Proteomic evaluation of wound-healing processes in potato ( Solanum tuberosum L.) tuber tissue

transcript

RESEARCH ARTICLE

Proteomic evaluation of wound-healing processes

in potato (Solanum tuberosum L.) tuber tissue

Ines Chaves1�, Carla Pinheiro1�, Jorge A. P. Paiva1,2, Sebastien Planchon3,Kjell Sergeant3, Jenny Renaut3, Jose A. Grac-a4, Gonc-alo Costa1, Ana V. Coelho1,5

and Candido P. Pinto Ricardo1,4

1 Instituto de Tecnologia Quımica e Biologica (Universidade Nova de Lisboa), Portugal2 Tropical Research Institute of Portugal (IICT), Forest and Forest Products Centre, Tapada da Ajuda, Portugal3 Centre de Recherche Public – Gabriel Lippmann, Department of Environment and Agrobiotechnologies (EVA),

Proteomic Plateform, Luxembourg4 Instituto Superior de Agronomia, Tapada da Ajuda, Portugal5 Universidade de Evora, Colegio Luıs Verney, Portugal

Received: October 9, 2007

Revised: May 6, 2009

Accepted: June 8, 2009

Proteins from potato (Solanum tuberosum L.) tuber slices, related to the wound-healing

process, were separated by 2-DE and identified by an MS analysis in MS and MS/MS mode.

Slicing triggered differentiation processes that lead to changes in metabolism, activation of

defence and cell-wall reinforcement. Proteins related to storage, cell growth and division, cell

structure, signal transduction, energy production, disease/defence mechanisms and

secondary metabolism were detected. Image analysis of the 2-DE gels revealed a time-

dependent change in the complexity of the polypeptide patterns. By microscopic observation

the polyalyphatic domain of suberin was clearly visible by D4, indicating that a closing layer

(primary suberisation) was formed by then. A PCA of the six sampling dates revealed two

time phases, D0–D2 and D4–D8, with a border position between D2 and D4. Moreover, a

PCA of differentially expressed proteins indicated the existence of a succession of proteomic

events leading to wound-periderm reconstruction. Some late-expressed proteins (D6–D8),

including a suberisation-associated anionic peroxidase, have also been identified in the native

periderm. Despite this, protein patterns of D8 slices and native periderm were still different,

suggesting that the processes of wound-periderm formation are extended in time and not

fully equivalent. The information presented in this study gives clues for further work on

wound healing-periderm formation processes.

Keywords:

MS protein sequencing / Native periderm / Plant proteomics / Potato slices/

Solanum tuberosum / Wounding

1 Introduction

Potato (Solanum tuberosum L.) is a very important food crop

consumed worldwide during extended periods of the year

(http://www.cgiar.org/impact/research/potato.html.) and,

so, the conservation of the tubers is of high economic

importance. The interaction of plant organs, such as the

tubers, with the environment is dependent on the epider-

mis/periderm and many physiological processes are directly

or indirectly affected by the characteristics of this structure.

The native periderm protects the tubers from pathogen and

pest attack [1, 2], dehydration, bruising during harvest and

handling and pressure increase during silo storage [3].

�These authors contributed equally to the work.Abbreviation: UNA, unassigned

Correspondence: Professor Candido P. Pinto Ricardo, Instituto

de Tecnologia Quımica e Biologica / Universidade Nova de

Lisboa, Av. da Republica-EAN, 2780-157 Oeiras, Portugal

E-mail: ricardo@itqb.unl.pt

Fax: 1351-214433644

& 2009 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim www.proteomics-journal.com

4154 Proteomics 2009, 9, 4154–4175DOI 10.1002/pmic.200700649

The ability to rapidly produce a wound-periderm, upon

damage, is vital for maintenance of tuber quality [4, 5]. The

wound-healing process involves dedifferentiation processes,

with activation of metabolism, the formation of mechanical

barriers (e.g. suberin) [1, 3] and the activation of defensive

mechanisms (e.g. formation of PR-like proteins) [6].

The response of plant tissues to wounding has been

studied for a very long time [7–9] and more recently it has

been demonstrated that several genes are wound-inducible

[10]. Functional genomics can provide a fundamental

insight into the organism development [11] and the

responses to stress [12]. The proteomic approach is a very

powerful tool to study the protein patterns that result from

differential gene expression as well as from post-transla-

tional modifications [13]. Although there have been some

studies on the potato tuber proteome [14–17] they were not

concerned with the wound-healing process.

