25
min a t 4oC. The final pellet was dissolved in 0.25 volumes of 0.1 M
phosphate buffer and dialyzed overnight at 40C against 0.1 M
phosphate-0.1 5 M NaCl (pH 7.6). After the addition of 0.02% NaN3 as
preservative, the antibody-containing fraction was aliquoted and
stored a t -700C. The immune reactivity was tested by performing an
enzyme-linked immunoadsorbent assay (ELISA procedure was
devised by the Alberta Peptide lnstitute a t the Department of
Biochemistry, University of Alberta, Edmonton, Alberta).
2.3. RESULTS
Disruption of the QCR7 gene
As a first step in the study of mutant Qcr7 proteins, I
constructed a yeast strain in which the chromosomal QCR7 gene was
inactivated. The chromosomal QCR7 gene was replaced by
integrative transformation of a DNA fragment containing the qcr7
gene interrupted by the LEU2 gene (Fig. 2-1). lntegrative
transformation in yeast generally occurs by homologous
recombination, hence Leu' transformants could result not only from
replacement of the QCR7 gene by the qcr7:LEUZ sequence, but also by
recombination of the transforming DNA at the chromosomal leu2
gene; in addition, Leu+ transformants could result from random
recombination elsewhere in the genome. To eliminate the seléction
of a strain in which the qcr7:LEUZ fragment has recombined a t a site
other than the genomic QCR7 locus, I first carried out a phenotypic
analysis of the Leu+ transformants.
The QCR7 gene is required for respiration-dependent growth,
that is growth on non-fermentable carbon sources (33) . 1 therefore
patched Leu' transformants ont0 medium containing glycerol and
ethanol as carbon sources. Transformants that failed to grow on
this medium were pet - and therefore candidates for containing the
qcr7 gene disruption. However, mutations in the mitochondrial
genome can also lead to a pet- phenotype, hence I had to ascertain
that the respiration-deficient Leu+ transformants had a wild type
mitochondrial genome. This was performed by mating the Leu4
transforrnants with a rho- strain (a strain which contains large
deletions in its mt DNA) and testing the resulting diploids for their
ability to grow on ethanoVglycerol medium. Diploids that were able
to grow on this medium had to contain an intact mitochondrial
genome.
Finally Leu+, respiration-deficient transformants that
contained intact mitochondrial DNA were subjected to Southern blot
analysis to confirm that the QCR7 gene had been replaced by the
qcr7A:LEUP allele. A blot of genomic DNA was probed with an [a-
"PIdCTP-labeled DNA fragment encompassing the QCR7 coding region.
The hybridization pattern of DNA that had been digested with Hindlll
confirmed that a 2600 bp fragment containing a Hindlll site had
replaced the chromosomal QCR7 gene. Only one fragment containing
the uninterrupted QCR7 gene is seen in the lane containing DNA from
the parental strain, W303-1 B (Fig. 2-2, panel B, lane 1). This is as
expected since the QCR7 coding region does not have a Hindlll
recognition site (Fig. 2-2, panel A). On the other hand, in the lane
containing DNA from the mutant strain the large fragment is
replaced by two smaller fragments since the coding region of the
qcr7 gene was interrupted by the LEU2-containing fragment which
introduced a new Hindlll site (Fig. 2-2, panel B, lane 2). In summary,
the phenotypic and Southern analyses confirmed that I had obtained a
strain in which the chromosomal QCR7 gene had been replaced by the
qcr7d:LEUZ allele, thus creating the new strain YSM-qcr7A.
Fig. 2 - 2 . Southern blot analysis of the parental strain W303-1 B and strain YSM-qcr7~ with the qcf7d:LEU2 allele. Yeast genomic DNA (1 0 pg) was digested with Hindlll (refer to panel A) and electrophoresed through a 0.6% agarose gel. The DNA was denatured in 1 M NaOH and transferred to a Hybond-N* nylon membrane, followed by fixation of the DNA to the membrane by treatment with ultraviolet light (254 nm) for 10 min. Hybridization was carried out a t 420C with a fragment encompassing the QCR7 coding region that had been labeled with [a-"PIdCTP by a random priming method. Panel B: Lane 1; DNA from the parental strain, W303-1 B; lane 2; DNA from the strain containing the qcr7A:LEUP allele, YSM-qcr7A.
Hind II
Qm7 1 . 4 wiid type lows
Hin d l Il 2575 bp Hindi I I
0 no~codng regions iqstiearnanddownstrearn of chrmasomal QCR7gene
0 QCR7obding region
vector pJJ250
LEU'-containing fragment
Confirmation of the qcr7 gene inactivation
The DNA construct (Fig. 2-1) used to disrupt the QCR? gene
included the entire coding region of this gene. Hence, it is
conceivable that in the strain YSM-qcr7~ a fusion transcript
consisting of the 5' end of the qcr7 gene and the LEU2 gene is
synthesized which results in a fusion protein. Such a protein might
have a dominant negative effect. To rule out the presence of such a
fusion transcript, Northern blotting was performed. From Fig. 2-3 it
is evident that no such transcript is present in the lane containing
RNA from strain YSM-qcr7A (lane l ) , whereas a transcript of
expected size (approximately 680 bases) is present in the wild type
parental strain (lane 2). This indicates that a stable fusion
transcript is not synthesized and further substantiates the QCR7
gene inactivation.
An antibody was raised in chickens t o a carboxy-terminal
peptide of the Qcr7 protein. The antibody was purified from egg
yolks and the titer was compared t o that of pre-immune egg yolks by
means of an ELISA. The preimmune egg yolks did not react with the
peptide (the peptide being the same one that was used to raise the
antibody) used in the ELISA, whereas a substantial reaction of the
post-immune egg yolks could be seen with the peptide. The antibody
was authenticated by immunoblotting of SDS-PAGE fractionated
mitochondrial proteins (Fig. 2-4). A band o f expected size
corresponding to the 14.5 kDa Qcr7 protein is seen in the wild type
parental strain (lane 2). As anticipated, a Qcr7 protein is not
present in strain YSM-qcr7~ (lane l ) , which confirms that the
protein recognized &y the antibody is the Qcr7 protein rather than
another protein of similar size.
Fig. 2-3. Northern blot analysis of RNA isolated from the parental strain W 3 0 3 - 1 B and YSM-qcr7~. Northern blot of total RNA (30 pg) isolated from the parental strain W303-1B (lane 2) and strain YSM-qcr7a (lane 1) . Total RNA was separated on a 1% agarose gel containing 1.8% formamide and subsequently transferred to a nylon membrane. The DNA probe consisted of the QCR7 coding region which was radiolabeled with [a-"PIdCTP by using a random prirned labeling kit.
Fig. 2-4. Western blot analysis of mitochondrial protein from YSM-qcr7a and the parental strain W 3 0 3 - 1 B. Mitochondrial proteins (1 00pg) were dissolved in SDS-PAGE buffer containing D7T and heated for three minutes at 950C. Samples were run on a 16% polyacrylamide gel and then transferred to a nitrocellulose membrane. Blots were probed with a polyclonal antibody (dilution 1 :100) raised against a c-terminal peptide of the 1 4 kDa subunit. Lane 1 : protein from YSM-qcr7~; lane 2: protein from the wild type parental strain W303-1 B.
2.4. DISCUSSION
This chapter describes the inactivation of the QCR7 gene by
replacement of the functional chromosomal copy with a version of
the gene that was disrupted by the LEU2 marker. Since the qcr7 gene
was disrupted rather than replaced, I had to ensure that a fusion
protein was not synthesized. Northern blot analysis (Fig. 2-3)
demonstrated that a stable transcript or fusion transcript is not
synthesized. Western blot analysis indicates that a fusion protein
which contains an in frame fused Qcr7 protein C-terminus is not
synthesized either. Whether or not a fusion protein is synthesized,
that contains an out of frame fused C-terminal end of the Qcr7
protein, cannot be determined as the antibody epitope is located in
the C-terminus. However, it is extremely unlikely that such a fusion
protein would be functional and/or stable. Hence, the gene encoding
subunit 7 of the bci complex has successfully inactivated and the
newly created strain, YSM-qcr7A, which contains the qcf7A:L EU2
allele, was used for further analysis of the Qcr7 protein by site-
directed mutagenesis of plasmid-borne qcr7 genes.
Since recombination and gene conversion could occur between
the chromosomal gene and a plasmid-borne version of the gene, the
mutant strain was always propagated in a selective manner (lacking
leucine) when transformed with a version of the qcr7 gene on an
expression plasmid. This ensured that the chromosomal gene was
qcr7A:LEUZ. Reversion of YSM-qcr7~ back to wild type has not been
found to be a cause for concern.
CHAPTER 3
Mutagenesis of the QCR7 Gene
CHAPTER 3
Mutagenesis of the QCR7 Gene
3.1 . INTRODUCTION
With the QCR7 gene inactivation verified it was now possible
to proceed with in vitro mutagenesis of the gene and express the
encoded mutant Qcr7 proteins in the newly created strain, YSM-
qcr7A. This study focused on the amino-terminus of the Qcr7 protein
and three functions were investigated. The first was based on
studies performed on the bc, complex of beef heart mitochondria in
which the purified complex was solubilized and subjected t o
protease digestion. Proteolysis resulted in partial cleavage of some
or al1 of the following subunits, depending on the experimental
conditions: core protein 2, the Rieske iron-sulfur protein, the 6.4
kDa subunit, the 9.2 kDa subunit, and 7 to 11 residues from the N-
terminus of the 13.4 kDa subunit (the homologue of the yeast 14.5
kDa Qcr7 protein). When complex III was reconstituted into
phospholipid vesicles after proteolysis and tested for redox and
protonmotive activities, it was found that there was a significant
decrease in the H'/e- ratio. This decrease in the H+/e- ratio was
still present under conditions where the 13.4 kDa subunit had been
cleaved but, of the other subunits, only marginal cleavage of the
iron-sulfur protein had occurred. The authors concluded from this
observation that the amino-terminus of the 13.4 kDa subunit is
involved in binding protons from the matrix phase and in promoting
conduction of these protons t o the ubiquinone-binding pocket (131.
741). It was furthermore concluded that the amino-terminus of the
13.4 kDa subunit protrudes into the inner space of the phospholipid
vesicles since there was no proteolytic cleavage of this subunit
under conditions where the complex was inserted into phospholipid
vesicles prior t o digestion. This finding correlates with the
predicted topology of the 13.4 kDa subunit in vivo where it is
believed to be a monotopic protein that is bound t o the surface of
the IMM on the matrix side where it presumably interacts with the
membrane and other subunits of complex III (Fig. 3-1 ) (23. 65).
Similar to its beef heart rnitochondrial homologue, the N-terminus
of the yeast Qcr7 protein is also believed to be located at the matrix
side (66,130, 142).
The second putative role for the Qcr7 protein that I
investigated dealt with mitochondrial protein targeting and import.
The rnechanisms for mitochondrial targeting of the Qcr7 protein are
unknown. Of the nine nuclear encoded subunits of the ber complex,
five have been shown t o contain cleavable mitochondrial signal
sequences (2. 36-39, 43) of varying lengths: core proteins 1 and 2 have
cleavable signal sequences 1 7 and 1 6 residues long, respectively;
cytochrome cl and the ISP have bipartite signal sequences of 61 and
30 amino acids, respectively; subunit 6 has a presequence of 25
amino acids. Subunits 7, 8, and 9 only undergo cleavage of the
initial methionine and this is presumably also the case for subunit
10. Although the mechanisms of import o f several of the
components of complex III in yeast have been studied extensively,
I M S
IMM
Fig. 3-1. Helical wheelplots and folding pattern of the 13.4 kDa subunit of beef heart mitochondrial complex III; as predicted by Link e t al. (23). Hydrophilic regions are located in the matrix while helices are predicted to be located in the IMM. The amphipathic helix a t the immediate N-terminus is predicted to be located on the matrix side of the IMM.
nothing is known about how subunits 7, 8, and 9 are imported into
mitochondria.
Core protein 2 follows the general energy-dependent import
pathway into the matrix where its signal sequence is cleaved off (2).
It is not known how core protein 1 is imported, however, it most
probably follows the same pathway since it also contains a
cleavable signal sequence and its final destination is in the rnatrix
with a small fraction of the protein bound to the IMM. The ISP is
irnported into the matrix in a receptor and membrane potential-
dependent manner where its signal sequence is cleaved for the first
time. The protein is then exported t o the outer face of the IMM in an
energy-dependent manner and cleaved by a protease for the second
time (2. 42). There are currently two theories on the import pathway
of cytochrome c l : In the first one, a stop-transfer pathway, the
precursor is transported across the OMM and then becomes anchored
to the outer face of the IMM by its signal sequence which is
subsequently cleaved. After removal of the amino-terminal part of
the leader sequence the protein remains bound to the outer face of
the IMM or is released into the IMS. The carboxy half of the leader
sequence thus functions as a sorting signal in this pathway and
prevents passage of the intermediate into the matrix. Cytochrome ci
is cleaved for the second time by a peptidase in the IMS (118). The
second pathway is referred to as the conservative route and the
precursor is first imported into the matrix according t o the general
pathway where it interacts with hsp60 ( i l s ) and mhsp70 ( t z i ) . In
this pathway the carboxy terminal end of the signal sequence
functions as an export signal that resembles the bacterial export
signal and targets the intermediates from the matrix across the IMM
into the IMS.
As already mentioned, the Qcr7 protein does not contain a
cleavable amino-terminal signal sequence and it is not known which
pathway it follows t o reach its final destination in the IMM.
However, it probably follows the general matrix pathway, since it
requires extra- and intramitochondrial ATP as well as the membrane
potential for import (1 42). Furthermore, there is circumstantial
evidence that the Qcr7 protein does not follow the import pathway
of proteins without a cleavable signal sequence such as the
ADP/ATP carrier (143). In addition, subunit 7 is believed to assemble
into a subcomplex with cytochrome b and the 1 1 kDa subunit (33. 60).
Although it is not certain at present whether this subcomplex
assembles directly in the membrane or first in the matrix before
insertion into the IMM, the latter hypothesis seems to be favored
according to the findings of a recent study. Japa e t al. (142) have
shown that the Qcr7 protein is not bound to the membrane when
performing in vitro import studies with mitochondria from a strain
lacking cytochrome b. When performing the same experiment with
mitochondria from wild type yeast, however, the Qcr7 protein was
bound to the IMM through protein-protein interactions. Hence, the
formation of a subcomplex containing cytochrome b, the 14 kDa and
the 11 kDa subunits probably occun in the matrix and a targeting
sequence must therefore be contained in the Qcr7 protein. However,
it cannot be ruled out completely that the Qcr7 protein is imported
into the IMM without passing through the matrix and, in the absence
of cytochrome b, passes on to the matrix.
The third possible function for the Qcr7 protein that I
investigated was the role of the subunit 7 N-terminus in the
assembly of ubiquinol-cytochrome c oxidoreductase. Previous
studies indicated that deletion of the QCR7 gene resulted in low
steady-state levels of the ISP, cytochrome b, and the 1 1 kDa protein
(33. 60). Due t o a post-translational interdependence of cytochrome
b, the 14 kDa subunit, and the 11 kDa subunit, which has been
demonstrated a number of times, it is believed that a subcomplex
consisting of these three components is formed prior to assembly of
these subunits into a functional complex 111 (33. 60-63). The ISP does
not seem to be a component of this subcomplex since a mutant strain
containing a deletion of the gene encoding the ISP does not contain
lowered steady-state levels of complex III subunits other than the
ISP itself (60).
To test the involvement of the Qcr7 protein N-terminus in
proton pumping, rnitochondrial targeting, and assembly of complex
111, 1 mutated the QCR7 gene in regions corresponding to the
following residues (refer to Fig. 3-2). A previous study by lmoto e t
al. suggested that a number of serine and threonine residues of the
nicotinic acetylcholine receptor probably form a ring or hydrophilic
pore structure that comes into close contact with permeating
cations and may determine the selectivity of the channel (165). In
addition, a study performed by Yool and Schwarz also implicated a
role for serine and threonine residues in the formation of a K+
channel (166). Similarly, in solving the crystal structure of the beef
heart mitochondrial cytochrome oxidase Tsukihara e t al. found that
one of the channels involved in H+ pumping terminated a t two serine
residues that may be involved in hydrogen bonding (168). Based on
these studies and the knowledge that mitochondrial signal sequences
are enriched with hydroxylated residues (939 941, such residues in the
N-terminus were targeted for mutagenesis to investigate their role
in import and in the possible construction of a H+ channel. Since,
however, mutating Ser-4 and Thr-6 did not affect mitochondrial
import or H+ translocation, and since a protein with an N-terminal
truncation of 20 residues is imported into the mitochondria to the
same extent as a protein with a truncation of 7 residues, no
additional hydroxylated residues were mutated (see Chapter 4).
Four mutants with Qcr7 proteins truncated by 7, 10, 14, and 20
residues from the mature protein (that lacks Met-1, due to cleavage)
N-terminus were also tested for their role in H+ translocation, in
accordance with the results from the studies in beef heart
mitochondria. Since the yeast 14 kDa subunit contains a longer N-
terminal extension than i t s beef heart homologue, deletion of 20
residues was comparable to the proteolytic cleavage (7 to 11
residues) that occurred from the N-terminus of the beef heart
subunit (131, 141) (Fig. 3-2). Contrary to the studies performed in
beef heart mitochondria, the introduction of deletions into the
plasmid-borne QCR7 gene enabled me to study the involvement of the
.L L* .L * -L* + A
Y : E Q S F ~ S I A R I G D Y I L K S P V L S K L C V P V A N Q F I B: A G R P A V S A S S R W L E G I R K W Y Y
Y : N L A G Y K K L G L E F D D L L A E E u P I M Q T A L R R L P E D B : N A A G F N K L G L M R D D T I H E N D D V K E A I R R L P E N
* A * * * * * * + * * X -ic
Y: E S Y A R A Y R I I R A H Q T E L T H A L L P R N Q W I K F F Q E B : L Y D D R V F R I K R A L D L s M R Q Q I L P K E Q W T K Y E E
Fig. 3-2. Alignment of yeast Qcr7 protein and its 13.4 kDa homologue from beef heart mitochondrial cornplex III; adapted from Link e t al. (23). Y = yeast Qcr7 protein ( 1 4.5 kDa sobunit 7); 8 = beef heart 13.4 kDa subunit. * = conserved residues; + and - indicate conserved charges, and A indicates an exchange of one aromatic residue for another. Truncations of 7, 10, 14, and 20 residues from the N-terminus of the mature Qcr7 protein (which lacks Met-1) are indicated by arrows. Individual residues that were substituted as a result of mutagenesis are underlined.
Qcr7 protein N-terminus (in events prior t o and involving the
assembly of the complex) in vivo rather than in vitro.
The Qcr7p-~7 displays a phenotype that is comparable t o the
wild type a t 30°C. Hence, a number of point mutations were
introduced into the QCR7 gene in the context of a a7 deletion.
Arginine-10 was targeted for two reasons. The first one, is t o test
i ts involvement in mitochondrial targeting since arginines are
typical for mitochondrial signal sequences. The other reason for
mutating Arg-1 O, which was also the reason for mutating Asp-13,
was to find out whether these amino acids might be important for
assernbly by providing contact with another subunit through salt-
bridge formation. Full-length mutants containing Qcr7 proteins with
substitutions for Arg-1 O and Asp-13 were created to investigate
the possible role of these residues in import and assembly of the
Qcr7 protein.