Potato tuber slices constitute a good model to study

wound-induced metabolism [9, 18] and healing [5] and are

used in the present work to detect proteins that are

sequentially expressed upon excision, leading to suberisa-

tion. Proteins were separated by 2-DE and identified by MS

techniques, giving information on the sequence of events

that take place during healing.

2 Materials and methods

2.1 Plant material

Dormant potato tubers (S. tuberosum L.), cv. Asterix, 3

months from harvesting, with fully mature native periderm

and free of any visible disease symptoms were bought

locally. The tubers’ surfaces were washed in running deio-

nised water, for 5 min, followed by 10% commercial bleach,

for 10 min and 70% ethanol for 3 min. Five tubers, that

constitute the five biological replicates, were peeled and cut

into slices (approximately 4 cm in diameter and 1 mm thick),

which were suspended by a plastic thread in a wet chamber

in the dark at 251C. Samples of slices from each tuber were

collected at 24-h intervals, frozen in liquid nitrogen and

stored at �801C until use. Samples of tuber native periderm

(about 0.5 mm thick) were also collected and immediately

frozen.

2.2 Microscopic observations

Pieces of tuber slices (approximately 5 mm� 5 mm� 1 mm)

were fixed in a solution of 5% formaldehyde, 5% acetic acid

and 50% ethanol, dehydrated with an ethanol series, at room

temperature, infiltrated in paraplast (Merck) and embedded

in paraffin (Histosec-Merck), according to the manu-

facturer’s instructions. Sections (about 10 mm thick) were

cut utilizing a rotating microtome (LEICA Instruments).

After deparafination and hydration, cuts were stained using

Sudan IV to visualise suberin aliphatic domains of the cell

walls [19].

2.3 Protein extraction

The plant material (1.5 g samples) was homogenised with

0.6 g of PVPP in liquid nitrogen and suspended in 13 mL of

10% TCA and 60 mM DTT in acetone, at �201C. The

homogenate was centrifuged at 15 000� g for 15 min at 41C

and the pellet recovered and washed with a solution of

60 mM DTT in acetone for 1 h, at �201C. After centrifuga-

tion (at 15 000� g for 15 min at 41C) the pellet was dried

under vacuum and total proteins were extracted by stirring

for 2 h at 251C, in a buffer containing 8 M urea, 4% CHAPS,

2% PVPP and 1% IPG buffer, pH 3–10. The protein was

quantified using the Bradford assay, modified by Ramagli

2.4 2-DE

IEF was performed in 24 cm gels, linear pH gradient of 3 to

10 (IPG strips – Amersham Biosiences) that were loaded

with 650 mg of total protein. IEF was carried out in a

IPGphor isoelectric focusing unit (Amersham Biosiences) at

201C, with the current limited to 50mA/strip, according to

the following protocol: 9 h of rehydration, followed by 50 V

for 10 h, 200 V for 200 Vh, 500 V for 750 Vh, 1000 V for

1500 Vh, 8000 V at a gradient of 6000 Vh and 8000 V up to a

total of 80 000 Vh. Following IEF, the proteins in the strips

were reduced with DTT and alkylated with iodoacetamide

and next separated by SDS-PAGE, in 25 mm� 20 mm� 1

mm gels with a homogeneous acrylamide percentage

(%T 5 12%, %C 5 3.3%). The protein migration took place

at constant voltage of 12 V per gel, for 14 h, at 151C. The gels

were stained with colloidal blue [21].

2.5 2-DE gel image analysis and statistical analysis

The gels were scanned in the ImageScanner II (Amersham

Biosciences) and the images were analysed by REDFIN

software from Ludesi (Uppsala, Sweden). The analysis

consisted in determining the spots present in each gel, their

level of expression and comparing the profiles obtained. Five

gels from five different tubers (biological replicates) were

made for each sampling date: 0 (D0), 1 (D1), 2 (D2), 4 (D4),

6 (D6) and 8 (D8) days from slicing. Image analysis and spot

volume quantification were performed with REDFIN soft-

ware (Ludesi) and only the spots present in the gels of at

least three replicates were accounted for (a total of 1190).

Spots selected for statistical analyses (n 5 182) were those

that had a volume Z150 (REDFIN units).

The following ANOVA model was then applied to each

spot i on normalised volume values to test the day effect on

Proteomics 2009, 9, 4154–4175 4155

protein expression:

Yijk ¼ mþ Dj þ eijk

(Yijk, the normalised volume of spot i (i 5 1–182) in sample jfor replicate k; m the general mean; Dj, the day effect (j 5 day

0, day 1, day 2, day 4, day 6 and day 8); eijk, the residual of

the declared model (k 5 1–5).

ANOVA were performed using R (R Development Core

Team 2004) by means of limma R library (2005) [22]. A spot

was classified as differentially expressed between the

different data samples if its false discovery rate (FDR)

adjusted p-value [23] was o0.05 (96 spots). PCA was

performed using the ade4 library of the R package [24] to

summarise and explore the relationships existing between

differentially expressed proteins along the experiment.

2.6 Protein identification and database search

Spots of interest were excised from colloidal Coomassie

Blue-stained gels and processed according to a previously

published protocol [25]. An Ettan Spot Handling work-

station (GE-Healthcare, Uppsala, Sweden) was used for

destaining and tryptic digestion of the gel-separated

proteins. Since modules for further sample handling and

spotting on MALDI-target plates are integrated in the same

instrument, a completely hands-free approach was

performed. After spotting of the samples, an MS analysis in

MS and MS/MS-mode using a 4800 MALDI TOF/TOF,

externally calibrated as outlined by the manufacturer

(Applied Biosystems, Foster City, CA), was done. Per spot

one MS and eight MS/MS spectra of the most intense peaks

were automatically acquired.

The acquired MS and MS/MS spectra of each spot were

submitted as a single query in database searches against the

NCBI database limited to the taxonomical class of the viri-

diplantae (download from www.ncbi.nlm.nih.gov on 11/01/

2008, containing 5 828 094 sequences). The searches were

done using the Applied Biosystems GPS software on an in-

house MASCOT platform. Similarly, the spectra were sear-

ched using an EST database containing all NCBI entries

from S. tuberosum, downloaded on 22/01/2008. The results

of these searches were combined, thereby increasing the

number of proteins that could be identified with signifi-

cance. All identifications were manually verified. For spots

that did not result in a significant identification, more

peptides were manually selected for fragmentation and, if

required, peptide sequences were determined manually

and used for homology searches with the FASTS-

algorithm (http://fasta.bioch.virginia.edu/fasta_www/cgi/)

[26]. Because it is impossible to discern the isobaric amino

acids Ile and Leu, all mass increments of 113 Da were

arbitrarily designated as Ile. Similarly, mass increments of

128 Da were always denoted as Gln, unless at the C-terminal

position of a peptide when Lys was used. To avoid hapha-

zard identifications, a threshold of 10� 10�4 was rigorously

used and a protein was only considered to be identified if the

majority of proteins with a significant search score had an

identical function [27].

3 Results

3.1 Microscopic observation

Light microscopic observations of the potato tuber slices

revealed structural changes in the cell walls during the

wound-healing process. Using the Sudan IV stain the cell

walls started to be coloured red by D4 from slicing (Fig. 1),

indicating that the deposition of the polyaliphatic domain of

suberin had been initiated. Wound-induced suberisation of

the tuber tissue involves two stages, during which two types

of cells are suberised: 1st stage – formation of a ‘‘closing

layer’’ (primary suberisation) when walls of the existing

parenchyma cells at the wound site suberise; 2nd stage –

formation of a ‘‘wound periderm’’ (secondary suberisation)

when new cells originating from a newly formed phellogen,

bellow the closing layer, are suberised [3].

3.2 2-DE polypeptide patterns

To study the changes in proteins associated with the wound-

healing process of the potato slices, 2-DE gels for the six

Figure 1. Microscopic observa-

tion of potato tuber slices stained

with Sudan IV to evidence

suberin deposition on the cell

walls, during the wound-healing

process. D0 to D7 indicate the

day after slice cutting; from the

4th day onwards the staining of

the polyaliphatic domain of

suberin just formed allows the

visualisation of the cell contours.

This information is consistent

with the time course detailed by

Lulai and Corsini [40].

4156 I. Chaves et al. Proteomics 2009, 9, 4154–4175

sampling dates (D0, D1, D2, D4, D6 and D8) were run

(Fig. 2). Image analysis of the gel patterns was performed

using REDFIN software (Ludesi) in order to get polypeptide

spot quantification, normalisation and matching. A re-

arrangement of the polypeptide patterns was observed as a

consequence of wounding, as indicated by the fact that

several spots decreased or increased in intensity and others

became evident.

Since the wound-healing process leads to the formation

of a new periderm (wound periderm) we also performed a

2-DE protein analysis of potato native periderm (Fig. 3)

to allow a comparison with the last stages of slice healing.