Of the other substitutions shown in Fig. 3-2, substitutions in
Gln-31 were created t o test the earlier hypothesis that the Qcr7
protein is involved in ubiquinone-binding. Although this hypothesis
was later corrected in the literature, as it was based on a mistake,
mutants with Qcr7 proteins containing residue substitutions for
Gln-31 had already been tested for complex Ill-linked activities and
ATP synthesis and found to be normal. Hence. Gln-31 is most likely
not involved in ubiquinone-binding. Full-length mutants with Qcr7p-
N53S and Qcr7p-N53D were created t o investigate the pet-
phenotype of the mutant with the truncated protein Qcr7p-
~7(N53S/E116G). Residue Glu-1 1 6 was not assessed as a cause for
the pe t - phenotype as a previous study, in which a segment
containing this residue was replaced by three amino acids encoding
STOP codons in al1 reading frames, did not result in a respiration-
deficient mutant (49). However, the levels of apo-cytochrorne b, the
ISP, and the 11 kDa subunit are reduced in this mutant. In addition,
complex Ill-linked enzyme activities are reduced by approximately
40%, whereby the mutant enzyme retains a normal turnover number.
These findings of the study by Hemrika e t al. (49) implicate the Qcr7
protein C-terminus in assembly. All the other residue substitutions
arose fortuitously during mutagenesis and were also investigated
for causing phenotypes relevant to this study.
The current chapter describes the mutagenesis of the QCR7
gene followed by a prelirninary characterization of the mutant
strains according to growth and enzyme activities. In total, 22
different residues were substituted and they were changed to 38
different amino acids. In addition, four truncated proteins were
constructed which were missing the N-terminal 7, 10, 14, and 20
residues, respectively. The protein with the N-terminal truncation
of 7 residues was further subjected to point substitutions, whereby
a total of six such proteins were constructed, four of which were
multiple mutants. In total, 38 individual mutant proteins were
constructed and the strains expressing these were further analyzed.
A detailed analysis of the role of the Qcr7 protein N-terminus with
respect to proton pumping, mitochondrial import, and assembly of
complex III is given in Chapter 4.
3.2. MATERIALS AND METHODS
Ma terials
Oligodeoxynucleotides were synthesized by the Department of
Clinical Biochemistry a t the University of Toronto. Restriction
enzymes were purchased from Pharmacia. The T7 GEN in vitro
mutagenesis k i t was obtained from United States Biochemical
(Cleveland, OH). The pG-3 expression vector ( i l * ) was a kind gift
from Dr. Jacqueline Segall a t the University of Toronto. This vector
contains a 2p origin for replication in yeast as well as pUC18
sequences for replication in bacteria and ampicillin resistance.
Selection in yeast occurs by the TRP-1 gene marker. Expression of
the insert is driven by the glyceraldehyde-3-phosphate
dehydrogenase promoter and termination as well as polyadenylation
signals are from the phosphoglycerokinase gene.
Mutagenesis by PCR
Oligodeoxynucleotides were synthesized containing mutations
in codons for the N-terminal portion of the Qcr7 protein (Table 3-1)
and a Kpnl restriction site a t the 5' end. Together with a wild type
oligodeoxynucleotide downstream of the QCR 7 coding reg ion t o
which a Sall restriction site was added, mutant genes were
amplified using PCR as described in Chapter 2. The original pG-3
expression plasmid was modified by digestion with Sacl t o excise a
1700 bp fragment in the polylinker region and subsequently self-
ligated to create the new p G - 3 ~ vector. PCR products were digested
with Safi and Kpnl and then subcloned into the respective sites of
Table 3-1. Oligodeoxynucleotide sequences used for mutagenesis of the QCR7 gene. OIigodeoxynucleotides were designed with deletions or base substitutions in the QCR7 gene. Following PCR amplification or M l 3 mutagenesis, the wild type codon sequence was substituted by a sequence containing a deletion or a missense mutation. Abbreviations used are: n=a, c, g, t; z=a, c, t; x=a, c, g, and "/" stands for "or1'.
Table 3-1. Primen Used for Mutagenesis
I Primer Sequence (5'03')
ccggtaccatggcgazaattgg tgacP
gtcaccaattg/atcgcaatagacgu
ccggtaccatggcgagaattggtga/tgtatattttgaagtcacccP
ggtgacttcaaaatatactc/taccaattctcgM
tctgcatgatgggagattcctctgcaM Oligonucleotides used for mutagenesis by PCR. Oligonucieotides used for Ml 3 mutagenesis.
Mutat ion/s
Encoded
wild type for 3'end
A 7
A1 O
A1 4
A20
R101, K, T (67)
RI 01, T
D l 3E, V ( ~ 7 )
D13E, K
S4A, C, Dl G, H, L, Y
T6P, Q R, S
Q31L, S, WQ
N34SQ
N53iY
N53Sç
These mutations were introduced to test an earlier hypothesis according to which the Qcr7 protein was believed to be a ubiquinone-binding protein. However, this was a mistake in the literature which has since been corrected.
This residue was mutated to investigate the pet- mutant expressing Qcr7p ~7(N53S/E116G).
the pG-3a vector. lnserts were sequenced as described in Chapter 2.
Yeast strain YSM-qcr7~ was transformed as described by Hill e t al.
(137) with pG-3A plasmids containing mutated qcr7 genes.
Site-directed mutagenesis using the Ml 3 phage
Oligodeoxynucleotides were synthesized containing various
nucleotide changes (Table 3-1). M l 3 mutagenesis was performed
using the T7 GEN in vitro mutagenesis kit and al1 manipulations were
performed as suggested by the manufacturer. For this technique the
QCR7 gene was subcloned into the double stranded, replicative form
RFM13, of the Ml 3 phage. The QCR7 insert was subsequently used in
the single stranded form of the M l 3 phage as a template for
mutagenesis. In the in vitro mutagenesis, primers were annealed to
the template and extended by T7 DNA polymerase to synthesize a
second strand of the QCRP gene-containing M l 3 phage. During the
second strand synthesis, 5'-methyl dCTP was incorporated into the
new strand. This ensured that the newly synthesized, methylated
strand was preserved whereas the original strand was nicked by
treatment with Mspl and M a l and subsequently degraded by
exonuclease III. Following mutagenesis, single stranded phage DNA
was prepared and sequenced t o identify mutated qcr7 genes. Mutated
genes were subsequently isolated from the RFM13 phage (139) and
transferred to the modified yeast expression vector pG-3A. The pG-
3 ~ - g c r 7 plasmids were transformed into strain YSM-qcr7A (1 37).
Enzyme assays
Mitochondria were isolated frorn glucose-grown cells. NADH-
cytochrome c reductase (complexes I+III) and succinate-cytochrome
c reductase (complexes II+III) activities were assayed in 0.1 M
potassium phosphate buffer (pH 7.0)-94 pM cytochrome e l mM
sodium azide containing between 20 and 100 pg of mitochondria. To
start the reaction, 34.2 pM NADH or 10 mM sodiumsuccinate were
added as substrates, respectively, and the reduction of cytochrome c
was monitored spectrophotometrically a t 5 50 nm. Cytochrome
oxidase activities were assayed in 0.1 M KPi buffer (pH 7.0) with
reduced cytochrome c as substrate (94 PM). Reduced cytochrome c
was prepared by the addition of 3.2 mM ascorbate to a suspension of
oxidized cytochrome c (40 mg/mL) followed by dialysis against 0.1
M KPi for 48 h during which the buffer was changed twice.
Mitochondria (20-50 pg) were added to start the reaction and the
oxidation of cytochrome c was followed a t 550 nm. A number of
ubiquinol-cytochrome c reductase assays (complex III) were
performed to show that the observed succinate-cytochrome c
reductase and NADH-cytochrome c reductase activities were a true
reflection of the technically more difficult complex III assays. For
these assays decylubiquinol, which was prepared f rom
decylubiquinone by reduction with HCI, was used as the substrate in
0.1 M KPi-94 p M cytochrome c-1 mM azide (144).
Gro wth s tudies
Growth was tested on solid medium a t RT (20-230C), 30oC, and
370C. To identify respiration deficient mutants, cells were grown
on SD medium containing ethanol (4%) and glycerol (3%) as the main
carbon sources with the addition of a small amount of glucose
(0.1 46). Mutant strains that were p e t at 300C were picked and rnated
with a rho- strain for further selection by growth on SD medium
containing only the non-fermentable carbon sources glycerol and
ethanol. Respiration deficient mutants that contained mutations in
the mitochondrial genome failed t o grow under these conditions and
could thus be eliminated from the selection.
3.3. RESULTS
Characterization of mutants by gro wth
Mutant versions of the Qcr7 protein were assessed for their
ability t o support respiration-dependent growth. This was
performed by site-directed mutagenesis of the QCR7 gene using
either the PCR or M 1 3 mutagenesis technique (see Materials and
Methods) and the oligodeoxynucleotides listed in Table 3-1 . Plasmid-borne versions of the QCR7 gene were introduced into the
strain containing the chromosomal qcr7A:LEUZ allele, YSM-qcr7A,
and characterized according to their growth patterns at RT (20-
23oC), 30C, and 37oC on two types of solid media. Synthetic
deficient medium containing ethanol and glycerol as main carbon
sources with the addition of 0.1% glucose is typically used to
identify respiration deficient strains in yeast. Hence, respiration
deficient strains arising from mutated Qcr7 proteins that affect
complex III function grow on this medium until the small amount of
glucose is depleted, but only small colonies form which are referred
to as pet- mutants. Strains containing mutations in the qcr7 gene
which do not affect function, on the other hand, will grow to wild
type size colonies. Such strains can continue to grow by
catabolizing ethanol and glycerol once glucose has been depleted.
Similarly, respiration deficient strains remain white when grown on
SD medium containing glucose as the sole carbon source, while cells
with a functional respiratory chain assume a red phenotype. This
red phenotype is due to the ade2 mutation that is present in the
parental strain W303-1B and causes a red pigment to accumulate
(14s). In respiration deficient strains, however, this pigment does
not accumulate and the cells retain a white phenotype. Hence, p e t
strains can be clearly distinguished from wild type strains on the
basis o f their growth characteristics on these types o f media. The
growth characteristics of selected strains are shown in Fig. 3-3 and
the results of the analyses of al1 38 mutant strains are summarized
in Table 3-2. The strain expressing Qcr7p-67 had wild type growth
characteristics at RT and 30oC, but was p e t - a t 370C. This
conclusion was based on the observations that a t RT and 300C this
strain formed wild type shed colonies on SD medium containing
ethanol and glycerol as the main carbon sources (top panel) and the
colonies were red on SD medium containing glucose as the sole
carbon source (bottom panel). In contrast, the strains expressing
Qcr7p-~10, Qcr7p-dl4 and Qcr7p-A20 were respiration deficient at
al1 temperatures. These strains formed small colonies on the non-
fermentable carbon sources (Fig. 3-3, top) and the colonies were
white on glucose (Fig. 3-3, bottom). Strains containing Qcr7p-
~ 7 ( R 1 0 K ) and Qcr7p-~7(A9V/R1 OT/Y14N/N53D) behaved as did
Qcr7p-a7; that is, they were pet - at 370C but not a t RT or 300C. In
contrast, Qcr7p-~7(RI OT/K44N), Qcr7p-~7(RI OI/G1 ZV), Qcr7p-
~7(D13V) , and Qcr7p-~7(N53S/E116G) were pet- at al1 temperatures
tested. A t 370C, al1 mutants including proteins with an amino-
terminal deletion, even those which displayed wild type
characteristics a t RT and 300C, were respiration deficient. None of
the full-length genes containing point mutations were found t o
cause deficiencies at any of the three temperatures.
Fig. 3-3. Growth on SD agar plate with ethanol/glycerol and 0.1% glucose, or SD media plate containing glucose. Top: when grown primarily on the non-fermentable carbon sources ethanol and glycerol, the mutant strain containing the Qcr7p-~7 is comparable in size to the wild type. Mutant strains expressing Qcr7 proteins truncated by 10, 14, or 20 amino acids are pet- mutants, indicative of a respiratory chain defect. Bottom: when grown on SD medium containing glucose as the sole carbon source, respiration competent strains turn red due to the ade 2 mutation which causes a red pigment t o accumulate. Strains expressing Qcr7 proteins truncated by 10, 14, and 20 residues remain white, confirming severe respiration defects.
Enzyme activities
I next tested whether the strains expressing mutated qcr7
genes had functionai deficiencies o f ubiquinol-cytochrome c
oxidoreductase. For this experiment, I had planned to grow cells on
a carbon source such as galactose, raffinose, or maltose, since these
sugars do not lead to catabolite repression. I discovered, however,
that pet- mutants did not grow well on minimal medium containing
these sugars, presumably because they were too compromised.
Hence, I performed enzyme assays with mitochondria from cells
grown in glucose. This was less than ideal, since glucose resulted in
significant catabolite repression of the QCR7 gene and most likely
the genes encoding the other subunits of the bci complex. The
activity of complex III was drastically lower in glucose grown cells
relative to cells grown in galactose. Nonetheless, it was possible to
compare complex Ill-linked activities in mitochondria from glucose-
grown cells.
Complex III-lin ked enzyme activities were measured with
mitochondria purified from each of the mutants grown a t 300C.
Complex III was either measured in combination with complex 1,
using NADH as substrate, or in combination with complex i l , using
succinate as substrate. The results obtained from the enzyme
assays correlated with the results from the growth studies, i.e., al1
mutants that were characterized as pe t - mutants in the growth
studies, displayed a severe decrease in complex Ill-linked enzyme
activities. Cytochrome c oxidase activities were measured as a
control t o determine the integrity o f the mitochondria. I found that
in al1 pet- mutants cytochrome c oxidase activities were decreased
by about 40% when compared to the wild type. This decrease in
complex IV activity can be explained by a downregulation of the
expression of mitochondrial respiratory chain proteins due to a
respiratory chain defect. Results are summarized in Table 3-2.
Table 3-2. Summary. Characterization of mutants according to growth and enzyme activities. Growth was monitored a t three temperatures: RT, 30°C, and 37OC. Mutant strains carrying plasmid-borne versions of qc r7 are named according t o their mutations in the Qcr7 protein and are classified with regard t o whether they cause a pet- phenotype (pet) or not (+). Complex III- Iinked enzyme activities were measured and the mutants were divided into two classes. One class of mutants had wild type level enzyme activity (wt), and the activity of the other class was as low as in YSM-qcr7~ ( 0 ) . Complex IV enzyme activities from mutants were divided into two classes. One class had wild type activity (wt) and the other class had activity of about 60% that of wild type. Typical enzyme rates are: complex Ill-linked wild type, 30-35 +/-5 nmol min-' mg"; complex Ill-linked activities for YSM-qcr7A, O nmol min-' mg-'; complex IV activity of wild type, 125 +/- 11 nmol min-' mg-'.
MUTANT
A 7 R1 OK (~7) R1 OI/G72V (~7) R1 01 R I OT/K44N (~7) A9V/R1 OT/ Y74N/N53D (~7) R I OT D l 3V (~7) D l 3K D l 3E N53S/E 1 7 6G (~7) N53S N53D 11 0 $1 4 120 s4c 340 54G 34H 34Y 54WP2T 54G/E 7 O9G 54NL35P ;4y/17 7 v ;4G/P2Q r6P r6Q -6 R -6s 231 L 13 1 s 13 1 W C 7 7N WS/I 7 07V 4 9 v ! 78s 199N IO plasmid (strain YSM-qcr7a)
Italicized mutations arose for chain defect.
- RT
- + +
Pet +
Pet + +
Pet + +
Pet + +
Pet Pet Pet + + + + + + + + + + + + + + + + + + + + + + pet
30OC
- + +
Pet +
pet + +
Pet + +
Pet + +
Pet pet Pet + + + + + + + + + + + + + + + + + + + + + + pet
Complex III linked
act ivity wt wt
trace wt -
wt wt -
wt wt - wt wt - - -
wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt wt -
Complex IV activity
tousiyand were also tested for causing a respiratory
3.4. DISCUSSION
This chapter describes the introduction of a number of point
and deletion mutations into various regions of the QCR7 gene with an
emphasis on the portion corresponding t o the Qcr7 protein amino-
terminus. These mutant genes, contained in an expression vector,
were subsequently expressed in yeast and the phenotype of the
resulting strains was assessed. Classification o f al1 mutants
according to growth and enzyme activities divided them into three
categories: mutants with wild type characteristics, mutants that
resemble strain YSM-qcr7~, a n d mutants that had wild type
characteristics a t RT and 30oC and characteristics like YSM-qcr7~ a t
37°C (Table 3-2). Notably, neither the strain expressing Qcr7p-~7,
nor any of the strains containing full-length Qcr7 proteins with
point mutations were deficient at 3OoC. However, strains
expressing deletion proteins Qcr7p-Al O, Qcr7pA14, and Qcr7p-a20
as well as Qcr7p-A 7(Rl OT/K44N), Qcr7p-b7(R1 OI/G12V), Qcr7p-
~7(D13V), and Qcr7p-b7(N 5 3 S/E1 1 6G) were respiration-deficient a t
al1 temperatures tested.
Many mutants displayed the inability t o grow in media
containing non-repressive carbon sources such as galactose,
raffinose, or maltose. When yeast are grown on high levels of
glucose, many respiratory chain related proteins suffer catabolite
repression; this means that the uptake systems of sugars other than
glucose are repressed (Z 15). ln order to compare results between
wild type and mutants, al1 strains had t o be grown in the same
medium, hence this medium had to contain glucose as the carbon
source. Unfortunately, I found that growing the cells on glucose
resulted in a significant catabolite repression of the QCR7 gene.
This was evidenced by a lower level of the QCR7 RNA transcript in
glucose-grown cells as opposed to galactose-grown cells (results
not shown). Catabolite repression of the QCR7 gene also led t o
lowered complex Ill-linked enzyme activities; this might indicate
that al1 or some of the genes encoding the other subunits of the bci
complex are also repressed.
As can be seen from the results summarized in this chapter,
despite 50 mutations that were introduced into the QCR7 gene only
very few resulted in a respiration defect. In addition, none of the
full-length Qcr7 proteins containing point mutations resulted in a
deficiency. It might therefore be more instructive to target highly
conserved residues in the future, especially with the use of a recent
cornparison of homologues to the Qcr7 protein from a wide variety of
organisms (146). Alternatively, it might be more successful to "work
backwards"; for example, one could select for respiration-deficient
mutant strains on non-fermentable carbon sources following random
mutagenesis of the QCR7 gene. A random mutagenesis approach was
not used for this study as I was particularly interested in
determining the function of the Qcr7 protein amino-terminus with
respect to proton translocation, mitochondrial import, and assembly
of complex III (see Introduction of this Chapter). In addition,
truncation of seven residues from the N-terminus of the Qcr7
protein resulted in the same phenotype, but a different profile of
subunits from the wild type and indicated that the N-terminus is
essential. This prornpted me to concentrate on the amino-terminus.
lmmunoblotting established that deleting as many as 20
residues from the Qcr7 protein N-terminus did not prevent this
subunit from being imported into mitochondria (results shown in
Chapter 4). Hence, the preliminary analysis of the respiration-
deficient mutants described in this chapter indicates that the
amino-terminus of the Qcr7 protein is essential for the functioning
of ubiquinol-cytochrome c oxidoreductase. A detailed
characterization of the role of the Qcr7 protein amino-terminus in
assembly of complex III, proton pumping, and mitochondrial import
is given in Chapter 4.
CHAPTER 4
The Role of the Amino-terminus
of the Qcr7 Protein in
Mitochondrial Targeting,
Complex I I I Assembly,
and
Proton Pumping
Contribution to this chapter:
Joses Jones perforrned the immunoblotting of figure 4-7.