Figure 2. Identification by MS of wound-induced proteins from potato tuber slices resolved on 2-DE gels. D0 to D8 indicate the day after

slice cutting. The proteins selected for identification are numbered in the gels. MW markers, respectively, of 100, 75, 50, 37, 25, 20, 15 and

10 kDa, are indicated at the left gel border.

Proteomics 2009, 9, 4154–4175 4157

The patterns of these gels were found to be dissimilar

from those of the slices, which precluded a joint image

analysis.

3.3 Protein identification in the slices

For the identification in the slices of polypeptides associated

with the wound-healing process (D0, D1, D2, D4, D6 and D8

gels) only spots present in at least three replicates (three

distinct tubers) and that had a volume Z150 (REDFIN

volume units) were considered and excised for MS identi-

fication (182 spots analysed and about 90% identified). The

results are shown in Table 1 (spots with a p-value o0.05)

and Table S1 (Supporting Information material with addi-

tional information about all the spots analysed).

The major proteins that were identified can be grouped

in several of the functional categories defined by Bevan et al.[28], namely: metabolism, energy, transcription, protein

synthesis, protein destination and storage, transporters, cell

structure, signal transduction, disease/defence and second-

ary metabolism. However, a few spots could not be identi-

fied and others referred to proteins of unknown function.

Disease/defence appears to be the most represented of

the functional classes. Membrane proteins were under-

represented among the identified proteins, with a few

exceptions (e.g. vacuolar ATPase subunit, mitochondrial

porin-like protein, plasma membrane polypeptide, b-subu-

nit of K1 channels), possibly as a consequence of the

general poor solubilisation of such proteins.

3.4 Differentially expressed proteins

Slices polypeptide spots statistically classified as differen-

tially expressed between the several data samples (p-value

o0.05; 96 spots) were subjected to a PCA, so that the rela-

tionships existing between the differentially expressed

proteins along the experiment could be explored. The PCA

accounted for about 85% of the total variance (61.16, 14.36

and 9.28%, respectively for the PC1, PC2 and PC3 axes). As

shown in the main PCA plane (PC1–PC2 representation)

(Fig. 4A) the six sampling dates originated six distinct

entities, which by their position can be considered to define

two groups: D0, D1, D2 and D4, D6, D8, with a border line

somehow placed between D2 and D4. Such grouping

suggests that a sequence of metabolic processes had occur-

red with time.

The polypeptide spots that are more strongly associated

with the PC1 and PC2 axes are indicated on the correlation

circle on the PC1–PC2 plane (Fig. 4B). For PC1 those

polypeptides are: high molecular weight patatins (]175,

]238, ]233, ]232) and several protease inhibitors (]456,

]459, ]126, ]335, ]119, ]453, ]251, etc.), when considering

the negative half of the axis (early wound-healing events);

PR10 (]259, ]209), formate dehydrogenase (]2510), wound-

induced protein with a chitin binding domain (]1076,

]1572), chitinases (]1569, ]1539, ]242, ]1929), several

protease inhibitors (]1647, ]1571, ]2545, ]211, ]3716,

]1790, etc.), peroxidases (]1284, ]1622, ]1593) and low

molecular weight patatins (]2458, ]208), for the positive half

of the axis (late wound-healing events). Proteins that mainly

define PC2 are: chitinase (]384), for the negative half-axis;

catalase (]935) and annexin (]875) for the positive half-axis.

The proteins that associate most specifically with the

initial tuber tissue (D0) are those with PC1o�0.6 and

PC2E0, essentially, several protease inhibitors (]456, ]459,

]335, ]453) and high molecular mass patatins (]175, ]238,

]233, ]232). For the extreme of our wound-healing experi-

ment (D8) the associated proteins are those with

0.64PC140.9 and 0.34PC240.7, namely, peroxidase

(]780), chitinases (]242, ]1929), and also proteins like,

metacaspase (]762), annexin (]1450), EIG-J7 protein

(]1546), Ran protein (]1024) and proteosoma alfa-subunit

(]1462).