CHAPTER 4
The Role of the Amino-terminus of the Qcr7 Protein in
Mitochondrial Targeting, Complex III Assembly, and Proton
Pumping
4.1 . INTRODUCTION
The mutational analysis described in Chapter 3 indicated that
the amino-terminus of the Qcr7 protein is essential for formation of
a functional complex III. Hence, with some pet - mutants now
identified I proceeded to test whether the amino-terminus of the
Qcr7 protein is involved in mitochondrial targeting and/or assembly
of ubiquinolsytochrome c oxidoreductase.
The involvement of the Qcr7 protein amino-terminus was also
investigated with respect to proton translocation. This hypothesis
was tested by indirectly measuring the integrity o f the proton
gradient which is only established under conditions where electron
transport is functional. Hence, only strains which contained a fully
or partially functional enzyme cornplex were tested; these included
strains expressing Qcr7 proteins with mutations in Pro-2, Ser-4,
Thr-6, and Ile-11, as well as the strain expressing Qcr7pA7.
4.2. MATERIALS AND METHODS
Ma terials
Chemicals were purchased from Sigma (St. Louis, MO), BDH
(Toronto, ON), or BioRad (Hercules, CA). Dodecylmaltoside was
purchased from Boehringer Mannheim (Mannheim, Germany), and
dithiobis(succinimidyl propionate) (DSP) from Pierce (Rockford, CT).
Restriction enzymes and protein A sepharose were obtained from
Pharmacia (Montreal, PQ). Anti-Qcr7 protein antibodies used for
immunoprecipitation were raised in chickens and rabbits against a
carboxy-terminal peptide of the protein (refer t o Chapter 2).
Antibodies raised against subunits of the bel complex were a kind
gift from Dr. Bernard L. Trumpower a t Dartmouth Medical School. An
antibody t o yeast S-acetyl coenzyme A synthetase was raised in
rabbit by the Centers of Excellence (Canada). Goat anti-mouse IgG
(H+L) coupled to alkaline phosphatase and goat anti-rabbit IgG (H+L)
coupled t o alkaline phosphatase were purchased from BioRad.
Alkaline phosphatase-conjugated AffiniPure rabbit anti-chicken IgY
(IgG) (H+L) was purchased from Jackson lmmuno Research
Laboratories, Inc. (Westgrove, CT). BioMag magnetic beads were
obtained f rom Perseptive Diagnostics (Cambridge, MA).
Isolation of yeast mitochondria and Western analyses
Mitochondrial isolations and Western analyses were
performed as outlined in Chapter 2.
A TP synthesis assays
Freshly prepared mitochondria (approximately 50 pg) were
resuspended in 200 PL breaking buffer (0.6 M sucrose, 20 mM HEPES-
KOH, pH 6.5, 0.1% BSA) without PMSF. To start the reaction, the
mitochondria were added to 5 mM KPi (pH 7.41-1 mM ADP-5 mM
succinate. The mixture was incubated at 370C for 45 min and the
reaction was stopped with 80 mM perchloric acid. Proteins were
pelleted and the supernatant was assayed for the amount of ATP
synthesized by using a hexokinase/gIucose-6-phosphate
dehydrogenase coupled assay (147) in which NADPH is generated.
NADPH was quantitated in an Eppendorf fluorimeter.
C W a r Dichroism spectra
Peptides were chosen from the N-terminus of the Qcr7 protein
in yeast and its homolog in beef heart and synthesized by the Alberta
Peptide Institute:
AGRPAVSASSRWLEG (residues 2-1 6, beef heart subunit 6;
peptide 1 );
AGRPAVSASSRWLEGIRKWYYNAAG (residues 2-26, beef heart
subunit 6; peptide 2);
PQSFTSIARIGDY (residues 2-1 4, Qcr7 protein; peptide 3);
PQSFTSIARIGDYILKSPVLSKL (residues 2-24, Qcr7 protein;
peptide 4).
For recording CD spectra, peptides were dissolved at 1 mg/mL in
either 10 mM NaCI-10 mM NaH2P04, methanol, or SDS (30-fold molar
excess) diluted in the above buffer. Spectra were recorded on a
Jasco J-720A spectropolarimeter, each with two to three scans
from 250 to 190 nrn a t 250C. Baseline spectra for each solvent were
subtracted from the peptide spectra.
Spectra of the cytochromes
For spectral analyses of the cytochromes, rnitochondria were
resuspended in 0.1 M potassium phosphate (pH 7.4)-0.25 M sucrose-
0.5% cholic acid (33). TO obtain a spectrum containing cytochromes c
and c l , cytochrome b, and cytochromes a and a,, a ferricyanide-
oxidized spectrum was subtracted from a dithionite-reduced
spectrum. To obtain a spectrum containing cytochrome b only,
dithionite-reduced minus ascorbate-TMPD (0.2 mM) reduced samples
were run. Spectra were recorded on a DW-2a Aminco
spectrophotometer from 520 to 620 nm.
Co-immunoprecipita tion
Different immunoprecipitation protocols were performed with
various combinations of the buffers and procedures listed below.
When the anti-Qcr7 antibody raised in chicken was used as the
primary antibody, magnetic beads had to be employed since Protein A
Sepharose does not bind chicken lgG. On the other hand, when
imrnunoprecipitations were performed with the anti-Qcr7 antibody
raised in rabbit, protein A sepharose was employed as the matrix to
bind the primary antibody. lmmunoprecipitated proteins were
analyzed by immunoblotting under both reducing and non-reducing
conditions.
Buffen: a) NET-gel buffer (50 mM Tris-CI pH 7.5, 150 mM NaCI, 0.1 %
Nonidet P-40, 0.25% gelatin, 1 mM EDTA pH 8.0, 0.02% sodium
azide), containing 0.05% to 1% Nonidet P-40 (139)
b) 50 mM Tris-HCI (pH 8), 1 mM MgS04, 0.5 mM PMSF, 0.8 g
dodecylmaltoside/g protein
c) 250 mM sucrose, 1 mM EDTA (pH 8), 10 mM MOPS-KOH (pH
7.2) , 60 mM KCI, 0.5 mM PMSF, 0.7% digitonin
d) 50 mM Tris-HCI (pH 8), 1 50 mM NaCI, 1 mM EDTA (pH 8),
0.25% gelatin, 0.5 mM PMSF, 0.8 g dodecylmaltoside/g
protein
e) 5 0 mM Tris-HCI (pH 8), 1 50 mM NaCI, 5 mM EDTA, 0.5
mM PMSF, 0.8 g dodecylmaltoside/g protein
Procedures;
A) Preclearing: mitochondria (100-200 pg) solubilized in one
of the above buffers, were incubated with a) pre-immune serum, or
b) rabbit-anti-yeast S-acetyl coenzyme A synthetase a t 0°C for
approxirnately 60 min. Subsequently, protein A sepharose or
magnetic beads were added and the suspension was incubated for
another 30 min a t O°C. Beads were pelleted, and the supernatant
fraction was used further for imrnunoprecipitation.
Immunoprecipitation: mitochondria-containing supernatant
(from above) was rotated a t 0°C with varying concentrations of
anti-Qcr7 protein antibody. Subsequently, protein A sepharose or
magnetic beads (coupled to rabbit-anti-chicken antibody), were
added and the suspension was rotated at 4°C for 1 h. The beads were
pelleted and washed three times with buffer by rotating for 20 min
during each wash. After the final wash, al1 o f the liquid was
removed from the beads which were subsequently resuspended in 30
pL of SDS-PAGE buffer with or without DlT, heated for 3 min a t
95°C and analyzed by immunoblotting.
B) Mitochondria solubilized in one of the above buffers (5
rng/mL) were incubated on ice for 10 min, centrifuged a t 4*C for 10
min in a microcentrifuge to remove insoluble materials, and
transferred to Protein A Sepharose beads/BioMag magnetic beads.
Subsequently, the volume was increased t o 1 mL and the
mitochondria-bead suspension was rotated for 1 h a t 4°C to reduce
the concentration of proteins in the suspension which bind the
matrix in a nonspecific manner. The beads were pelleted and the
supernatant was transferred to a new bead suspension, after which
the primary antibody was added and the suspension was incubated
overnight with rotation a t 4°C. Samples were washed three times in
buffer, beads were resuspended in 2 x SDS-PAGE buffer not
containing DTT and analyzed by immunoblotting.
Cross-linkina: -
Mitochondria (200 pg) were resuspended in 450 pL breaking
buffer (pH 8.0) containing 0.5 mM PMSF and 10 mM iodoacetamide.
The cross-linking agent DSP was added from a 500 mM stock in dry
DMSO to a final concentration of 0.28 mM, the suspension was
incubated on ice for 20 to 30 min, and the reaction was terminated
with 5 0 pL of 100 mM glycine containing 10% aprotinin.
Mitochondria were pelleted and washed once with breaking buffer
containing 0.5 mM PMSF. lmmunoprecipitations using procedure (B)
with various buffers from the list above followed the cross-linking
procedure devised by Dr. David B. Williams at the University of
Toronto. lmrnunoprecipitated proteins were analyzed by
immunoblotting (as described in Chapter 2) under reducing and non-
reducing conditions.
4.3. RESULTS
Circular Dichroism spectra of amino-terminal peptides
Link e t al. (23) have previously suggested that the N-terminus
of the 13.4 kDa subunit 6 of complex III from beef heart
mitochondria forms an amphipathic a-helix. To confirm this
helicity, and t o compare the yeast N-terminus of the Qcr? protein to
i ts homologue in beef heart mitochondria, two peptides
corresponding to amino acids 2-16 and 2-26, respectively, for the
bovine sequence and 2-1 4 and 2-24, respectively, for the yeast
sequence were synthesized (see Methods section).
CD spectra were obtained for al1 four peptides in diluted saline
buffer, methanol, and SDS micelle suspension in saline buffer (Fig.
4-1). All peptides formed only a Iimited amount of secondary
structure in aqueous buffer. However, as shown in Fig. 4-1 (middle
panels, top and bottom) by the minima at 208 nrn and 222 nrn which
are characteristic for a-helix formation, peptides 2 (long beef heart
peptide) and 4 (long yeast peptide) display considerable a- he l i x
content in methanol. In SDS micelles, the secondary structure of
peptides 2 and 4 are similarly a-helical. Spectra and helical
content of peptide 4 strongly resemble that of peptide 1 (shon beef
heart peptide, spectra not shown). This indicates that although the
N-terminal regions of the yeast and beef heart proteins are not very
similar (due to the increased length of the yeast N-terminus), they
nevertheless display similar secondary structures. Peptide 3 (short
yeast peptide), on the other hand, did not display any a-helix
Fig. 4-1. Circular Dichroism spectra. Peptides corresponding t o amino acids 2-26 of the beef heart 13.4 kDa subunit (peptide 2) and amino acids 2-24 of the yeast 14.5 kDa subunit (peptide 4) were assayed for secondary structure by CD. Peptides were dissolved a t a concentration of 1 mg/mL in buffer (1 0 mM NaCI-10 mM NaH2P04), methanol, or SDS (to a 30-fold molar excess diluted in above buffer). Spectra were recorded a t 250C on a Jasco J - 7 2 0 A spectropolarimeter. The y-axis represents the mean residue molar ellipticity which contains the units [deg cm2 dmoïl]. Top three panels, beef heart peptide 2; bottom three panels, yeast peptide 4.
2 4 ' A 4
iu ô g g g b b 0 0 0 0 0 0 ~
T ' T Y Y ' + + T ' O O O O O O O O N N N N O W
formation in water, methanol, or SDS (not shown). This indicates
that although many peptides display helical spectra in SDS
independent of their role in vivo, one can a t Ieast conclude from
these experiments that the peptides involved possess the intrinsic
capability ("threshold hydrophobicity" coupled with residue-
dependent helical propensity) to penetrate membranes and form
stable secondary structures (1 48).
The amino-terminus o f the Qu7 protein may facilita te import into
mitochondria
Many nuclear encoded mitochondrial proteins possess targeting
sequences, 15-70 amino acids long, that are usually located a t the
N-terminus. Some proteins such as cytochromes c, and b2 even have
bipartite signal sequences that are cleaved in two steps (12& 149).
Mitochondrial targeting sequences have no obvious homology, but are
generally rich in hydrophobic and hydroxyla ted a mino acids, have a
net positive charge, and are able to forrn amphipathic a-helices
when in contact with the lipid bilayer (6. 50. ' s i 1.
The Qu7 protein does not contain a cleavable N-terminal
mitochondrial targeting sequence (21, but according to Sirrenberg e t
al., it is also unlikely to follow the import pathway used by proteins
without a cleavable amino-terminal signal sequence such as the
ADP/ATP carrier (143). Since the Qcr7 protein N-terminus contains
many residues that are typical of mitochondrial signal sequences,
and since CD spectrophotornetry of an N-terminal peptide has shown
that there is a potential for forming an a -helix (Fig. 4-1) with
Fig. 4-2. Helical wheel projections. The amino-terminal 18 residues (starting after Met-1) are plotted. a) Wild type; b) Qcr7 protein truncated by residues 2-8 from the N-terminus. A helical wheel projection of the wild type shows that al1 the charged and most of the polar residues are located on one face of the helix, whereas the majority of the hydrophobic residues are located on the opposing face. A helical wheel projection of the Qcr7p-a7 shows that charged residues are located on one face of the helix whereas hydrophobic and polar residues are interspersed throughout.
amphipathic character for the wild type (Fig. 4-2), 1 decided to
investigate whether this region contains any information for the
mitochondrial localization of the protein. Accordingly, I tested the
mutants expressing Qcr7p-A7, Qcr7p-Al O, Qcr7p~14, and Qcr7pa20
(see Chapter 3, Fig. 3-2) for the presence of their respective
truncated Qcr7 proteins in the mitochondria. Mitochondria were
purified from YSM-qcr7A strains grown a t 30°C, each of which
expressed one of the above truncated proteins. Western blot analyses
of these mitochondrial proteins revealed that Qcr7 proteins lacking
7, 14, and 20 N-terminal amino acids are synthesized and
transporteci into mitochondria (Fig. 4-3, lanes 1, 2, and 4). However,
it was consistently found that the levels of truncated Qcr7 proteins
were reduced by approximately 60% when compared to the Qcr7
protein from the strain overexpressing the wild type gene (Figs. 4-3
and 4-4). These lower steady-state levels of the Qcr7 proteins
truncated by 7, 14, and 20 residues might be the result of a-helix
formation (if indeed they form a-helices) with compromised
amphipathicity as shown for Qcr7p-A7 (Fig. 4-2). Amphipathic
helices contain charged and polar residues on one face of the helix
and hydrophobic residues on the other. While this rule holds true for
the first 18 residues (after Met-1) of the wild type N-terminus, the
amphipathicity of Qcr7p-~7 (the N-terminus corresponds to residues
9 t o 26 of the wild type sequence) is compromised with hydrophobic
and charged residues interspersed throughout the helix (Fig. 4-2). In
addition, deletion of seven or more residues from the Qcr7 protein
N-terminus (after Met-1) results in the loss of the three
hydroxylated residues Ser-4, Thr-6, and Ser-7. Decreasing the
320 ~7 KO WT Core 1
- 0 .- - - - Core 2
Fig. 4-3. Western blot analyses of mitochondrial proteins from YSM-qcr7~ s t r a i n s overexpressing wild type and N- terminally truncated proteins Qcr7p-~7, Q c r 7 p - ~ l O, Qcr7p 61 4, Qcr7p-820. Mitochondrial proteins (100pg) were dissolved in SDS-PAGE buffer containing D l T and heated for 3 min a t 950C. Samples were run on 16% polyacrylamide gels and then transferred to nitrocellulose membranes. The blots on the top and middle panels were probed with an antibody recognizing core proteins 1 and 2, intermediate (i-ISP) and mature ISP (ISP), the 11 kDa and 14 kDa subunits. The blot containing cytochrome cl, on the bottom panel, was probed with a monoclonal antibody raised against this subunit. Top panel: Lane 1 : protein from YSM-qcr7~ overexpressing Qcr7p- ~ 2 0 ; Lane 2: protein from YSM-qcr7A overexpressing Qcr7pd7; Lane 3: protein from YSM-qcr7A; Lane 4: protein from YSM-qcr7A overexpressing wild type Qcr7 protein. Middle and bottom panels: Lane 1 : protein from YSM-qcr7A overexpressing Qcr7p-A 14; lane 2: protein from YSM-qcr7~ overexpressing Qcr7p-A20; lane 3: protein from YSM-qcr7~ overexpressing Qcr7p-Al O; lane 4: protein from YSM-qcr7a overexpressing Qcr7p-~7; lane 5: protein from YSM- qcrïA; lane 6: protein from YSM-qcr7~ overexpressing wild type Qcr7 protein.
% WILD TYPE 9) % WILD TYPE -
w % WILD TYPE w % WILD TYPE
Panel II. Number of blots used for histogram determinations
Subunit
14 kDa 11 kDa al1 ISP m-ISP a11 cyt cl m- cyt cl core 1 core 2 - - - 1 - -
* Due to faint bands on some of these blots, accurate quantifications could not be performed for these samples by densitometry. The numbers indicated reflect the number of blots inspected visually. The levels of 11 kDa subunit in the various mutant strains are as follows: WT, ~ 7 , R I OK > A I 4, 420 > D l 3V > R l OVG12V > AI 0, KO. # These nurnbers reflect the number of blots inspected visuatly (due to uneven running of the gel).
Fig. 4-4. Quantification of Complex III subunits in various Qcr7 mutant strains by densitometry. Panel 1: Histograms were constructed by averaging the density of each subunit from a number of blots (see table on panel I I ) . The density is expressed as a percentage of the respective subunit compared to the overexpressed wild type of each blot. a) Histogram representing quantitation for the 14 kDa and 1 1 kDa subunits. Error bars correspond to the standard error. Where error bars are not shown, the standard error is too small to be visible. b) Histogram representing quantitation for the mature ISP (m-ISP) and combined intermediate and mature ISP (al1 ISP). Error bars correspond to the standard error. Where error bars are not shown, the standard error is too small to be visible. c) Histograrn representing quantitation for mature cytochrome c, (m-cyt c,) and combined intermediate and mature cytochrorne c, (al1 cyt c,). d) Histogram representing quantitation for core protein 1 (core 1 ) and core protein 2 (core 2).
amphipathicity and eliminating these hydroxylated residues removes
some of the important features that are typical of mitochondrial
signal sequences. This could account for the lowered steady-state
levels of Qcr7 proteins seen in mitochondria isolated from strains
expressing the truncated versions of this subunit. Western blot
analyses of mitochondria which were treated with proteinase K
revealed that the mutant proteins were properly located inside the
mitochondria. It cannot be ruled out, however, that the observed
lowered levels of mutated Qcr7 proteins are due to degradation of
these proteins as a result of misfolding or a defect in assembly (see
"Future Directions" in Chapter 5).
Yeast overexpressing Qcr7p-al O do not contain any detectable
levels of the 14 kDa protein in the mitochondria although a band
migrating slower than the expected Qcr7 protein can be seen (Fig. 4-
3, lane 3). I t is unlikely that this band corresponds to an aberrantly
running Qcr7p-al O, however, since a faint band of the same size can
be visualized in lanes 6 and 7. In addition, blots performed with a
different antibody, which among other subunits also recognizes the
Qu7 protein, do not show the presence of this band. Hence, it may
be speculated that the Qcr7p-Al O is not imported into mitochondria
t o detectable levels because, in addition to its compromised
amphipathicity and elimination of hydroxylated residues Ser-4, Thr-
6, and Ser-7, it contains a negatively-charged aspartate as the
second residue from the N-terminus. If indeed the Qcr7 protein N-
terminus is involved in import, this residue might repel the protein
from the negatively-c harged phospholipid backbone of the membrane
and decrease the eff~ciency of import to levels below detection.
lmmunoblotting of the cytosolic protein fraction from the
mutant with QcrTp-Al O did not show an accumulation of Qcr7p-Al O
precursor in the cytosol (results not shown). This is not unexpected
as impon of rnitochondrial proteins is tightly coupled to synthesis
and it is rare that mitochondrial precursor proteins can be detected
in the cytoplasm (16% 164). Hence, Qcr7p-A10 is either imported
quickly after synthesis, or CO-translationally or, alternatively, it is
degraded rapidly due t o impaired import. Further experiments need
t o be performed to resolve the issue of whether Qcr7p-A~O is not
imported and degraded in the cytoplasm or whether it is degraded in
the mitochondria due t o an unassembled, partially assernbled, or
misfolded mutant protein.
The amino-terminus of the Qcr7 protein is essential for assembiy of
the bel complex
Examination of mutants with truncated proteins Qcr7p-A?,
Qcr7p-Al O, Qcr7p-A14, and Qcr7p-~20 with respect t o the levels of
the other subunits (refer to Figs. 4-3, 4-4, and 4-5) of complex III
indicates that the content of core protein 1 does not V a r y
significantly. Core protein 2 seems to be slightly reduced in al1
respiration-deficient mutants except in that with Qcr7p-
~7(RlOl/G12V). Intermediate ISP (i-ISP) whose bipartite signal
sequence has been processed once, is present a t lower arnounts in
the strain expressing the Qcr7p-~7 than in the strain with wild type
Qcr7 protein. The strain carrying Qcr7p-~14, however, contains only
trace amounts of this intermediate and i-ISP is undetectable in
strains with Qcr7p-a20 and Qcr7p-al0 and in YSM-qcr7A. Despite
the decreased leveis or absence of this intermediate, mature ISP is
present in al1 the mutant strains, showing decreased levels t o about
75% of wild type in mutants with Qcr7p-A14 and Qcr7p-~20. Yeast
expressing wild type Qcr7 protein and Qcr7p-A7 contain comparable
levels of mature ISP, whereas the remaining mutants have lower
amounts. The strain with Qcr7p-A? contains levels of 11 kDa
subunit comparable t o the wild type, the strains expressing Qcr7p-
A 14 and Qcr7p-A 2 0 have intermediate levels of this subunit
(approxirnately 60% of wild type), and the lowest levels of 11 kDa
subunit are seen in the strain expressing Qcr7pa l O and in YSM-
qcr7A. Examination of the levels of cytochrome cl suggests that
combined intermediate and mature cytochrome cl are reduced
approximately by 40% in the strain with Qcr7p-AI 4, and by over 60%
in strains with Qcr7p-A20 and Q c r 7 p - ~ l O and in YSM-qcr7A. In
summary, this initial analysis o f the truncated Qcr7 proteins
indicates that deletion of seven or more residues from the amino-
terminus of the Qcr7 protein leads to levels of this protein that are
reduced by approximately 55%; truncation of seven residues leads to
lowered levels of intermediate ISP and intermediate cytochrome cl.
In addition, truncation of 10 or more residues results in lowered
steady-state levels of the 11 kDa subunit, as well as intermediate
and mature iron-sulfur and cytochrome c l proteins. These results
implicate the amino-terminus of the Qcr7 protein in the functional
assembly of the bel complex (33.47,49, 55,60, 133.152).
Because the strain expressing Qcrfp-a7 was the least
compromised of the mutants in assembly of a functional complex III,
I decided to analyze the effect of point mutations in the context of a
A 7 deletion. The mutations targeted two charged residues, Arg-1 O
(mutated to Lys and Ile) and Asp-13 (mutated to Val). Three strains
were studied: a strain with Qcr7p-d7(RI OK), a strain with Qcr7p-
A7(D13V), and a strain containing Qcr7p-a7(R1 OVG12V). The
analysis presented in Chapter 3 indicated that strains expressing
Q c r 7 p - ~ 7 and Qcr7p-a7(RI OK) were respiration-deficient only a t
3 7OC. Cornplex Ill-linked activities measured in mitochondria from
these strains grown a t 300C were comparable t o the activities of
wild type cells. Strains expressing Qcr7p-A 7(Dl3V) and Qcr7p-
A7(R 1 0VG12V) were respiration-deficient at RT, 300C, and 370C.
W hereas the strain containing Qcr7p-A~(D 1 3V) lacked complex III-
linked enzyme activity, the strain with Qcrip-a7(R1 OVG12V)
contained a trace of complex Ill-linked activity.
Examination of the subunit composition of complex III in
mutant strains (Fig. 4-5) indicated that, of al1 the mutants studied
in detail, only the respiration-deficient mutant with Qcr7p-
87(D13V) contained levels of 14 kDa subunit comparable to that of
the strain overexpressing the wild type QCR7 gene. In strains
containing Qcr7p-d7(R1 OK) and Qcr?p-~7(RlOI/G12V) the amount of
14 kDa subunit is reduced to levels similar to that of yeast strains
expressing Qcr7p-~7, Qcr7p-~14, and Qcr7p-~20 (Figs. 4-3 and 4-4).
All the other subunits of the bc, complex in the yeast containing
Fig. 4-5. Western blot analyses of mitochondrial proteins from YSM-qcr7a strains overexpressing wild type Qcr7, Q c r 7 p - a 7 ( D 1 3 V ) , Qcr7p-A 7 ( R 1 OU), and Qcr7p- A 7 ( R 1 01/G 1 2V), respectively. Mitochondrial proteins (1 00pg) isolated from the above strains were dissolved in SDS-PAGE buffer containing DTT and heated for 3 min at 95oC. Samples were run on a 1 6% polyacrylamide gel and then transferred t o a nitrocellulose membrane. The blot containing core proteins 1 and 2, the ISP, the 11 kDa and 14 kDa subunits was probed with an antibody detecting al1 those subunits. The blot containing cytochrome c, was probed with a monoclonal antibody raised against this subunit. Lane 1: protein from YSM-qcr7A overexpressing wild type; lane 2: protein from YSM- q c r7A overexpressing R I OK; lane 3: protein from YSM-qcr7A overexpressing D l 3V; lane 4: protein from YSM-qcr7~ overexpressing R I OVG12V.
Qcr7p-~7(RlOK) are present in amounts comparable to the wild type.
Strains expressing Qcr7p-h7(D13V) and Qcr7p-~7(RlOI/G12V), have
core protein 1 levels comparable to the wild type, whereas
densitometry indicated that the level of core protein 2 is reduced in
the strain with Qcr7p-A i ( D l 3 V ) , similar as in the respiration-
deficient strains Qcr7p-A 1 O, Qcr7p-~14, Qcr7p-A20, and YSM-qcr7~
(Figs. 4-4 and 4-5). Mature ISP and cytochrome c, levels are sirnilar
to the wild type in yeast with Qcr7p-~7(Rl OVG1 ZV), but combined
intermediate and mature cytochrome c l and ISP are reduced by
approximately 30% in this mutant. The mutant containing Qcr7p-
~7(D13V) has lowered levels of both intermediate and mature ISP
and cytochrome c,. Although only mature ISP and cytochrome c,
contain catalytic activity, the reduced levels of their intermediates
are indicative of a higher turnover rate due t o an unassembled or
weakly assembled complex. As for the 11 kDa subunit, it is severely
reduced in the mutants with Qcr7p-h7(D13V) and Qcr7p-
a7(R1 OI/G12V) with the lower apparent level being in the latter.
Since an antibody was not available to monitor cytochrome b, I
assessed the presence of holo-cytochrome b in mitochondria by
spectrophotometric analyses (Fig. 4-6). Some samples could not be
assayed for cytochrome b content as they did not grow on non-
repressive carbon sources. Panel (a) in Figure 4-6 shows typical
spectra from the strain expressing the wild type QCR7 gene. In the
top part of panel (a) reduced minus oxidized spectra are seen
corresponding to cytochromes c ic , at 550 nm and cytochromes a+a,
a t 605 nm. In the bottom part of panel (a), reduced minus oxidized
spectra are seen corresponding to cytochrome b at 560 nm and
cytochromes a+a, at 605 nm. With respect to the other strains, the
difference spectra show that the strain carrying the conservatively
substituted Qcr7p-~7(R1 OK) is comparable t o that of the mutant
with Qcr7p-~7. The levels of holocytochrome b from these two
mutants are comparable t o the wild type, whereas the levels of
holocytochrome c+c, are somewhat reduced. In contrast, strains
expressing Qcr7p-~?(RlO!/G12V) and Qcr7p-~7(D13V) displayed
significantly lowered and undetectable amounts of holocytochrome
b, respectively, by this technique. The levels of holocytochrome c ic ,
were comparable in mutants with Qcr7p-A7 and Qcr7p-
~7(R101/G1 ZV), whereas the mutant with Qcr7p-b7(D13V) displayed
slightly reduced levels (Fig. 4-6).
The reduced levels of cytochrome b in strains expressing
Qcr7p-a7(RI OI/G12V) and Qcr7p-~7(D13V), correlate with the
decreased levels of overall ISP and cytochrome c,, as identified by
immunoblotting (Fig. 4-4). Although, as identif ied by
immunoblotting, mature cytochrome c, is comparable to the wild
type in the mutant with Qcr7p-b7(RlOI/G12V) and only slightly
reduced in the mutant with Qcr7p-b7(D13V), the lower relative
levels of holocytochrome c+c,, as seen by spectrophotometry, may be
due to decreased maturation of apocytochrome c, t o holocytochrome
c, as a result of an unstable or a weakly assembled complex. In
summary, immunoblotting and spectrophotometric analyses have
shown that combined intermediate and mature ISP, as well as
holocytochromes b and c+c, are reduced in the mutant with Qcr7p-
~7(D13V) when compared to the mutant with Qcr7p-~7(RlOI/G12V).
Keeping in mind that the mutant with Qcr7p-A7(D13V) has slightly
higher levels of 11 kDa subunit and significantly higher levels of
Qcr7 protein in the mitochondria than the mutant with Qcr7p-
a7(RlOI/G12V), and considering the results from the enzyme
activities (Chapter 3), the varying levels of complex III subunits
implicate a role for the Qcr7 protein amino-terminus in assembly of
a subcornplex/bc, complex.
Fig. 4-6. Difference spectra of the cytochromes. For spectral analyses of the cytochromes, mitochondria (2mg/mL) were resuspended in 0.1 M potassium phosphate (pH 7.4)-0.25 M sucrose- 0.5% cholic acid (33). TO obtain a spectrum containing cytochromes c+c, and cytochromes a i a , , a ferricyanide oxidized spectrum was subtracted from a dithionite reduced spectrum (top panel). To obtain a spectrum containing cytochrome b only, dithionite reduced minus ascorbate-0.2 mM TMPD reduced samples were run (bottom panel). Spectra were recorded on a DW-Za Aminco spectrophotometer from 520 to 620 nm.
cl- -/--
Co-immunoprecipita tlons
Since the N-terminus of the Qcr7 protein seemed to play a role
in assembly of the bel complex, it was of interest t o determine
which subunits the N-terminus associates with and in which order.
These issues were approached by attempting t o CO-precipitate the
subunit/s surrounding the 14 kDa protein. lmmunoprecipitations
were carried out under a variety of conditions using an anti-Qcr7p
antibody raised in chicken and in rabbit to a carboxy-terminal
peptide of the protein. The immune response is unique for each
animal, hence the two anti-Qcr7 antibodies obtained varied with
regard to their specificities. The antibody raised in chicken did not
immunoprecipitate the Qcr7 protein, hence the anti-Qcr7p antibody
raised in rabbit was employed for all imrnunoprecipitation
procedures. The results proved t o be inconclusive (results are not
shown). Three secondary antibodies were used in Western blot
analyses t o determine which complex III subunits had CO-
precipitated with the 14 kDa protein. The first one, raised in rabbit,
recognizes core proteins 1 and 2 , the ISP, and subunits 7 and 8; the
other two were monoclonal antibodies raised in mice against the ISP
and cytochrome c I , respectively. When the rabbit antibody was
employed to detect immunoprecipitated proteins on the immunoblot
there was a significant amount of cross-reaction with the anti-
Qcr7p antibody since both were raised in the same animal species.
Hence, the large molecular weight core proteins could not be
detected due to interference from the IgG heavy chains (about 5 0 kDa
in size). Even under non-reducing conditions there was sufficient
background on the immunoblot corresponding to the heavy chains to
obscure the potentially CO-precipitated core proteins. Similarly, the
ISP could not be detected with this antibody due to interference
from the IgG light chains (approximately 25 kDa in size). However,
when ernploying the mouse monoclonal anti-cytochrome c l and anti-
ISP antibodies, there was minimal interference frorn the IgG (H+L)
chains of the anti-Qcr7 antibody used in the immunoprecipitation.
Blots visualized with these secondary antibodies seemed to indicate
that cytochrome cl and the ISP did not CO-precipitate. This notion
was substantiated by the identical band profile seen in the two
immunoblots. That is, since the bands that could be seen in the two
blots were identical, they could not correspond to cytochrome cl and
the iron-sulfur protein, but rather to the minimal interference of
the IgG light chains which migrate a t approximately the same rate
as cytochrome cl and the ISP.
Under some conditions employed, a protein band that migrates
in the region of the 11 kDa protein could be visualized in the wild
type, but not in the strain YSM-qcr7~. On the other hand, under
different conditions there appeared to be such a protein band even in
the disruption strain suggesting that the protein migrating in the
region of 11 kDa seen following immunoprecipitation is not the 11
kDa protein of the bci complex.
Results from immunoprecipitations following cross-linking
were inconclusive as well. No matter which of the three antibodies
described above were used to detect the proteins on the
immunoblots, the profile seen for al1 the mutant strains tested and
the wild type (whether under reducing or non-reducing conditions)
was the same. That is, the same band pattern was seen for al1 the
mutant strains, including YSM-qcr7A, and for the wild type. Since
the immunoprecipitations were carried out with an anti-Qcr7
antibody, this indicates that the observed bands are not relevant to
subunits from complex III. A new antibody raised against the 14 kDa
subunit or the 11 kDa subunit could perhaps be tested with better
results in the future (see "Future Directions", Chapter 5).
Deletion of seven residues from the amino-terminus does not impair
pro ton pumping
1 found that truncation of the amino-terminal seven amino
acids did not impair electron transport (that is complex Ill-linked
enzyme activity was not affected), hence I tested whether this
segment might contribute t o proton translocation. Generation of
ATP can be used as an indirect measure of the proton gradient. With
succinate as substrate, ATP synthesis in mitochondria is a measure
of the integrity of the proton gradient that is established by
complexes III and III+IV. When ferricyanide is used as electron
acceptor with succinate as substrate, the ATP produced is solely due
to the electrochemical gradient generated by complex III. As already
mentioned, to establish a proton gradient electron transport has to
be intact; hence, as expected, of al1 the strains containing truncated
Qcr7 proteins that were tested, only Qcr7p-~7 produced ATP in the
assay system. The amount of ATP produced in mitochondria from the
A 7 protein-containing mutant, however, was no different from that
in mitochondria from the wild type irrespective of whether the ATP
was generated by the activity of complex Ili alone or complexes
III+IV. Similarly, mutant strains expressing Qcr7 proteins with
residue substitutions in Ser-4 and Thr-6 did not show a decrease in
the amount of ATP produced when compared to the wild type (Table
4-1). As the yeast Qcr7 protein has a longer N-terminal extension
than its beef heart homologue, Qcr7 proteins with N-terminal
truncations of 14 and 20 residues (after Met-1) were synthesized to
test for the amount of ATP synthesized. Unfortunately, mutants
expressing Qcr7p-AI 4 and Qcr7p-A 20 completely lack complex III-
linked enzyme activities (see Table 3-2) and could therefore not
produce any ATP.
The strain expressing Qcr7p-d 7 is temperature sensitive
The growth of the yeast strain expressing the Qcr7p-~7 a t
370C (Fig. 4-7) displays a different profile from the phenotype a t
30oC (refer to Fig. 4-3). At 370C this strain is a pe t - mutant with
undetectable NADH-cytochrome c reductase activity. In this case
immunoblotting (Fig. 4-7) showed that the A 7 protein was not
present in the mitochondria (lane 1) although it was readily
detectable in YSM-qcr7~ overexpressing the wild type Qcr7 protein
(lane 2). This result may implicate involvement of the N-terminus
in mitochondrial targeting and import in a temperature sensitive
manner. Alternatively, the absence of Qcr7p-A7 in the mitochondria
rnay simply be the result of an intrinsically unstable protein and a
higher rate of degradation a t 370 C.
Table4-1: ATPS
Mutation
episomal wild type
~7
S4G
S4Y/11 1 V
S4G
S4WE109G
P2T/S4L
T6P
T6R
nt hesis
Complex III+IV Complex III
(- Ferricyanide) (+ Ferricyanide)
41 9 (8) +/- 73 1 12 (8 ) +/- 27
374 (2) 107 (2)
366 - 516 - 554 - 540 - 412 ( 2 ) 122
- 85
- 85 v
synthesized per milligram of protein (nmol of ATP/mg of protein) in 45 minutes in the presence or absence of femcyanide (for details see Material and Methods).
II
The numbers correspond to the total arnount of ATP
Fig. 4-7. Wes te rn b lo t analysis p e r f o r m e d w i t h mitochondrial membranes prepared f rom Y S M - q c r 7 ~ (g r o w n a t 370C) overexpressing Q c r 7 p - ~ 7 and the wild type Qcr7 protein. Mitochondrial proteins (1 00 pg, from cells grown a t 370C) were dissolved in SDS-PAGE buffer and heated for 3 min a t 950C. Samples were run on a 16% polyacrylamide gel and then transferred to a nitrocellulose membrane. The blot was probed with a polyclonal antibody that recognizes core proteins 1 and 2, the iron-sulfur protein, the 14 kDa and 1 1 kDa subunits. Lane 1: protein from the strain Y S M - q c r 7 ~ overexpressing Qcr7p-A7; iane 2 : protein from strain YSM-qcr7~ overexpressing the wild type Qcr7 protein.
4.4. DISCUSSION
From the analyses of the mutant strains presented in Chapters
3 and 4 it is evident that despite the 5 0 mutations that were
introduced into the QCR7 gene, only few caused a respiration
deficiency. Of 28 full-length Qcr7 proteins containing point
mutations that were examined, none caused any deficiencies a t RT,
30°C, or 37OC when expressed in the strain containing the qcr7 gene
disruption, YSM-qcr7A. On the other hand, some o f the mutant
strains expressing Qcr7 proteins with point mutations in the context
of a a7 deletion were respiration-deficient even though the strain
expressing Qcr7p-~7 by itself did not display such a defect at 30°C.
These results rnay indicate that while individual residues alone are
not crucial for the function of the Qcr7 protein amino-terminus, the
destabilized, but still functional Qcr7p-~7 can be disruptive with
respect t o cornplex III function when additional residues are
mutated. This theory would explain why substitution of residues
without an added deletion, as in the mutants containing full-length
proteins, did not result in a deficiency. Furthermore, it explains
why the strain expressing Qcr7p-A7 displays a phenotype equivalent
t o the wild type at 30°C, whereas some of the strains expressing
point mutations in the context of a ~7 deletion are pet-. A deletion
of seven residues rnay be tolerated, but any additional unconserved
substitutions in critical reg ions apparently exceed the threshold. If,
for example, the Qcr7 protein N-terminus is involved in assembly,
truncating this region could weaken the interaction with the other
subunith. Hence, truncation of the N-terminal seven amino acids
still allows assembly, but the complex is less stable. If, then,
additional deletions or point mutations are introduced into the N-
terminal region of the Qcr7p-A7, the secondary structure of the
protein may be further altered especially if the amino acid
substitutions are not conservative. This could cause the already
weakened interactions t o be disrupted. Construction of mutants
with full-length Qcr7 proteins showing normal activity, particularly
Qcr7pG12V and Qcr7pD13V, would strengthen this argument.