An interesting observation was that proteins of similarly

attributed function could have maximum expression at

different sampling dates, as it is quite evident for the pata-

tins and the protease inhibitors. In what concerns the

inhibitors we identified a great diversity of them. Different

designations have been utilised in the databases and the

nomenclature is a bit confusing, but by the combined use of

the NCBI BLAST and the Merops databases (http://

merops.sanger.ac.uk/) [29] we were able to group the several

protease inhibitors of the slices in the Merops families I03

and I20. As shown in Fig. 5, the I03 inhibitors could be

further divided into the following four classes: 002, 017, 020

and unassigned (UNA). In general, the I03.017 and

I03.UNA inhibitors (as well as the I20) had a high expres-

sion at D0 that decreased along the wound-healing process,

while inhibitors of the other three I03 classes either

had an opposite behaviour or remained high for most of the

Figure 3. Identification by MS of potato tuber native periderm

resolved on 2-DE gels. The proteins selected for identification

are numbered in the gel. MW markers, respectively, of 100, 75,

50, 37, 25, 20, 15 and 10 kDa, are indicated at the left gel border.

Table 1. List of proteins from the wound-healing potato slices identified by MS and previously separated by 2-DE, with p-value r0.05.

Spotnumber

Variation ofnormalised volume(affected by s.d.)

Proteinidentification

p-Value Functionalcategory

98 Calreticulin 0.030 Disease/defense

99 Unnamed protein product 0.034 Unclassified

119 Proteinase inhibitor S9C11 –Merops family I03.017

0.001 Disease/defense

140 Proteinase inhibitor homologue –Merops family I03.017

175 Patatin 0.003 Protein destinationand storage

189 GST 0.008 Disease/defense

Proteomics 2009, 9, 4154–4175 4159

Table 1. Continued

Spotnumber

209 Pathogenesis-related protein 10 0.018 Disease/defense

211 Proteinase inhibitor precursor –Merops family I03.020

242 Class II chitinase 0.008 Disease/defense

246 Patatin 0.008 Disease/defense

249 Miraculin (low homology) –Merops family I03.UNA

Table 1. Continued

Spotnumber

255 Glycine-rich protein 2 0.000 Disease/defense

302 Gamma interferon-responsivelysosomal thiol reductase

345 Proteinase inhibitor II – Merops family I20.001 0.043 Disease/defense

371 Catalase isozyme 1-like protein 0.004 Disease/defense

380 Not identified 0.000

384 Endochitinase 2 0.002 Disease/defense

Proteomics 2009, 9, 4154–4175 4161

Table 1. Continued

Spotnumber

398 Proteinase inhibitor – Merops family I03.002 0.026 Disease/defense

447 Osmotin-like protein 0.016 Disease/defense

453 Proteinase inhibitor II - Merops family I20.001 0.017 Disease/defense

462 Proteinase inhibitor II precursor – Merops family I20.001 0.012 Disease/defense

464 Proteinase inhibitor II precursor – Merops family I20.001 0.008 Disease/defense

Table 1. Continued

Spotnumber

611 Ankyrin-repeat protein 0.000 Signal transduction

762 Metacaspase 1 0.000 Disease/defense

769 DS2 protein 0.000 Disease/defense

780 Peroxidase 1 0.026 Disease/defense

797 Plasma membrane polypeptide 0.005 Cell structure

810 Proteinase inhibitor homologue – Merops familyI03.017Patatin Protein destination and storage

865 Actin 0.003 Cell structure

872 Aspartic proteinase 2 0.005 Disease/defense

Proteomics 2009, 9, 4154–4175 4163

Table 1. Continued

Spotnumber

875 Annexin p34 0.008 Disease/defense

964 Pathogenesis-related protein STH-2 0.002 Disease/defense

969 Pathogenesis-related protein STH-2 0.004 Disease/defense

1024 Ran protein/TC4 protein 0.031 Signal transduction

1035 Proteinase inhibitor homologue – Merops family I03.017 0.020 Disease/defense

1067 Putative mitochondrial NAD-dependentmalate dehydrogenase

0.000 Energy

Eukaryotic initiation factor 3I1 subunit Transcription1076 Wound-induced protein (with chitin-binding domain) 0.003 Disease/defense

1284 Suberisation-associated anionic peroxidase 0.005 Secondarymetabolism

Table 1. Continued

Spotnumber

1350 Unnamed protein product 0.007 –

1411 Miraculin (low homology) – Merops family I03.UNA 0.000 Disease/defense

1447 Not identified 0.011

1450 Annexin p34 0.019 Disease/defense

1458 Cyprosin 0.001 Protein destinationand storage

1460 Caffeoyl-CoA 3-O-methyltransferase 0.000 Secondarymetabolism

1462 20S Proteasome alpha subunit B, putative 0.000 Protein destinationand storage