The results outlined in this chapter are consistent with this
model. The strain expressing Qcr7p-a7(R1 OK) with the conservative
amino acid substitution R l O K displays a phenotype identical t o the
strain containing the Qcr7p-A7; however, the strain containing the
protein with the non-conservative substitution, D l 3V, is a pe t -
mutant. The hypothesis that the preservation of the entire N-
terminal region and i ts inherent conformation are crucial rather
than the individual residues alone, is further substantiated by
strains expressing Qcr7p-A ï ( R l OT/K44N) and Qcr7p-
A ~ ( A ~ V / R I OT/Y14N/N53D) (see Chapter 3). The former of these
mutants is respiration-deficient, whereas the latter has a phenotype
comparable t o strains expressing Qcr7p-a7 and Qcr7p-a7(RlOK).
This observation rnay argue against a functional involvernent of Arg-
10, but on the other hand, one has t o be cautious in drawing
conclusions from the strain with the quadruply mutated Qcr7p-
a7(A9V/R1 OT/Y14N/N53D), as the substitution of Arg-1 O by
threonine could potentially be compensated for by the other amino
acid substitutions. The wild type phenotype of the strains
expressing full-length Qcr7p-R 1 OT, Qcr7p-R 1 01, Qcr7p-D13K, and
Qcr7p-Dl SE further confirm the notion that preservation of the N-
terminus and its inherent conformation are important. Since,
however, full-length proteins Qcr7p-K44N, Qcr7p-G1 ZV, and Qcr7p-
Dl 3V were not constructed, it cannot be ruled out cornpletely that
these individual residues are essential. This seems improbable
however, since none of the strains expressing full-length Qcr7
proteins with point mutations caused a respiratory chain defect, no
matter whether the charged residues were substituted for by a polar
residue (RlOT), a residue of opposite charge (Dl 3K), or a hydrophobic
residue ( R I 01). Furthermore, the mutant containing the truncated
protein Qcr7p-~7(N53S/EI 1 6G) is pet-, whereas expression of
neither of the full-length proteins Qcr7p-N53S and Qcr7p-N53D
resulted in a respiration-deficient phenotype. In this case, the pet-
phenotype cannot be attributed to the mutation at residue Glu-1 16,
since Hemrika e t al. (49) have truncated a region including this
residue and found that the mutant containing this protein retains
approximately 40% of complex Ill-linked activity and is not
respiration-deficient. Hence, the p e t - phenotype of the strain
expressing Qcr7p-~7(D13V) is probably the combined result of an
unconserved substitution of a critical residue, and the N-terminal
truncation of seven residues.
Recent results obtained from preliminary growth analyses of
newly generated mutants indicate the following: al1 mutants
containing Qcr7 proteins with residue substitutions in the context
of the truncated protein Qcr7p-A7 are respiration-deficient. These
include mutants with proteins Qcr7p-~?(D13Y), -(Dl 3A), -(Dl 3G),
-(Dl 3N), -(G12V), - (R I OI), and -(A9V/G12E). In contrast, the only
new mutant containing a protein with a residue substitution in the
context of the full-length protein, Qcr7pG1 ZV, did not display a
pe t - phenotype. This confirms the prediction that truncation of
seven residues from the amino-terminus is dominant and that any
additional, non-consewative residue substitutions of important
amino acids are disruptive. These results also make it less likely
that a full-length Qcr7p-Di 3V would cause a respiratory chain
defect (So-Young Lee, personal communications).
Co-precipitation of proteins was atternpted by employing an
anti-Qcr7 antibody in order to reveal the identity of any subunit
cornplexed with the 14 kDa protein. Although the antibody used was
capable of immunoprecipitation, under conditions where subunits
were not cross-linked, CO-precipitation could not be achieved. It is
thus probable that the anti-Qcr7 protein antibody cannot access the
14 kDa subunit without disrupting the interactions with the
surrounding subunits. Hence, the yield of only the 14 kDa subunit
following immunoprecipitation. This speculation is in agreement
with previous studies which suggested that the 14 kDa subunit is
located in the interior of the enzyme complex (66) .
CHAPTER 5
Discussion and
Future Directions
CHAPTER 5
Discussion
Previous inactivation of the QCR7 gene has shown that the
Qcr7 protein is an essential component of ubiquinol-cytochrome c
oxidoreductase (33). The disrupted strain displays a pet- phenotype
and does not grow on non-fermentable carbon sources. Previous
studies have implicated the Qcr7 protein in the functional assembly
of ubiquinol-cytochrome c reductase (33 , 4% 55, 60-63). The N-
terminus of the Qcr7 protein is believed to be oriented towards the
matrix in yeast (66 , 130) and in its homologue of beef heart
mitochondria (*3# 31 1. Because proteolysis of the N-terminal seven
amino acids of the beef heart mitochondrial counterpart leads to a
decreased H+/e- ratio, Cocco e t al. (131 ) suggested that this subunit is
involved in proton uptake from the rnatrix with subsequent transfer
of these protons t o the hypothetical ubiquinone binding pocket at
center N. Since, however, proteolysis also resulted in a small
amount of cleavage from the Rieske ISP, it cannot be ruled out that
the ISP is in fact responsible for the decreased H+/e- ratio.
In the current work, the role o f the Qcr7 protein amino-
terminus was investigated with respect to three putative functions;
(1) proton translocation, (2) mitochondrial targeting, and (3)
assembly of the bcl complex. Although the Qcr7 protein does not
contain a cleavable N-terminal targeting sequence, the Qcr7 protein
is unlikely to follow the import pathway used by mitochondrial
proteins without cleavable N-terminal leader sequences, such as the
ADP/ATP carrier (143). In addition, the N-terminal amino acids
display features characteristic of signal sequences, such as net
positive charge, and a number of hydroxylated and hydrophobic
residues. The N-terminus o f the beef heart mitochondrial
counterpart has been postulated to form an amphipathic a-helix (231,
a feature that is typical of mitochondrial targeting sequences. The
above issues were approached by inactivating the QCR7 gene and
complernenting the resulting mutant strain, YSM-qcr7~, with a
number of qcr7 genes containing point and deletion mutations. In
addition, the secondary structures of selected amino-terminal
peptides were studied by CD spectroscopy and by cornparison to their
beef heart homologues.
Circular dichroism studies of a 23 residue peptide from the
amino-terminus of the Qcr7 protein (peptide 4) indicated that this
region displays a-helical spectra in SDS and in methanol (Fig. 4-1).
The extent of a-helix formation of this peptide was comparable to
that of beef heart peptide 1 (residues 2-1 6, results not shown) and
similar t o beef heart peptide 2 (residues 2-26). These results
indicate that even though the primary sequences of the yeast and
beef heart N-termini do not show significant similarity, their
secondary structures are nevertheless similar. In addition, these
findings rnay point towards the importance of the conformation of
the N-terminus as a whole. Helical wheel plots o f the wild type N-
terminus show that the predicted a-helix is amphipathic in nature
(Fig. 4-2) in agreement with one of the typical features of
mitochondrial signal sequences.
Overexpression o f the genes encoding Qcr7p-87 and Qcr7p-
~ 7 ( R 1 OK) in YSM-qcr7~ restored complex Ill-linked enzyme
activities t o levels comparable t o the strain overexpressing the
wild type QCR7 gene a t 30°C. However, overexpressing the genes
encoding Qcr7p-A 1 O, Qcr7p-A14, Qcr7p-~20, Qcr?p-~7(RlOl/G1 ZV),
and Qcr7p-~7(D13V) did no t restore a respiration-competent
phenotype. This prompted me t o investigate whether the truncated
proteins are in fact transported into mitochondria. From Figs. 4-3,
4-4, and 4-5 it is evident that al1 the above mutated proteins with
the exception o f Qcr7p-A~O and Qcr7p-a7(D13V) are present in the
mitochondria a t levels comparable t o the functional Q c r 7 p - ~ 7 .
Althoug h these steady-state levels are signif icantly reduced in
cornparison t o the wild t ype Qcr7 protein in the strain
overexpressing QCR7, the levels are nonetheless comparable t o those
of Qcr7 protein in the parental strain W303-1 B.
Respiration-deficient mutants with Qcr7p-Al0 and Qcr7p
~ 7 ( D 1 3 V ) displayed a different profile from the other Qcr7 proteins
(Figs. 4-3, 4-4, and 4-5). The strain containing Qcr7p-~7(D13V) is
the only mutant with Qcr7 protein steady-state levels comparable t o
the strain overexpressing the wild type QCR7 gene. One can argue
that the elimination of the negatively-charged Asp-13, an untypical
residue for rnitochondrial signal sequences, compensates for the
truncation of the seven N-terminal residues and restores protein
levels back t o those comparable to the strain overexpressing the
QCR7 gene. However, one cannot eliminate the possibility that this
protein is present at wild type levels because it is less susceptible
t o proteolysis in the mitochondria than the other truncated Qcr7
proteins. In contrast t o Qcr7p-A 7(Dl3V), Qcr7p-Al O is not
detectable in the mitochondria. Western blotting of the cytosolic
protein fraction from the strain with Qcr7p-Al O did not show an
accumulation of this subunit in the cytosol. Hence, it is not clear
whether the absence of detectable Qcr7p-Al0 is the result of an
unstable protein which is degraded in the cytoplasm or the
mitochondria t o levels below detection, or whether Q c r 7 p - ~ l O is
degraded in the cytoplasm because it is not imported. I t is
conceivable, that Qcr7p-al O is not imported into mitochondria due
to the negative charge of Asp-13 which, in this truncated protein, is
exposed a t the amino-terminus and might repel the protein from the
negatively charged phopholipid backbone. Negatively charged
residues are uncommon in mitochondrial signal sequences ( iso l '531,
but they may not always be as detrimental to the irnport process
depending on their location or orientation. Further experiments are
clearly needed to resolve the issue between import and degradation
(see "Future Directions").
If the Qcr7 protein was to follow the same import pathway as
proteins with a cleavable amino-terminal signal sequence, then
deletion of the amino-terminus could conceivably result in
decreased import (1 25). For example, truncated proteins may not
interact with cytosolic chaperones as efficiently or, alternatively,
they rnay not bind as tightly to the OMM receptors. The absence of
Qcr7p-~7 at 370C could thus be due to a higher degradation rate at
that temperature resulting from the impaired binding t o cytosolic
chaperones. Roise e t ai. ( 1 5 4 ) have suggested that part of the
mechanism of protein import is the perturbation of the phospholipid
bilayer by the surface active amphipathic helix of the presequence.
This ability of the presequence t o cause a local defect in the
membranes would then create a route for the rest of the protein t o
follow. It is thus conceivable that the truncated proteins of this
study cannot enter the membrane as efficiently, since their
amphipathic character and inherent lytic properties have been
decreased by shortening the presequence. Presequences must be able
t o form amphipathic structures with the charged and hydrophilic
residues located on one side of the helix and the hydrophobic
residues on the other side ( 1 W 155). As indicated by the CD spectra,
the wild type N-terminus is capable of forming an a-helix in a
membrane-mimetic environment (Fig. 4-1 ). In addition, helical
wheel plots of the wild type N-terminus show that this helix is
amphipathic. In contrast, helical wheel plots of Qcr7p-A7 (Fig. 4-2)
and Qcr7pdl O, Qcr7p-AI 4, and Qcr7pA20 (not shown) show that the
amphipathicity o f these helices, if indeed they form helices, is
compromised. Baker and Schatz (95) have shown that 25% of
randomly generated peptides are capable of targeting proteins into
mitochondria, although a t lower efficiency than authentic signal
sequences. Hence, if the Qcr7 protein amino-terminus does in fact
play a role in mitochondrial import, then elimination of some of the
features typical of mitochondrial signal sequences, as seen here in
the truncated Qcr7 proteins, does not have to prevent irnport into
mitochondria, but merely reduce its efficiency. To make a definite
statement on the efficiency of mitochondrial import, further
experiments can be performed (see "Future Directions"). Such
experirnents were not atternpted as a part of this study, as the
question whether the Qcr7 protein amino-terminus is essential for
import into mitochondria was answered by the presence of Qcr7p-
a20 in the mitochondria.
Since transformation of the gene encoding Qcr7p-A7 into the
strain YSM-qcr7a restored complex Ill-linked enzyme activities to
levels comparable to the strain expressing the episomal wild type
Qcr7 protein a t 300C (Table 3-Z), 1 proceeded to test whether the N-
terminal seven amino acids play a role in proton transfer by
assaying the amount of ATP synthesized in mitochondria. As ATP
synthesis is driven by the protonmotive force, the amount of ATP
produced can be used as an indirect assessment of the integrity of
the proton gradient. I found that concentrations of ATP produced
were comparable in strains expressing wild type Qcr7 protein,
Qcr7p-A7, Qcr7p-S4G, Qcr7p-S4Y/IIlV, Qcr7p-S4Y, Qcr7p-
S4G/E109G, Qcr7p-P2T/S4L, Qcr7p-T6P, and Qcr7p-T6R (Table 4-1 ).
From this it can be concluded that in yeast, the involvement of the
N-terminal seven amino acids in proton translocation and ATP
synthesis is unlikely to be critical. Unfortunately, it was not
possible to test the N-terminal region in yeast that is relevant to
the region found to be critical in the beef h e m homologue, as yeast
with truncated proteins Qcr7p-a14 and Qcr7p-a20 did not contain
any complex Ill-linked activitieç. Although these findings may seem
to contradict the studies performed in beef heart mitochondria (1 311,
one has to remember that the yeast homologue contains a longer N-
terminal extension. Furthermore, one has to keep in mind that Cocco
et al. truncated the 13.4 kDa subunit (and others) by subjecting the
already assembled complex t o proteases, thereby circumventing a
potential assembly problem. Hence, it cannot be ruled out that the
region between residues 9 and 21 of the yeast Qcr7 protein are in
fact involved in proton translocation.
Although the N-terminal seven amino acids (after Met-1) of
subunit 7 may facilitate import into mitochondria or confer
stability to the complex, the results of this work suggest that the
amino-terminus of the Qcr7 protein, especially the region between
residues 8 and 20 (after Met-1), is essential for the formation of a
functional bc, complex. Steady-state levels of the majority of
truncated Qcr7 proteins are reduced when compared to the
overexpressed wild type (Fig. 4-4), but the pet- phenotype of the
respiration-deficient mutants cannot be attributed to these reduced
levels as they are comparable to the functional Qcr7pa7. Hence, the
p e t - character of the strains expressing Qcr7 proteins with
truncations (and point mutations) is more likely to be the result of
the decreased levels of some of the other subunits of complex III.
lmmunoblotting shows that the steady-state level of the 11
kDa subunit is decreased in al1 respiration-deficient mutants.
Combined intermediate and mature cytochrome c, and ISP are also
decreased in al1 respiration-deficient mutants tested except for the
mutant with Qcr7p-~7(RlOI/G12V); this mutant contains wild type
levels of mature cytochrome c, and ISP, but lowered overall levels of
these proteins. In addition, spectrophotometric analyses of the
respiration-deficient strain containing Qcr7p-a7(D13V) show that
holocytochrome cl is sig nificantly decreased in this mutant when
compared to the wild type, in agreement with the observations from
the immunoblotting. Furthermore, holocytochrome cl seems to be
reduced slightly in the respiration-deficient mutant with Qcr7p-
~7(R101/G12V) and the respiration-competent mutants with Qcr7p-
A7 and Qcr7p-a7(Rl OK). Nonetheless, the strain with Qcr7p-A7,
which has complex Ill-linked activities indistinguishable from the
wild type a t 30°C, contains lowered intermediate cytochrome cl and
ISP.
Although the N-terminal seven residues of the Qcr7 protein are
not essential for assembly, the complex seems to be less stable
without them. This is indicated by the reduced intermediates of
cytochrome c, and ISP which are the result of a higher turnover rate
of the complex in the mutant containing Qcr7pWA7. When comparing
mutants with Qcr7p-A7, Qcr7pa14, and Qcr7p-A20, one can see that
with increasing N-terminal truncation the levels of intermediate
cytochrome c, and ISP decrease to be virtually absent in the mutant
containing Q c r 7 p - ~ 2 0 . This makes sense since the larger
truncations presumably result in more compromised assembly and
since processing of intermediate ISP into mature ISP is predicted
not to occur until after insertion of this protein into the assembled
complex (133 . 156) . Hence, even though mature ISP and mature
cytochrome c, are present, the reduced levels of these proteins as
seen in some mutants and the absence of their intermediate forms
are a typical indication of an assembly defect (33, 47, 49. 55. 60. l33 ,
152). For example, mature ISP is reduced and intermediate ISP is
undetectable in the study performed by Schoppink e t al. (331, which
describes the previous inactivation of the 14 kDa subunit and in
which the authors conclude that the obsewed defect is due to
compromised assembly of the complex. This profile is similar t o the
profiles seen for YSM-qcr7~, and the strains expressing Qcr7p-~10,
and Qcr7p-~20, respectively. In addition, in the study by Hemrika e t
al. (55) who have concluded that the aromatic nature of residue 66 of
the 11 kDa subunit is important for assembly o f a functional
complex III, intermediate and mature ISP are characteristically
reduced in a mutant in which residues 66 to 70 (YWYWW) have been
replaced by the sequence SASAA. A revertant of the SASAA mutant
with growth rates approximately equal to the wild type was
sequenced and found to contain the sequence FASAA. Analysis of
this revertant revealed that mature ISP is present a t comparable
levels t o the wild type, whereas intermediate ISP is reduced. This
profile is similar to the profile seen for the ISP in the mutant with
Qcr7p-~7. Furthermore, in the study in which Hemrika e t al. (49) have
shown that the C-terminus of the 14 kDa subunit is involved in
assembly of a functional enzyme, intermediate and mature ISP are
characteristically reduced. Also, a study by Crivellone e t al. (60) has
shown that intermediate and mature ISP are reduced in al1 mutants
in which the genes encoding complex III subunits have been deleted
and, as a result, the complex does not assemble into a functional
enzyme. Thus, numerous mutational studies of complex III subunits
have been performed, where reduction of intermediate and mature
(or interrnediate only) forms of ISP and cytochrome c, have been
interpreted as being indicative of an impairment of the assembly
process. The levels of ISP and cytochrome c,, as documented by
previous studies and by this study, faIl between the wild type levels
and the drastically lowered levels seen in strains in which the QCR7
gene has been deleted. However, in spite of the interpretation of
lack of intermediate ISP and cytochrome c, proteins in complex III
mutant analysis as being indicative of lack of complex III assembly,
there is a paucity of experimental work in the literature to
substantiate this assurnption.
The hypothesis that truncation o f the N-terminal seven
residues (of the mature protein) destabilizes the assembly of the bc,
complex, but that any further truncation or non-conservative
substitution of important residues is detrimental t o the assembly
process is substantiated by the following observations: i) truncation
of seven residues from the amino-terminus by itself results in
lowered levels of cytochrome c, and ISP intermediates; ii) any
truncation beyond seven residues of the Qcr7 protein amino-
terminus results in lowered levels of intermediate and mature
cytochrome c, and ISP, as well as the 11 kDa subunit, despite levels
of 14 kDa subunit comparable to the strain with Qcr7p-A7; iii) the
substitution of valine for Asp-13 in the context of a A 7 truncation
results in severely reduced levels of the 11 kDa subunit,
intermediate cytochrome c, and ISP, mature ISP, holocytochrome c,
and holocytochrome b; the mutant containing Qcr7p-~7(RlOI/G12V)
has severely reduced levels of the 11 kDa subunit, reduced levels of
intermediate cytochrome c , and ISP, as well as reduced
holocytochrome b and holocytochrome c,; iv) none of the mutants
with full-length Qcr7 proteins containing only point mutations
display either a respiratory chain defect or lowered levels o f
intermediate or mature cytochrome c, and ISP (not shown). This is
the case, no matter whether the charged residues were substituted
for by a polar residue ( R I OT), a residue of opposite charge (Dl 3K), or
a hydrophobic residue (RI 01). Furthermore, the mutant containing
the truncated protein Qcr7p-~7(N53S/E116G) is pet- , whereas
expression of neither of the full-length proteins Qcr7p453S and
Qcr7p-N53D resulted in a respiration-deficient phenotype. In this
case, the pet- phenotype is less likely due t o the mutation a t residue
Glu4 16, since Hemrika e t al. (49) have truncated a region including
this residue and found that the mutant containing this protein
retains approximately 40% of complex III-linked activity and is not
respiration-deficient. Hence, the evidence from al1 the mutants
constructed in the context of Qcr7p-A7 and the new finding that the
mutant with the full-length Qcr7p-G1ZV is comparable t o the wild
type according to growth, speaks for the dominant effect of the N-
terminal truncation of seven residues.
The observed decrease in the levels of complex III subunits
other than the Qu7 protein cannot be explained by an unstable Qcr7
protein which is misfolded and subsequently degraded. In addition,
the presence of most mutated Qcr7 proteins (except Qcr7p-al O and
Qcr7p-~7(D13V)) in the mitochondria at comparable levels which are
also similar to, or higher than the level of Qcr7 protein in the
parental strain W303-1 B, speaks against their lowered levels as a
result of degradation. If the mutated Qcr7 proteins were unstable,
one would expect them to be degraded to levels below detection or
t o varying levels as shown in the study by Crivellone e t al. (60 ) . In
addition, the fact that the majority of mutated Qcr7 proteins are
present in the mitochondria a t comparable levels, despite their
different mutations, speaks against their instability as a result of
mutation. The fact that so many mutants with wild type phenotype
(Table 3-2) could be isolated speaks for the stability of the protein
and indicates that overall configuration is perhaps more important
than the individual residues. A precedent of this type of phenornenon
is seen in some of the subunits of complex I from a variety of
eukaryotes where few amino acid residues are consewed (18).
Nevertheless, the comparable levels of Qcr7 protein seen in
most mutants by themselves do not rule out the possibility that this
protein is partially degraded and that the assembly defect of
complex III follows from that. However, the levels of the other
subunits of the complex speak against an assembly defect as a
result of a misfolded Qcr7 protein. When comparing the degree of
assembly t o that in the mutant strain YSM-qcr7A, in which a Qcr7
protein is not synthesized, the following observations speak for an
increase in the assembly of a subcomplex or cornplex III itself (Fig.
4-4): i) elevated levels of 11 kDa subunit in al1 mutants when
compared t o YSM-qcr7a; ii) elevated levels of mature ISP in the
respiration-deficient mutants containing Qcr7p-~7(D13V), Qcr7p-
A14, and Q c r 7 p ~ 2 0 when compared t o YSM-qcr7A; iii) elevated
levels of mature cytochrome c, in some of the respiration-deficient
mutants when compared to YSM-qcr7A. Taken together, these results
speak against a mechanism involving total misfolding followed by
degradation independent of the other subunits of the complex, as
this would give levels of 11 kDa subunit, ISP and cytochrome c,
identicai to those seen in YSM-qcr7A.
One could possibly argue that truncation of the Qcr7 protein N-
terminus alters the state of acetylation of the truncated proteins as
opposed to the wild type and that this could influence the assembly
process. This seems unlikely, however. According to Persson e t a/.
(167) Ser and Ala are the most common residues at position 1 in
acetylated proteins, followed by Met. Furthermore, Asp, Glu, Ser,
and Thr are common a t position 2 and Lys is generally
overrepresented in the N-terminal 10 residues of the 250 acetylated
proteins that were characterized. When applying these guidelines to
the wild type and truncated Qcr7 proteins, the wild type Qcr7
protein and Qcr7p-A14 are not candidates for acetylation; Qcr7p-~7,
410, and - A 2 0 could potentially be acetylated, with Qcr7p-A7 being
the most likely candidate. Since Qcr7p-~7 is similarly functional in
assembly to the wild type whereas Qcr7p-AI 4 and Qcr7p-A20 are
similarly disruptive with respect to assembly, it is highly
improbable that the potentially different states of acetylation are
responsible for the observed assembly defect. In addition, it is not
clear whether the Qcr7 protein is acetylated in the first place as
mitochondrial proteins are less frequently acetylated than their
non-mitochondrial isozyme counterparts. This makes sense since
acetylation is dependent on the availability of acetyl Co-A which in
turn is decreased when the tricarboxylic acid cycle is active or
when yeast are grown under aerobic conditions (169).
Now, that the implication of the Qcr7 protein N-terminus in
assembly has been established, a model is proposed on the basis of
these findings which is compatible with the observations. Consider
the results obtained for the 11 kDa subunit: it is present a t wild
type levels in the mutant expressing Qcr7pd7, a t intermediate
levels in mutants containing Qcr7p-AI 4 and Qcr7p-AZO, but this
subunit is drastically lowered in strains with Qcr7p-a7(R101/GlZV)
and Qcr7p-~7(D13V). This observation suggests that the putative
interaction between the Qcr7 protein and the 11 kDa subunit occurs
beyond residue 8. In light of the proposed formation of a subcomplex
between cytochrome b, the Qcr7 protein, and the 11 kDa subunit (339
4% 559 60-631, this may suggest that the potentially destabilized
complex that is seen for the mutant containing Qcr7pa7, is the
result of a disruption of the putative interaction between
cytochrome b and the 14 kDa subunit. Examination of the data
obtained for the mutant containing Qcr7pd7(D13V) confirms the
above model. In this mutant the levels of 11 kDa subunit are
significantly lowered which can be explained by the substitution of
Val-13 for Asp-13 which could lower the extent of the putative
interaction of the Qcr7 protein and the 11 kDa subunit. Because of
the potential repulsion between the Qcr7p-~7(D13V) and the 1 1 kDa
subunit in addition t o the potentially destabilized interaction
between the Qcr7p-~7(D13V) protein and cytochrome b as a result of
the N-terminal truncation, further assembly into a multimeric
complex III is presumably unstable and the degree of assembly is
therefore decreased. This notion is conf irmed by the
spectrophotometric analyses of holocytochrome b, which indicate
that cytochrorne b maturation does not occur to detectable levels in
this mutant, and by the lowered levels of total apocytochrome cl,
holocytochrome cl, and mature ISP. Now consider the data obtained
for the mutant containing the Qcr7p-~7(RlOI/G12V) in light of the
postulated hypothesis. Of al1 mutants with detectable Qcr7 proteins
in the mitochondria, this mutant has the lowest levels of 11 kDa
subunit, but has intermediate levels of cytochrome b. The more
severe putative inhibitory effect between Qcr7p-~7(RlOl/GlZV) and
the 1 1 kDa subunit, as compared to that between Qcr7p-~7(D13V)
and the 11 kDa subunit, may be explained by a "double" severe
negative effect due to the creation of two hydrophobic residues. The
higher level o f holocytochrome b seen in the mutant with Qcr7p-
~7(R101/G12V) as opposed to that with Qcr7p-~7(D13V), might be
explained by a closer proximity of Arg-1 O tu cytochrome b than Asp-
13. Hence, in this mutant, as opposed to the mutant with Qcr7p-
~7(D13V), the newly created lie-1 0 (and perhaps Val-1 2 ) may repel
the 11 kDa subunit, but, on the other hand, may strengthen the
putative hydrophobic interaction with cytochrome b. This more
stable interaction with cytochrome b in the mutant containing
Qcr7p-d7(Rl OI/G1 ZV), as opposed to the mutant containing Qcr7p
b7(D13V), results in a higher degree of assembly of a multimeric
complex III and cytochrome b maturation, despite the relatively
lower abundance of the 11 kDa subunit. The higher levels of
cytochrome c, and ISP in the mutant containing Qcr7p-
~7(R101/G12V) as compared to YSM-qcr7~ are in agreement with the
hypothesis of an increase in the degree of assembly. The finding
that cytochrome c, is present a t relatively higher levels than the 11
kDa subunit when compared to the wild type may seem to contradict
the hypothesis of Hemrika e t al. (49) who suggest that the C-
terminus of the 11 kDa subunit anchors the cytochrome c,
subcomplex (45. 47, 65). However, the 11 kDa subunit does not
constitute the only contact site of the cytochrome c, subcomplex
with the bc, complex.
So how does the above model explain the findings of mutants
expressing Q c r 7 p ~ 1 4 and Qcr7p-AZO? These mutants display an
intermediate levei (approximately 60%) of 11 kDa protein. This fact
reinforces the notion stated earlier, that the contact site between
the Qcr7 protein and the 11 kDa subunit is beyond residue 8. One
may wonder why the interaction between Qcr7pA14, Qcr7p-A20 and
the 11 kDa subunit is stronger than that between the 11 kDa subunit
and Qcr7p-~7(D13V) or Qcr7p-~7(Rl OVG1 ZV), since Arg-1 O, Gly-12,
and Asp-13 are absent. Firstly, this could be taken as evidence for,
and could be explained by, the existence of another contact site
(beyond residue 15) between the Qcr7 protein and the 11 kDa subunit.
Secondly, the putative repulsive effect that is present between the
11 kDa subunit and the mutant proteins Qcr7p-A7(RlOI/G12V) and
Qcr7p-a7(D13V), de facto, is absent in Qcr7p-A14 and Qcr7p-~20.
The observation that mutants with Qcr7p-~14 and Qcr7pA20 have
significant levels of 11 kDa subunit, speaks for an association of the
Qcr7 protein and the 11 kDa subunit and against total misfolding of
Qcr7p-a14 and Qcr7pa20. The observation that the mutant with
Qcr7p-a20 has ISP and cytochrome c, levels comparable to YSM-
qcriA, whereas the level of 11 kDa subunit is significantly higher,
speaks for a direct interaction of the Qcr7 protein with the 11 kDa
subunit. The levels of ISP and cytochrome c, which are as low as in
YSM-qcr7~, furthermore constitute circumstantial evidence that
holocytochrome b is also undetectable in this mutant as it is in YSM-
Q C ~ ~ A (33). Hence, taken together al1 the evidence suggests that the
mutant containing Qcr7p-~20 is presumably the most compromised
of al1 the mutants that contain detectable Qcr7 protein in the
mitochondria. This argument is indirectly supported by the inability
of this mutant to grow on non-repressive carbon sources, such as
galactose.
The results of the current work suggest that the N-terminus of
the Qcr7 protein is involved in the assembly of complex III.
Although residues 1 to 7 (of the mature protein) seem tu play a role
in the assembly process, they are not crucial for the formation of a
functional bc,complex. In contrast, the region between residues 8
and 20 of the mature Qcr7 protein is essential for the functional
assembly of ubiquinol-cytochrome c oxidoreductase. In addition to
the role of the Qcr7 protein N-terminus in assembly, residues 2 to 8
(of the mature protein) may facilitate import into mitochondria or
confer stability to the protein. The elucidation of the function of
the subunit 7 N-terminus with respect to assembly may explain why
this region is retained as part of the mature protein rather than
being cleaved upon import into the mitochondria (if indeed it is
involved in import).
Future Directions
The current study indicates that the amino-terminus of
subunit 7 of the yeast bc, complex is essential for the formation of a
subcomplex consisting of cytochrome b, the 14 kDa and the 11 kDa
subunits. Without the formation of this subcomplex a functional
multimeric enzyme complex is not formed and mutant yeast display
a respiration-deficient phenotype. In addition to the proposed role
in assembly, the N-terminus of the Qcr7 protein is suggested to
increase the efficiency of the localization of subunit 7 into
mitochondria. Further studies can be perforrned t o confirm the
predicted functions of the Qcr7 protein amino-terminus.
Confirmation of assembly of the Qcr7 protein N-terminus with
cytochrome b and/or the 1 7 kDa subunit and identification of contact
sites
Confirmation of the putative interaction between cytochrome b
and the Qcr7 protein, as well as between the 11 kDa subunit and the
Qcr7 protein can be performed by CO-immunoprecipitation
procedures. The use of different conditions could not only confirm
the CO-precipitation of the components of the cytochrome b
subcomplex, but could potentially identify other subunits of complex
III that are in contact with either cytochrome b, the 14 kDa subunit,
or the 11 kDa subunit, respectively. For successful
immunoprecipitation it is important to obtain a good antibody.
Although obtaining a good antibody requires some luck, the
investigator should take into account the following information
when choosing the peptide that will be used to obtain the antibody.
The anti-Qcr7 protein antibody used in the immonoprecipitation
procedures of this study did not seem to CO-precipitate any other
subunits. This might be because the C-terminus (which contains the
epitope for the antibody) of the 14 kDa protein is buried in the
interior of complex III and/or because the C-terminus is believed to
anchor the core protein subcomplex (49. 66). Since the middle part of
the Qcr7 protein might be involved in forming a membrane-spanning
segment (481, raising an antibody against a reg ion immediately
following the Qcr7 protein N-terminus would be a plausible
possibility. Alternatively, it might be more useful t o raise an
antibody against cytochrome b or the N-terminus of the 11 kDa
subunit. The N-terminus of the 11 kDa subunit would probably be a
better choice than the C-terminus of the 11 kDa subunit, which has
been suggested to be located either on the matrix side of the IMM (5%
6 5 ) or on the IMS side of the IMM (66. 671, because the C-terminus has
been proposed to anchor the cytochrome c, subcomplex (49). Raising
an antibody against cytochrome b is difficult owing t o the
hydrophobicity of this protein and was unsuccessfully attempted
during this study. An antibody against cytochrome b would open up a
multitude of experimental possibilities (see below).
The residues involved in the interaction between the Qcr7
protein N-terminus and cytochrome b and/or the 11 kDa subunit
might be identified by the yeast "two-hybrid system". In this
experimental system, the Qcr7 protein amino-terminus can be used
to assay for the interaction with various regions of the 11 kDa
subunit and cytochrome b. The advantage of this system is the
inherent HA epitope tagging that can be used to detect fusion
proteins by Western blot analysis with commercially available
antibody. Hence, antibodies against the subcloned fragments are not
required. The disadvantage of the two-hybrid system is that it is
based on the solubility of proteins in aqueous environment. This
could be problematic for membrane proteins or for protein-protein
interactions that occur in a hydrophobic environment.
An anti-cytochrome b antibody can be used to further clarify
some of the results obtained in this study. Assaying for the levels
of apocytochrome b by Western blot analysis, versus holocytochrome
b by spectral analysis, could be used to gain further insight into the
mechanism of assembly. If results indicate that the levels of
apocytochrome b are low in strains expressing the N-terminally
truncated proteins of this study, then the respective truncated
regions of the Qcr7 protein could be implicated in the direct
assembly with cytochrome b. If, however the results showed that
apocytochrome b is present a t significantly higher steady-state
levels than holocytochrome b, then this would implicate the Qcr7
protein N-terminus in assembly a t the level of cytochrome b
maturation. In this case the Qcr7 protein N-terminus might be
involved in the stabilization of the cytochrome b heme environment
so as to maintain it in a state that is competent for the insertion of
heme/s.
Testing for the involvement of the Q u 7 protein N-terminus in
mitochondrial irnport
Based on the results of this study, the N-terminal seven amino
acids (after Met-1) o f the Qcr7 protein have been implicated in
mitochondrial import of this subunit. The truncation of seven or
more residues from the N-terminus resulted in decreased
mitochondrial steady-state levels o f the mutated Qcr7 proteins
from strains overexpressing the mutated genes as compared to the
strain overexpressing the wild type QCR7 gene. The functional
deficiencies observed in some of these strains expressing mutated
proteins cannot be attributed to the decreased levels of subunit 7 in
the mitochondria, as they are no lower than the levels observed in
the parental strain in which the QCR7 gene is not overexpressed.
Nevertheless, it is interesting t o investigate the cause for the
observed lowered steady-state levels.
To determine whether any of the lowered levels of the mutated
Qcr7 proteins are due t o a Iowered efficiency o f mitochondrial
import or to increased degradation, one could radioactively label
cytoplasmic proteins in vivo with [3SS]-methionine. After chasing
proteins for various times with cold medium, immunoprecipitation,
and SDS PAGE, one could distinguish whether the mutated Qcr7
proteins are accumulating in the cytoplasm and subsequently
degraded due to a decreased rate of import, or whether the mutant
proteins are imported at equal rates to the wild type, but degraded
faster inside the mitochondria due to an instability as a result of
mutation.
An alternative t o determining the efficiency of import in vivo,
is t o radiolabel proteins by in vitro translation in the presence of
reticulocyte lysate. Purified precursor protein can then be added to
mitochondria a t increasing concentrations in a standard import
mixture according to Millar and Shore (171). Following SDS PAGE,
import into mitochondria can then be tested for by resistance to
externally added proteases and the extent of import can be
determined by fluorography. To test whether the N-terminus of the
Qcr7 protein contains a mitochondrial targeting sequence, one could
fuse the N-terminal 21 amino acids of subunit 7 t o a non-
mitochondrial passenger protein such as the cytosolic mouse
dihydrofolate reductase (DHFR) (37). AS above, this import assay
could also be performed by in vitro synthesis of the chimeric Qcr7-
DHFR protein. Again, localization into mitochondria can then be
tested for by the resistance to externally added proteases.
An in vitro assay system can also be used to determine
whether the mutated Qcr7 proteins that are localized in the
mitochondria reach their final destination in the IMM or whether
they are accumulating in the matrix. Depending on whether
mitochondria or mitoplasts (mitochondria which lack the OMM) are
used in the in vitro assay in combination with protease resistance,
one can determine whether the Qcr7 proteins are associated with
the IMM or present in the matrix (142). According to Japa e t a l (142)
cytochrome b is required for the association o f the Qcr7 protein
with the membrane. Hence, if the mutated Qcr7 proteins are shown
to be localized in the matrix rather than in the membrane, then this
would further implicate the N-terminus in the direct assembly with
cytochrome b. If, however, the mutated Qcr7 proteins are localized
to the IMM, the obsewed assembly defect would more likely be a t the
level of cytochrome b maturation as discussed in the assembly
section above.
Further mutagenesis of the Qcr7 protein
Further mutational analysis of the Qcr7 protein in the context
of the full-length protein or in the context of a a7 truncation, can be
performed to confirm sorne of the predictions from this study. For
example, to identify which of the two residues, if not both, are
responsible for the p e t - phenotype in mutants with Qcr7p-
~7(R101/G12V) and Qcr7p-A7(RlOT/K44N), one would construct
mutants with full-length proteins Qcr7p-G1 ZV and Qcr7p-K44N.
Should these mutants display a wild type phenotype, then it would be
of interest to construct two mutants with the same residue
substitutions in the context of Qcr7p-~7. Should these mutants
compare t o the wild type as well, then the issue of whether
substitutions for Arg-1 O or both Arg-1 O and Gly-lZ/Lys-44
together are causing the p e t - phenotype could be resolved by
constructing mutants with Qcr7p-~7 containing substitutions for
Arg-10. In addition t o point substitutions a t the above residues, it
would also be of interest to construct a mutant with the full-length
Qcr7p-D'i3V. This will resolve the question as t o whether point
mutations are only informative in the context of Qcr7p-A7, or
whether they can disrupt assembly in the context of a full-length
protein. In addition, this will identify potentially important
residues.