1543 Putative transcription factor Btf3 0.040 Signal transduction

1546 Elicitor-inducible protein EIG-J7 0.019 Disease/defense

Proteomics 2009, 9, 4154–4175 4165

Table 1. Continued

Spotnumber

1564 Mitochondrial malate dehydrogenase 0.001 Energy

Proteinase inhibitor homologue – Merops family I03.0171572 Wound-induced protein (with chitin-binding domain 0.001 Disease/defense

Proteinase inhibitor – Merops family I20.UPW Protein destinationand storage

Putative ubiquitin extension protein1580 Glutaredoxin 0.043 Disease/defense

1593 Peroxidase 0.031 Secondarymetabolism

1647 Kunitz-type protease inhibitor precursor – Merops family I20.001 0.006 Disease/defense

Table 1. Continued

Spotnumber

1790 Miraculin (low homology) – Merops family I03.UNA 0.000 Disease/defense

1863 Ascorbate peroxidase 0.000 Secondarymetabolism

1878 Proteinase inhibitor precursor – Merops family I03.020 0.000 Disease/defense

1929 Chitinase 0.002 Disease/defense

2190 SOD [Mn], mitochondrial 0.002 Disease/defense

Miraculin (low homology) – Merops family I03.UNA2275 Catalase isozyme 1-like protein 0.001 Disease/defense

2501 Chitin-binding lectin 1 (not securely identified) 0.006 Disease/defense

Proteomics 2009, 9, 4154–4175 4167

3.5 Proteins from the native periderm

For identification of polypeptides from the native periderm

only spots present in at least four replicates (peels from four

distinct tubers) were considered and excised for MS identi-

fication (91 spots analysed and about 90% identified). The

results are presented in Table 2 and Table S2 (Supporting

Information material with additional information).

The major proteins that were identified can be grouped

in the similar Bevan et al. [28] functional categories referred

for the slices. Some differences between proteins identified

in the slices and in the native periderm are however

apparent. For instance, it seems that there is still a higher

preponderance of disease/defence proteins in the periderm

than in the slices, and in what concerns the protease inhi-

bitors, the periderm has, like the slices, the Merops families

I03 and I20, but members of the I13 and I25 families were

additionally detected.

4 Discussion

Slicing triggers in the potato storage tissue a marked

increase in respiration [18, 30] and a dedifferentiation

Table 1. Continued

Spotnumber

2506 Chitin-binding lectin 1 (not securely identified) 0.023 Disease/defense

2510 Formate dehydrogenase, mitochondrial 0.050 Energy

2580 34 kDa Outer mitochondrial membrane protein porin-like protein 0.008 Disease/defense

2275875

6%) 380374

1929865

2421447

1450780

1564 1192545 1622

9691284 447733

36 1067

6112420

175371

25011350

299 2580

141232

251459249 464

453456238

335233455

121126

1035388 1151345

1790259

9641076

15391647189

2545 1622969

1572211

24581578

d = 0.2

18631458

810 246 398905

4521543

-10 -5 0 5 10PC1

(61.16%)

Figure 4. PCA of differentially expressed wound-induced proteins (p-value o0.05) from potato tuber slices for sampling dates D0, D1, D2,

D4, D6 and D8; (A) main plane (PC1–PC2) showing the position of the mean value resulting from analysis of the five replicate gels of each

sampling date; (B) correlation circle showing the position of proteins on the PC1–PC2 plane (see spot numbering in Table 1).

Figure 5. Distance tree (rectangle representation) for the protease inhibitors of the Merops family I03 detected in the potato slices,

produced using BLAST pair-wise alignments. The Merops classification is indicated.

Proteomics 2009, 9, 4154–4175 4169

Table 2. Proteins from potato peels identified by MS and previously separated by 2-DE

Spotnumber

Protein identification Functional category

4 Tobacco calretulin Stress response26S proteasome regulatory subunit S5A Protein destination and

storage6 Suberisation-associated anionic peroxidase 2 precursor (TMP2) Secondary metabolism20 Nascent polypeptide-associated complex subunit alpha-like protein 3 Intracellular traffic33 Not identified40 Kunitz proteinase inhibitor homologue (sexual organ expressed protein) – Merops family