If further analysis of the Qcr7 protein is desired, it might be
more informative in the future t o perform random mutagenesis of
the QCR7 gene rather than site-directed mutagenesis, since very few
of the mutants in this study displayed a respiration-deficient
phenotype. This can be performed by a number of methods, including
UV irradiation, PCR, and alanine scanning (1 57# 58). Alternatively,
further site-directed mutagenesis can be employed to mutate
consewed residues as determined by the comparison of homologues
of the Qcr7 protein (146). A preliminary screen for respiration-
deficient mutants can be performed by growth analysis on non-
fermentable carbon sources. Deficient mutants can then be further
characterized by the various methods outlined in the results
chapters and in the Future Directions of this dissertation. In order
to circumvent the issue of glucose repression which results in a
significant decrease of complex Ill-linked enzyme activities and in
the inability to perform spectra of the cytochromes (see Chapter 4),
mutant genes can be permanently integrated into the genome by
homologous recombination (as described in Chapter 2). This would
elirninate the need for selective growth in minimal media and the
mutant cells could be grown in rich medium containing non-
repressive carbon sources such as galactose. Further mutational
analysis of the Qcr7p-~7 amino-terminus (in which residues 2 t o 8
are deleted) has been performed by substituting residues 9 to 1 5
wi th a poly-alanine segment (So-Young Lee, personal
communication). In this experiment the Qcr7 protein is not
detectable in the rnitochondria and the assembly phenotype of the
mutant strain is comparable to that in YSM-qcr7a.
REFERENCES
REFERENCES
1. Voet D, Voet JG. In: Stiefel J, ed. Biochemistry. New York: John
Wiley & Sons, Inc., 1990.
2. de Vries S, Marres CA. The mitochondrial respiratory chain of
yeast. Structure and biosynthesis and the role in cellular
metabolism. Biochim Biophys Acta 1 987;895:205-39.
3. Wallace DC. Structure and evolution of organelle genomes.
Microbiol Rev 1 982;46:208-40.
4. Schatz G. Protein import by yeast mitochondria. Prog Clin Bi01
Res 1 992;375:1-8.
5. Schatz G. The protein import machinery of mitochondria.
Protein Sei 1993;2:141-6.
6. Pfanner N, Neupert W. The mitochondrial protein import
apparatus. Annu Rev Biochem 1990;59:331-53.
7. Lithgow T, Glick BS, Schatz G. The protein import receptor of
mitochondria. Trends Biochem Sci 1995;20:98-101.
8. Lithgow T, Junne T, Suda K, Gratzer S, Schatz G. The
mitochondrial outer membrane protein Mas22p is essential for
protein import and viability of yeast. Proc Nat/ Acad Sci USA
1 994;91:11973-7.
9. Haucke V, Lithgow T, Rospert S, Hahne K, Schatz G. The yeast
mitochondrial protein import receptor Mas20p binds precursor
proteins through electrostatic interaction with the positively
charged presequence. J Bi01 Chem 1 995;27O: 5565-70.
10. Gratzer S, Lithgow T, Bauer RE, e t al. Mas37p, a novel receptor
subunit for protein import into mitochondria. J Ce11 Bi01
1995;129:25-34.
11. Bolliger L, Junne T, Schatz G, Lithgow T. Acidic receptor
domains on both sides of the outer membrane mediate translocation
o f precursor proteins into yeast mitochondria. Embo J
1995;14:6318-26.
12. Hatefi Y. The mitochondrial electron transport and oxidative
phosphorylation system. Annu Rev Biochem 1985;54:1015-69.
13. GriveII LA. Nucleo-mitochondrial interactions in yeast
mitochondrial biogenesis. Eur J Biochem 1 989; 1 82:477-93.
14. Lazowska J, Jacq C, Slonimski PP. Sequence of introns and
flanking exons in wild type and box3 mutants of cytochrome b
reveals an interlaced splicing protein coded by an intron. CeIl
1980;22:333-48.
15. Tzagoloff A, Myers AM. Genetics of mitochondrial biogenesis.
Annu Rev Biochem 1 986;55:249-85.
16. Marres CA, de Vries S, Grivell LA. Isolation and inactivation of
the nuclear gene encoding the rotenone-insensitive interna1 NADH-
ubiquinone oxidoreductase of mitochondria from Saccharomyces
cerevisiae [published erratum appears in Eur J Biochem 1991 Sep
15;200(3):812]. Eur J Biochem 1991 ;195:857-62.
17. de Vries S, Grivell LA. Purification and characterization of a
rotenone-insensitive NADH-Q6 oxidoreductase from mitochondria of
Saccharomyces cere visiae. Eur J Biochem 1 9 8 8; 1 76 : 3 77-84.
18. Fearnley IM, Walker JE. Conservation of sequences of subunits
o f mitochondrial complex I and their relationships with other
proteins. Biochem. Biophys. Acta 1 992;1140:105-134.
19. Mackler B, Haynes B. Studies of oxidation phosphorylation in
Saccharomyces cerevisiae and Saccharomyces carlsbergensis.
Biochim Biophys Acta 1973;292:88-91.
20. Ohnishi T. Induction of the site I phosphorylation in vivo in
Saccharomyces carlsbergensis. Biochem. Biophys. Res. Commun.
1970;41:344-352.
21. Scriver CR, Beaudet, A. L., Sly, W. S., Valle, D. In: Scriver CR,
Beaudet, A. L., Sly, W. S., Valle, D., ed. The metabolic and molecular
bases of inherited disease. New York: Mc Graw Hill, Inc., 1 995 (vol 1).
22. Marres CM, Slater EC. Polypeptide composition of purified QHz-
cytochrome c oxidoreductase from beef heart mitochondria. Biochim
Biophys Acta 1 977;462:53 1-48.
23. Link TA, Schaegger H, von Jagow G. Cytochrome systems. In:
Papa S, Chance B, Ernster L, eds. Structural analysis of the bcl
complex from beef heart rnitochondria by the sided hydropathy plot
and by comparison with other bel complexes, 1987.
24. Brandt U, Uribe S, Schagger Hl Trumpower BL. Isolation and
characterization of QCR 70, the nuclear gene encoding the 8.5 kDa
subunit 1 O of the Saccharomyces cerevisiae cytochrome bc
complex. J Biol Chern 1994;269:12947-53.
25. Kurowski B, Ludwig B. The genes of the Paracoccus
denitrificans bc complex. Nucleotide sequence and homologies
between bacterial and mitochondrial subunits. J Biol Chem
1987;262:13805-11.
26. Yang XH, Trumpower BL. Purification of a three-subunit
ubiquinol-cytochrome c oxidoreductase complex from Paracoccus
denitrifieans [published erratum appears in J Biol Chern 1986 Nov
25;261(33):15813]. J Biol Chem 1 986;26 1 :12282-9.
27. Hauska G, Hurt E, Gabellini N, Lockau W. Comparative aspects of
quinol-cytochrome dplastocyanin oxidoreductases. Biochim Biophys
Acta 1983;726:97-133.
28. Trumpower BL. The protonmotive Q-cycle. Energy transduction
by coupling of proton translocation to electron transfer by the
cytochrome bel complex. J Bi01 Chem 1990;265:11409-12.
29. Crofts AR. Reaction center and UQHz-cyt c2 oxidoreductase act
as independent enzymes in Rps. sphaeroides. J Bioenerg Biomembr
1 986;18:437-45.
30. Mitchell P. Possible molecular mechanisms o f the
protonmotive function of cytochrome systems. J Theor Bi01
1976;62:327-67.
31. di Rago JP, Colson AM. Molecular basis for resistance t o
antimycin and diuron, Q-cycle inhibitors acting a t the Qj site in the
mitochondrial ubiquinol-cytochrome c reductase in Saccharomyces
cerevisiae. J Bi01 Chem 1 988;263: 1 2564-70.
32. Esposti MD, De Vries S, Crimi M, Ghelli A, Patarnello 1, Meyer
A. Mitochondrial cytochrome b: evolution and structure of the
protein. Biochim Biophys Acta 1 993;1143:243-71.
33. Schoppink PJ, Berden JA, Grivell LA. Inactivation of the gene
encoding the 14 kDa subunit VI1 of yeast ubiquinol. cytochrome c
oxidoreductase and analysis o f the resulting mutant. Eur J Biochem
1989;181:475-83.
34. Brasseur R. Calculation of the three-dimensional structure of
Saccharomyces cerevisiae cytoch rome b inserted in a lipid matrix. J
Biol Chem 1988;263:12571-5.
35. Sadler 1, Suda K, Schatz G, Kaudewitz F, Haid A. Sequencing of
the nuclear gene for the yeast cytochrome cl precursor reveals an
unusually complex amino-terminal presequence. Embo J
1 984;3:2 1 37-43.
36. Wachter C, Schatz G, Glick BS. Role of ATP in the
intramitochondrial sorting of cytochrome c l and the adenine
nucleotide translocator. Embo J 1 992; 1 1 :4787-94.
37. van Loon AP, Brandli AW, Schatz G. The presequences of two
imported mitochondrial proteins contain information for
intracellular and intramitochondrial sorting. Ceil 1 9 86;44:801-12.
38. Beckmann JD, Ljungdahl PO, Lopez JL, Trumpower BL. Isolation
and characterization of the nuclear gene encoding the Rieske iron-
sulfur protein (RIP 1 ) f rom Saccharomyces cerevisiae. J Biol Chem
1 987;262:8901-9.
39. Ljungdahl PO, Beckmann JD, Trumpower BL. Mutational analysis
of the mitochondrial Rieske iron-sulfur protein of Saccharomyces
cerevisiae. II. Biochemical characterization of temperature-
sensitive RIP I - mutations. J Bi01 Chem 1 989;264:3723-31.
40. Van Doren SR, Yun CH, Crofts AR, Gennis RB. Assembly of the
Rieske iron-sulfur subunit of the cy tochromeb~~ complex in the
Escherichia coli and Rhodobacter sphaeroides membranes
independent of the cytochrome b and c l subunits. Biochemistry
1 993;32:628-36.
41. Link TA, lwata S. Functional implications of the structure of
the Rieske iron-sulfur protein of bovine heart mitochondrial
cytochrome bc1 complex. Biochim Biophys Acta 1 996; 1 275: 54-60.
42. Graham LA, Trumpower BL. Mutational analysis of the
mitochondrial Rieske iron-sulfur protein of Saccharomyces
cerevisiae. III. Import, protease processing, and assembly into the
cytochrome bc complex of iron-sulfur protein lacking the iron-
sulfur cluster. J Biol Chem 1991 ;266:22485-92.
43. van Loon AP, de Groot RJ, van Eyk E, van der Horst GT, Grivell
LA. Isolation and characterization of nuclear genes coding for
subunits of the yeast ubiquinol-cytochrome c reductase complex.
Gene 1982;20:323-37.
44. Trumpower BL. Cytochrome bc, complexes of microorganisms.
Microbiol Rev 1 990;54:101-29.
45. Schoppink PJ, Hemrika W, Berden JA. The effect of deletion of
the genes encoding the 40 kDa subunit II or the 17 kDa subunit VI on
the steady-state kinetics of yeast ubiquinol-cytochrome c
oxidoreductase. Biochim Biophys Acta 1 9 89;974: 1 92-201 . 46. Schmitt ME, Trumpower BL. Subunit 6 regulates half-of-the-
sites reactivity of the dimeric cytochrome b c l complex in
Saccharomyces cerevisiae. J Bi01 Chem 1 990;Z 6 5 : 1 7005-1 1 . 47. Schmitt ME, Trumpower 01. The petite phenotype resulting
from a truncated copy of subunit 6 results from loss of assembly of
the cytochrorne bcl complex and can be suppressed by overexpression
of subunit 9. J Bi01 Chern 1 991 ;266:14958-63.
48. De Haan M, van Loon AP, Kreike J, Vaessen RT, Grivell LA. The
biosynthesis of the ubiquinol-cytochrome c reductase complex in
yeast. DNA sequence analysis of the nuclear gene coding for the 14
kDa subunit. Eur J Biochem 1 984;138:169-77.
49. Hemrika W, De Jong M, Berden JA, Grivell LA. The C-terminus of
the 14 kDa subunit of ubiquinol-cytochrorne c oxidoreductase of the
yeast Saccharomyces cerevisiae is involved in the assembly of a
functional enzyme. Eur. J. Biochem 1 994;220:569-576.
50. Hemrika W. Berden JA, Grivell LA. A region of the C-terminal
part of the 11 kDa subunit of ubiquinol-cytochrome c oxidoreductase
of the yeast Saccharomyces cerevisiae contributes t o the structure
of the &, reaction domain. Eur J Biochem 1993;215:601-9.
51. Maarse AC, Grivell LA. Nucleotide sequence of the gene
encoding the 11 kDa subunit of the ubiquinol-cytochrome c
oxidoreductase in Saccharomyces cerevisiae. Eur J Biochem
1987;165:419-25.
52. Usui S, Yu L, Yu CA. The small molecular mass ubiquinone-
binding protein (QPc-9.5 kDa) in mitochondrial ubiquinol-cytochrome
c reductase: isolation, ubiquinone-binding domain, and
immunoinhibition. Biochemistry 1 990;29:46 1 8-26.
53. Bruel C, Brasseur R, Trumpower BL. Subunit 8 of the
Saccharomyces cerevisiae cytochrome bc l complex interacts with
succinate-ubiquinone reductase complex. J Bioenerg Biomernbr
1996;28:59-68.
54. Lobo-Hajdu G, van Gaalen Ml Grivell LA, Berden JA. The
aromatic domain 66YWYWW70 of subunit Vlll of the yeast ubiquinol-
cytochrome c oxidoreductase is important for both assembly and
activity of the enzyme. FEBS Letters 1 996;39S: 1 99-203.
55. Hemrika W, Lobo-Hajdu G, Berden JA, Grivell LA. The aromatic
nature of residue 66 of the I l -kDa subunit of ubiquinol-cytochrome
c oxidoreductase of the yeast Saccharomyces cerevisiae is
important for the assembly of a functional enzyme. FEBS Le t t
1 994;344:15-9.
56. Phillips JD, Graham LA, Trumpower BL. Subunit 9 of the
Saccharomyces cerevisiae cytochrome bc cornplex is required for
insertion of €PR-detectable iron-sulfur cluster into the Rieske iron-
sulfur protein. J BiolChem 1993;268:11727-36.
57. Weiss H, Leonard K, Neupert W. Puzzling subunits of
mitochondrial cytochrome reductase. Trends Biochem Sci
1 990; 1 5: 1 78-80.
58. Pollock RA, Hartl FU, Cheng MY, Ostermann J, Honuich A,
Neupert W. The processing peptidase of yeast mitochondria: the two
CO-operating components MPP and PEP are structurally related. Embo
J 1 988;7:3493-500.
59. Jensen RE, Yaffe MP. lmport of proteins in to yeast
mitochondria: the nuclear MAS2 gene encodes a component of the
processing protease that is homologous to the MAS1 -encoded
subunit. Embo J 1 988;7:3863-71.
60. Crivellone MD, W u MA, Tzagoloff A. Assembly of the
mitochondrial membrane system. Analysis of structural mutants of
the yeast coenzyme QHZ-cytochrome c reductase cornplex. J Biol
Chem 1988;263:14323-33.
61. Crivellone MD. Characterization of CBP4, a new gene essential
for the expression of ubiquinol-cytochrome c reductase in
Saccharomyces cerevisiae. J Bi01 Chem 1 994;269: 2 1 2 84-92.
62. Wu M, Tzagoloff A. Identification and characterization of a new
gene (CBP3) required for the expression o f yeast coenzyme QH2-
cytochrome c reductase. J Biol Chem 1 989;264: 1 1 1 22-30.
63. Maarse AC, De Haan M, Schoppink PJ, Berden JA, Grivell LA.
Inactivation of the gene encoding the 11 kDa subunit Vlll of the
u biquinol-cytoc hrome c oxidoreductase in Saccharomyces cerevisiae.
Eur J Biochem 1 988;172: 1 79-84.
64. Graham LA, Brandt U, Sargent JS, Trumpower BL. Mutational
analysis of assembly and function of the iron-sulfur protein of the
cytochrome b c i complex in Saccharomyces cerevisiae. J Bioenerg
Biomembr 1993;25:245-57.
65. Gonzalez-Haiphen D, Lindorfer MA, Capaldi RA. Subunit
arrangement in beef heart complex III. Biochemistry 1 988;Z 7: 702 1 - 31.
66. Hemrika W, Berden JA. Membrane topography of the subunits of
ubiquinol-cytochrome c oxidoreductase o f Saccharomyces
cerevisiae. The 14 kDa and the 1 1 kDa subunits face opposite sides
of the mitochondrial inner membrane. Eur J Biochem 1990;l W 7 6 1 - 765.
67. Boumans H, Berden JA, Grivell LA. Topoiogical organization of
subunits VI1 and Vlll in the ubiquinol-cytochrome c oxidoreductase
of Saccharomyces cerevisiae. FEBS Lett 1 996;MO: 1 3 7-41.
68. Rep M, Grivell LA. The role of protein degradation in
mitochondrial function and biogenesis. Curr Genet 1 99 6;30:367-380.
69. Rep M, Grivell LA. MBA1 encodes a mitochondriai membrane-
associated protein required for biogenesis of the respiratory chain.
FEBS Lett 1 996;388:185-8.
70. Rep M, van Dijl JM, Suda K, Schatz G, Grivell LA, Suzuki CK.
Promotion of mitochondrial membrane complex assembly by a
proteolytically inactive yeast Lon. Science 1 996;274: 1 03-6.
71. Pearce DA, Sherman F. Diminished degradation o f yeast
cytochrome c by interactions with its physiological partners. Proc
Nat1 Acad Sci U S A 1 995;92:3735-9.
72. Kadenbach 6, Jarausch J, Hartmann R, Merle P. Separation of
mammalian cytochrome c oxidase into 13 polypeptides by a sodium
dodecyl sulfate gel electrophoretic procedure. Analytical
Biochemistry 1983; 12951 7-521.
73. Aggeler R, Capaldi RA. Yeast cytochrome c oxidase subunit VI1
is essential for assembly of an active enzyme. J. Biol. Chem.
1990;265:16389-16393.
74. Lig htowlers R, Chrzanowska-Lig htowlers 2, Ma rusich M,
Capaldi RA. Subunit function in eukaryote cytochrome c oxidase: A
mutation in the nuclear-coded subunit IV allows assembly but alters
the function and stability of yeast cytochrome c oxidase. J. Biol.
Chern. 1991 ;266:7688-7693.
75. Patterson TE, Poyton RO. COX8, the structural gene for yeast
cytochrome c oxidase subunit VIII. J. Biol. Chem. l986;26 1 : 171 92-
171 97.
76. Hatefi Y. ATP synthesis in mitochondria. Eur J Biochem
1993;218:759-67.
77. Pedersen PL, Amzel LM. ATP synthases. Structure, reaction
center, mechanism, and regulation of one of nature's most unique
machines. J Biol Chem 1993;268:9937-40.
78. Tatuch Y, Christodoulou J, Feigenbaum A, e t al. Heteroplasmic
mtDNA mutation (T---G) a t 8993 can cause Leigh disease when the
percentage of abnorrnal mtDNA is high [see comments]. A m J Hum
Genet 1992;50:852-8.
79. Mueller DM, Getz GS. Steady state analysis of mitochondrial
RNA after growth o f yeast Saccharomyces cerevisiae under
catabolite repression and de-repression. J Biol Chern
1986;261:11816-22.
80. Robinson BH. Lacticacidemia. Biochemical, clinical, and genetic
considerations. Adv Hum Genet 1 989; 1 8: 1 5 1 -79.
81. Robinson BH. Lacticacidemia. Biochim Biophys Acta
1 993;l l82:23 1-44.
82. Forsburg SL, Guarente L. Communication between mitochondria
and the nucleus in regulation of cytochrome genes in the yeast
Saccharomyces cerevisiae. Annu. Rev. Ce11 Biol. 1 9 89; 5: 1 5 3-1 80.
83. Dieckmann CL, Koerner TJ, Tzagoloff A. Assembly o f the
mitochondrial membrane system. CBP 7 , a yeast nuclear gene
involved in 5' end processing of cytochrome b pre-mRNA. J Bi01 Chem
1 984;259:4722-3 1.
84. McGraw P, Tzagoloff A. Assembly of the mitochondrial
membrane system. Characterization of a yeast nuclear gene involved
in the processing of the cytochrome b pre-mRNA. J Bi01 Chem
1983;258:9459-68.
85. Pillar T, Lang BF, Steinberger 1 , Vogt B. Kaudewitz F.
Expression of the "split gene" cob in yeast mtDNA. Nuclear mutations
specifically block the excision of different introns from its primary
transcript. J Biol Chern 1983;258:7954-9.
86. Guarente L, Lalonde B, Gifford P, Alani E. Distinctly regulated
tandem upstream activation sites mediate catabolite repression of
the CYC7 gene of S. cerevisiae. Cell1984;36:503-11.
87. Guarente L, Maçon T. Herne regulates transcription of the CYC7
gene of S. cerevisiae via an upstrearn activation site. Ce11
1 983;32:1279-86.
88. Dieckmann CL, Tzagoloff A. Assernbly of the mitochondrial
membrane system. CBPG, a yeast nuclear gene necessary for
synthesis of cytochrome b. J Bi01 Chem 1 985;260: 1 51 3-20.
89. Tzagoloff A, Yue J, Jang J, Paul MF. A new member of a family
of ATPases is essential for assembly of mitochondrial respiratory
chah and ATP synthetase complexes in Saccharomyces cerevisiae. J
Biol Chem 1994;269:26144-51.
90. Barath 2, Kuntzel H. Cooperation of rnitochondrial and nuclear
genes specifying the mitochondrial genetic apparatus in Neurospora
crassa. Proc Nat1 Acad Sci U S A 1 972;69:1371-4.
91. Parikh VS, Conrad-Webb Hl Docherty R, Butow RA. Interaction
between the yeast mitochondrial and nuclear genomes influences the
abundance of novel transcripts derived from the spacer region of the
nuclear ribosomal DNA repeat. Mol Ce11 Bi011 989;9:1897-907.
92. Pelham HR. Control o f protein exit from the endoplasmic
reticulurn. Annu Rev Cell Bi011 989;5:1-23.
93. Schatz G. Mitochondria: beyond oxidative phosphorylation.
Biochirn Biophys Acta 1 995;1271:123-6.
94. Schatz G, Dobberstein B. Common principles of protein
translocation across membranes. Science 1 996;271: 1 5 1 9-26.
95. Baker A, Schatz G. Sequences from a prokaryotic genome or the
mouse dihydrofolate reductase gene can restore the import of a
truncated precursor protein into yeast mitochondria. Proc Nat1 Acad
SciUSA 1987;84:3117-Zl.
96. Hardy SJ, Randall LL. A kinetic partitioning model of selective
binding of nonnative proteins by the bacterial chaperone SecB.
Science 1991 ;251:439-43.
97. Wickner W. Mechanisrns of membrane assembly: general lessons
from the study of Ml3 coat protein and Escherichia coli leader
peptidase. Biochemistry 1 988;îï: 1 081 -6.
98. Deshaies RJ, Koch BD, Werner-Washburne M, Craig €A,
Schekman R. A subfamily of stress proteins facilitates translocation
of secretory and mitochondrial precursor polypeptides. Nature
1988;332:800-5.
99. Murakami H, Pain D, Blobel G. 70-kD heat shock-related protein
is one of a t least two distinct cytosolic factors stimulating protein
import into mitochondria. J Ce// Bi011 988; 1 07:205 1-7.
100. Cyr DM, Lu X, Douglas MG. Regulation of Hsp7O function by a
eukaryotic DnaJ homolog. J Bi01 Chem 1992;267:20927-31.
101. Glick BS, Wachter C, Schatz G. The energetics of protein import
into mitochondria. Biochim Biophys Acta 1 9 92; 1 1 01 :Z49-5 1 . 102. Eilers M, Schatz G. Binding of a specific ligand inhibits import
of a purified precursor protein into mitochondria. Na t u r e
1 986;322:228-32.
103. Hachiya N, Alam R, Sakasegawa Y, Sakaguchi M, Mihara K,
Omura T. A mitochondrial import factor purified from rat liver
cytosol is an ATP-dependent conformational modulator for precursor
proteins. Embo J 1 993; 1 2: 1 579-86.
104. Hachiya hi, Mihara K, Suda K, Horst M. Schatz G, Lithgow T.
Reconstitution of the initial steps of mitochondrial protein import.
Nature 1 995;376:705-9.
105. Sollner T, Rassow J, Wiedmann M, e t al. Mapping of the protein
import machinery in the mitochondrial outer membrane by
crosslinking of translocation intermediates. Nature 1 992;3 5 5: 84-7.
106. Bolliger L, Deloche O, Glick BS, e t al. A mitochondrial
homologue of bacterial GrpE interacts with mitochondrial hsp70 and
is essential for viability. Embo J 1 994; 1 3:1998-2006.
107. Ikeda E, Yoshida S. Mitsuzawa H, Uno 1, Toh-e A. YGEl is a yeast
homologue of Escherichia coli grpE and is required for maintenance
of mitochondrial functions [pubfished erratum appears in FEBS Lett
1994 Apr 25;343(2):181]. FEBS Lett 1994;339:265-8.
108. Emtage JL, Jensen RE. MAS6 encodes an essential inner
membrane component of the yeast mitochondrial protein import
pathway. J Ce11 Bi011 993;122:1003-12.
109. Dekker PJ, Keil Pl Rassow J, Maarse AC, Pfanner N, Meijer M.
Identification of MIM23, a putative component of the protein import
machinery of the mitochondrial inner membrane. FEBS L e t t
1993;330:66-70.
110. Bauer MF, Sirrenberg C, Neupert W, Brunner M. Role of TimZ3 as
voltage sensor and presequence receptor in protein import into
mitochondria. Ce111 996;87:33-41.
11 1. Matouschek A, Rospert S, Schmid K, Glick BS, Schatz G.
Cyclophilin catalyzes protein folding in yeast mitochondria. Proc
Natl Acad Sci U SA 1995;92:6319-23.
112. Rowley N, Prip-Buus C, Westermann B, et al. Mdjl p, a novel
chaperone of the DnaJ family, is involved in mitochondrial
biogenesis and protein folding. Ce11 1 994;77:249-59.
11 3. Hohfeld J, Hartl FU. Role of the chaperonin cofactor Hspl O in
protein folding and sorting in yeast mitochondria. J Ce11 Biol
1994;126:305-15.
114. Rospert S, Glick BS, Jeno Pl et al. Identification and functional
analysis of chaperonin 10, the groES homolog from yeast
mitochondria. Proc Natl Acad Sci U S A 1 993;gO: 1 O96 7-71.
11 5. Manning-Krieg UC, Scherer PE, Schatz G. Sequential action of
mitochondrial chaperones in protein import into the matrix. Embo J
1991 ;10:3273-80.
11 6. Ostermann J, Honuich AL, Neupert W, Hartl FU. Protein folding
in mitochondria requires complex formation with hsp60 and ATP
hydrolysis. Nature 1 989;341: 1 25-30.
117. Stuart RA, Neupert W. Apocytochrome c: an exceptional
mitochondrial precursor protein using an exceptional import
pathway. Biochimie 1 99O;TZ: 1 1 5-2 1.
118. Glick BS, Brandt A, Cunningham K, Muller S, Hallberg RL, Schatz
G. Cytochromes cl and b2 are sorted t o the intermembrane space of
yeast mitochondria by a stop-transfer mechanism. Ce11
1992;69:809-22.
119. Tokatlidis K, Junne T, Moes S, Schatz G, Glick BS, Kronidou N.
Translocation arrest of an intramitochondrial sorting signal next to
Timl 1 at the inner-membrane import site. Nature 1 996;384:585-
588.
120. Glick BS, Beasley EM, Schatz G. Protein sorting in
mitochondria. Trends Biochem Sci 1 992;17:453-9.
121. Koll H, Guiard B, Rassow J, et al. Antifolding activity of hsp60
couples protein import into the mitochondrial matrix with export t o
the intermembrane space. CeM 1 992;68: 1 1 63-75.
122. Cheng MY, Hartl FU, Martin J, e t al. Mitochondrial heat-shock
protein hsp60 is essential for assembly of proteins imported into
yeast mitochondria. Nature 1 989;337:620-5.
123. Kang PJ, Ostermann J, Shilling J, Neupert W, Craig EA, Pfanner
N. Requirement for hsp70 in the mitochondrial matrix for
translocation and folding of precursor proteins. N a t u r e
1990;348:137-43.
124. Lill R, Stuart RA, Drygas ME, Nargang FE, Neupert W. lmport of
cytochrome c heme lyase into rnitochondria: a novel pathway into the
intermembrane space. Embo J 1 992; 1 1 :449-56.
125. Pfanner N, Hoeben P, Tropschug M, Neupert W. The carboxyl-
terminal two-thirds of the ADP/ATP carrier polypeptide contains
sufficient information to direct translocation into mitochondria. J
Biol Chem 1 987;262:14851-4.
126. Mahlke K, Pfanner N, Martin J, Horwich AL, Hartl FU, Neupert W.
Sorting pathways of rnitochondrial inner membrane proteins. Eur J
Biochem 1990;192:551-5.
127. Hartl FU, Schmidt B, Wachter E, Weiss H, Neupert W. Transport
into mitochondria and intramitochondrial sorting of the Fe/S protein
of ubiquinol-cytochrome c reductase. Ceil1 986;47:93 9-5 1 .
128. Segui-Real B, Stuart RA, Neupert W. Transport of proteins into
the various subcompartments of mitochondria. FEBS L e t t
1 992;s 13:2-7.
129. Mayer A, Neupert W, Lill R. Mitochondrial protein import:
reversible binding of the presequence a t the trans side of the outer
membrane drives partial translocation and unfolding. CeI I
1 995;80:127-37.
130. Japa S, Beattie DS. Electron transfer through center O of the
cytochrome bel complex of yeast mitochondria involves subunit VII,
the ubiquinone-binding protein. J Biol Chem 1 989; 264: 1 3 994-7.
131. Cocco T, Lorusso M, Sardanelli AM, e t al. Structural and
functional characteristics of polypeptide subunits of the bovine
heart ubiquinol-cytochrome c reductase complex. Eur J Biochem
1 99 1 ; 1 9573 1 -4.
132. Sherman F. Getting started with yeast. Methods Enzymol
1991;194:3-21.
133. Yang M, Trumpower BL. Deletion of QCRG, the gene encoding
subunit six of the rnitochondrial cytochrome bel complex, blocks
maturation of cytochrome cl, and causes temperature-sensitive
peti te growth in Saccharomyces cerevisiae. J Biol Chem
1994;269:1270-5.
134. Graham LA, Phillips JD, Trumpower BL. Deletion of subunit 9 of
the Saccharomyces cerevisiae cytochrome bc, complex specifically
impairs electron transfer a t the ubiquinol oxidase site (center P) in
the bcl complex. FEBS Lett 1 992;s 1 3 : Z S 1 -4.
135. Van Loon AP, Vijn RJ, De Groot RJ, Polman JE, Grivell LA.
Nuclear genes coding for four subunits of the yeast ubiquinol-
cytochrome c reductase complex are present in single copies in the
haploid genome and at least two of these are located on different
chromosomes. Mol Gen Genet 1 984; 1 97:219-24.
136. Strathern JN, Higgins DR. Guide t o yeast genetics and
molecular biology. In: Guthrie C, Fink G, eds. Methods in Enzymology:
Academic Press, 1 99 1 (vol 1 94).
137. Hill J, lan KA, Griffiths DE, Donald G. DMSO-enhanced whole
cell yeast transformation [published erratum appears in Nucleic
Acids Res 1991 Dec 11;19(23):6688]. Nucleic Acids Res
1991;19:5791.
138. Fourney RM, Miyakoshi J, Day RSI, Paterson MC. Northern
Blotting : Efficient RNA staining and transfer. Fucus 1 988; 1 05-7.
139. Sambrook J, Fritsch EF, Maniatis T. Molecular Cloning: A
Laboratory Manual. Cold Spring Harbor, New York: Cold Spring Harbor
Laboratory, 1989.
140. Guthrie C, Fink GR. Guide t o yeast genetics and molecular
biology. : Academic Press, Inc., 1991.
141. Lorusso M, Cocco T, Boffoli Dl e t al. Effect of papain digestion
on polypeptide subunits and electron transfer pathways in
mitochondrialb~~ complex. Eur J Biochem 1 989; 1 7953 5-40.
142. Japa S, Sun JZ, Beattie DS. lmport of subunit VI1 of the
cytochrome bc, complex into yeast mitochondria. Arch Biochem
Biophys 1 995;319:250-6.
143. Sirrenberg Cl Bauer MF, Guiard B, Neupert W, Brunner M. lmport
of carrier proteins into the mitochondrial inner membrane mediated
by Tim22. Nature 1996;384:582-585.
144. Trumpower BL, Edwards CA. Purification of a reconstitutively
active iron-sulfur protein (oxidation factor) from succinate-
cytochrome c reductase complex o f bovine heart mitochondria. J Biol
Chem 1979;254:8697-8706.
145. Stotz A, Linder P. The A D E 2 gene from Saccharomyces
cerevisiae: sequence and new vectors. Gene 1990;95:91-8.
146. Boumans H, Berden JA, Grivell LA. Identification of additional
homologs of subunits VI1 and Vlll o f the ubiquinol-cytochrome c
oxidoreductase enables definition o f consensus sequences. Febs
Letters 1995;368:105-109.
147. Robinson BH, Ward J, Goodyer P, Baudet A. Respiratory chain
defects in the mitochondria of cultured skin fibroblasts from three
patients with lacticacidemia. J Clin lnvest 1 9 86;77: 1 422-7.
148. Deber CM, Goto NK. Folding proteins into membranes. Nature
Structural Biology 1996;3:815-818.
149. Gasser SM, Ohashi A, Daum G, e t al. lmported mitochondrial
proteins cytochrome b2 and cytochrome cl are processed in two
steps. Proc Natl Acad Sci U S A 1 982;79:267-71.
150. Hammen PK, Gorenstein DG, Weiner H. Arnphiphilicity
determines binding properties of three rnitochondrial presequences
to lipid surfaces. Biochemistry 1 996;s 5:3772-8 1 . 151. Allison DS, Schatz G. Artificial mitochondrial presequences.
Proc Natl Acad Sei U S A 1 986;83:9011-5.
152. Schoppink PJ, Hemrika W, Reynen JM, Grivell LA, Berden JA.
Yeast ubiquinol-cytochrome c oxidoreductase is still active after
inactivation of the gene encoding the 1 7 kDa subunit VI. Eur. J.
Biochem. 1988;173:115-122.
153. von Heijne G. Mitochondrial targeting sequences may form
amphiphilic helices. Embo J 1 986;5:1335-42.
154. Roise D, Horvath SJ, Tomich JM, Richards JH, Schatz G. A
chemically synthesized pre-sequence of an imported mitochondrial
protein can form an amphiphilic helix and perturb natural and
artificial phospholipid bilayers. Embo J 1 986;s: 1 327-34.
155. Roise D, Theiler F, Horvath SJ, e t al. Amphiphilicity is
essential for mitochondrial presequence function. Embo J
1988;7:649-53.
156. Brandt U, Yu L, Yu CA, Trurnpower BL. The mitochondrial
targeting presequence of the Rieske iron-sulfur protein is processed
in a single step after insertion into the cytochrome bc l complex in
mammals and retained as a subunit in the complex. J Bi01 Chem
1993;268:8387-90.
157. Cunningham BC, Wells JA. High-resolution epitope mapping of
hGH-receptor interactions by alanine-scanning mutagenesis. Science
1 989;244:1081-1085.
158. Ling M, Robinson BH. A one-step polymerase chah reaction
site-directed mutagenesis method for large gene-cassettes with
high efficiency, yield, and fidelity. Anal Biochem 1 995;230:167-72.
159. lwata S, Ostermeier C, Ludwig B, Michel H. Structure a t 2.8 A
resolution of cytochrorne c oxidase from Paracoccus denitrifieans.
Nature 1995; 376:660-669.
160. Abrahams JP, Leslie AGW, Lutter R, Walker JE. Structure a t 2.8
A resolution of Fi-ATPase from bovine heart mitochondria. Nature
1 994; 370:621-628.
161. Abrahams JP, Lutter R, Todd RJ, van Raaij MJ, Leslie AGW,
Walker JE. lnherent asymmetry of the structure of FI-ATPase from
bovine heart mitochondria at 6.5 A resolution. EMBO J 1993;
12(5):1775-1780.
162. Yu C-A, Xia J-2, Kachurin AM, Yu 1, Xia D, Kim H, Deisenhofer J.
Crystallization and preliminary structure o f beef heart
mitochondrial cytochrome bci complex. Biochim Biophys Acta 1 996;
1275:47-53.
163. Fujiki M, Verner K. Coupling of cytosolic protein synthesis and
mitochondrial protein import in yeast. J Bi01 Chem 1993;
268(3):1914-1920.
164. Nijtmans LGJ, Spelbrink JN, van Galen MJM, Zwaan M, Klement
P, van den Bogert C. Expression and fate of the nuclearly encoded
subunits of cytochrome c oxidase in cultured human cells depleted of
mitochondrial gene products. Biochim Biophys Acta 1995;
1265: 1 17-1 26.
165. lmoto K, Konno T, Nakai J, Wang F, Mishina M, Numa S. A ring of
uncharged polar amino acids as a component of channel constriction
in the nicotinic acetylcholine receptor. Febs Letts 1991;
289(2):193-200.
166. Yool AJ, Schwarz TL. Alteration of ionic selectivity of a K+
channel by mutation of the H5 region. Nature 1 99 1 ; 349:700-704.
167. Persson B, Flinta C, von Heijne G, Joernvall H. Structures of N-
terminally acetylated proteins. Eur J Biochem 1 985; 1 52523-527.
168. Tsukihara T, Aoyama H, Yamashita E, Tomizaki T, Yamaguchi H,
Shinzawa-ltoh K, Nakashima R, Yaono R, Yoshikawa S. The whole
structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
Science 1996; 2729 136-1 144.
169. Joernvall H, Fairwell T, Kratofil P, Wills C. Differences in a-
amino acetylation of isozymes of yeast alcohol dehydrogenase. Febs
Letts 1 980; 1 1 1 :2 1 4-2 1 8.
170. Lea PJ, Temkin RJ, Freeman KB, Mitchell GA, Robinson, BH.
Variations in mitochondrial ultrastructure and dynamics observed by
high resolution scanning electron microscopy (HRSEM). Microscopy
Research and Technique 1 994; 27:269-277.
171. Millar DG and Shore GC. Signal anchor sequence insertion into
the outer mitochondrial membrane. Comparison with porin and the
matrix targeting pathway. J Biol Chem 1996; 271 (42):25823-
25829.
TEST TARGET (QA-3)
APPLIED - i IMAGE. lnc = 1653 East Main Street
O 1993. W i e d image. Inc.. All Rights Resewed