I03.017Disease/defense

Calmodulin-5/6/7/8 Signal transduction45 Not identified46 Calreticulin precursor Protein destination and

storage47 Abscisic stress ripening protein Transcription48 Abscisic stress ripening protein Transcription70 Patatin Protein destination and

storage72 Patatin precursor Protein destination and

storage113a Drought-induced protein sdi-6 Unclear classification

Patatin precursor Protein destination andstorage

113b No significant homologue found –114 Kunitz-type enzyme inhibitor S9C11 – Merops family I03.017 Disease/defense115 Kunitz-type enzyme inhibitor S9C11 – Merops family I03.017 Disease/defense116 Cysteine protease inhibitor – Merops family I03.017 Disease/defense117 Cysteine protease inhibitor – Merops family I03.017 Disease/defense128 Miraculin (low homology) – Merops family I03.UNA Disease/defense129 Miraculin (low homology) – Merops family I03.UNA Disease/defense

Chloroplast processing enzyme Protein destination andstorage

130 Miraculin (low homology) – Merops family I03.UNA Disease/defense131 Kunitz-type proteinase inhibitor – Merops family I03.020 Disease/defense147 Proteinase inhibitor – Merops family I13.UPW Disease/defense148 Proteinase inhibitor – Merops family I20.UPW Disease/defense171 Patatin precursor Protein destination and

storage175 Peroxidase 1 Secondary metabolism177 Patatin precursor Protein destination and

storage203 Pathogenesis-related protein 10 Disease/defense204 Miraculin (low homology) – Merops family I03.UNA Disease/defense205 Pathogenesis-related protein 10 Disease/defense

Chloroplast small heat shock protein class I Disease/defense206 Pathogenesis-related protein 10 Disease/defense221 Kunitz-type enzyme inhibitor S9C11 – Merops family I03.017 Disease/defense228 Enolase Energy273 Proteinase inhibitor – Merops family I03.030 Disease/defense274 Kunitz-type protease inhibitor precursor – Merops family I03.020 Disease/defense275 Pathogenesis-related protein 10 Disease/defense276 Putative miraculin – Merops family I03.UNA Disease/defense293 Catalase Secondary metabolism

Table 2. Continued

Spotnumber

294 Propolyphenol oxidase Secondary metabolismCatalase Secondary metabolism

312 Formate dehydrogenase Energy313 Endochitinase 2 precursor Disease/defense314 Not identified331 Kunitz proteinase inhibitor homologue (sexual organ expressed protein) – Merops family

I03.017Disease/defense

332 Kunitz proteinase inhibitor homologue (sexual organ expressed protein) – Merops familyI03.017

Disease/defense

358 Cold inducible; similar to other osmotic stress-induced gene products including: tomatoabscisic st

Disease/defense

368 Not identified385 Peroxidase Secondary metabolism386 Peroxidase Secondary metabolism387 Putative mitochondrial NAD-dependent malate dehydrogenase Energy388 Fructose-1,6-bisphosphate aldolase Metabolism389 Peroxidase Secondary metabolism407 Osmotin-like protein Disease/defense408 Miraculin (low homology) – Merops family I03.UNA Disease/defense409 Kunitz proteinase inhibitor homologue (sexual organ expressed protein) – Merops family

I03.017Unclear classification

410 Proteasome subunit alpha type-7 Protein destination andstorage

419 Putative pathogen-induced protein Disease/defense420 Pathogenesis-related protein Disease/defense421 Aspartic protease inhibitor precursor Disease/defense436 Cold inducible; similar to other osmotic stress-induced gene products including: tomato

abscisic stDisease/defense

448 Peroxidase Secondary metabolism449 Propolyphenol oxidase Secondary metabolism452 Peroxidase Secondary metabolism471 Endochitinase 4 precursor Disease/defense472 Peroxidase Secondary metabolism473 Peroxidase Secondary metabolism474 Peroxidase precursor Secondary metabolism

Glyceraldehyde 3-phosphate dehydrogenase Energy475 Peroxidase Secondary metabolism476 Glucan endo-1,3-beta-glucosidase Metabolism477 Peroxidase Secondary metabolism481 Porin Transporters

1,3-Beta-glucan glucanohydrolase Metabolism516 Cysteine protease inhibitor precursor – Merops family I03.017 Disease/defense517 Aspartic proteinase inhibitor precursor – Merops family I03.002 Disease/defense518 Kunitz-type protease inhibitor precursor – Merops family I03.020 Disease/defense539 Kunitz-type trypsin inhibitor – Merops family I03.017 Disease/defense557 Peroxidase Secondary metabolism558 Putative peroxidase Secondary metabolism559 Polygalacturonase inhibitor protein Disease/defense561 Peroxidase precursor Secondary metabolism581 Peroxidase Secondary metabolism

Glucan endo-1,3-beta-glucosidase Metabolism582 Peroxidase Secondary metabolism583 Endochitinase 1 precursor Disease/defense585 Acid phosphatase Metabolism596 Putative Kunitz-type tuber invertase inhibitor precursor – Merops family I03.017 Disease/defense597 Cysteine protease inhibitor – Merops family I03.002 Disease/defense598 Psmotin-like protein OSML81 precursor Disease/defense616 Cyclophilin Signal transduction

Aspartic protease inhibitor – Merops family I03.002 Disease/defense

Proteomics 2009, 9, 4154–4175 4171

process [18, 31] with formation of a wound-periderm [5],

which involves the activation of many genes. In general

terms we can consider that the alterations in the slices

proteins that we are here reporting are related to those

profound changes in metabolism that are triggered by

excision. The PCA representation clearly shows a progres-

sion of interrelated events defining two major groups of the

sampling dates (D0, D1, D2 and D4, D6, D8), which

suggests a sequence of metabolic process occurring with

time. Interestingly, by applying a PCA to non-polar meta-

bolite profiles of potato slices, Yang and Bernards [32] also

observed a progression of changes with time that defined

three main clusters (D0–D2, D3–D4 and D5–D7).

The storage proteins of the potato tuber should have a

marked contribution to the wound induced events. Patatins

and protease inhibitors form the bulk of the tuber protein

and are mostly considered to be storage proteins [33]. The

high MW forms of patatins we detect at D0–D1 (steadily

decreasing to D8) and the lower MW forms of D4–D6 have

similar sequences, which suggests that these last ones are

mainly degradation products of the tuber patatins. About

their role in the cell, patatins are mainly localised in the

vacuoles, where they are inactive, but cytosolic forms with

lipid acyl-hydrolase activity were detected [34] and there are

indications they have other enzymatic activities and parti-

cipate in resistance reactions induced by pathogen attack

Regarding the protease inhibitors, they also form a

numerous group of proteins in the slices. The fact that the

different classes detected have distinct expression patterns

along the sampling dates suggests that they may have

complex and marked roles during the wound-healing

process. Their participation in defence and in the regulation

of proteolysis associated with development could be

proposed. Induction in response to wounding was referred

[36, 37], as well as involvement in several developmental

processes, such as programmed cell death [38]. A complexity

of functions for the inhibitors in the wound-healing

process is further stressed by the presence in the native

periderm of two families (I13 and I25) that we did not

detect in the slices. These two families of inhibitors

have been considered to be important in pathogen defence

Of the several responses activated by wounding, suber-

isation is certainly of great significance since suberin

deposition in the cell wall acts as a physical barrier against

water movement and pathogen attack [1, 3]. At D4 the

polyaliphatic domain of the suberin layer was already

evident, which agrees with the Lulai and Corsini [40] report

that the tubers acquired total resistance to fungal infection

from the 5th to the 7th day after wounding, when complete

deposition of the suberin aliphatic domain on the 1st cell’s

layer was reached. Some of the proteins expressed in the

D6–D8 slices are similar to proteins detected in the native

periderm (including a suberisation-associated anionic

peroxidase), which suggests that the slice metabolism in the

later stages tends to acquire similarities to that of the native

periderm. However, the gel patterns of the two tissues still

differed and it is possible that a higher similarity could be

reached at a later stage. In fact, Stark et al. [5] stated that

periderm formation in the potato slices is an extended

process that continues for at least 14 days, with the

deposition of aliphatic long-chain species dominating from

the 7th day onwards. Nevertheless, it is interesting to find

that both histological observations and immunolabelling

analyses indicate that there are differences in the cell walls

of wound versus native periderm [3].

ROS that are known to be produced in association with

stress (oxidative burst) play a central role in wound response

[41], and at least four successive peaks of oxidative burst

were observed in association with potato wounding [42].

ROS have a dual nature, being cytotoxic exacerbate damage

but, at the same time, have a key role in regulation of

defence mechanisms [41] by activating genes, for instance of

the phenylpropanoid pathway [43], and by participating in

pathogen response [10]. Plants have very efficient anti-

oxidant defence systems either enzymatic or non-enzymatic,

which allow scavenging of ROS and protection of cells

against oxidative damage [44].

GST is an important protein in cell protection against

ROS, being responsible for the complexation of GSH to a

variety of compounds later subjected to cellular detoxifica-

tion. The identification of GST forms, one with a maximum

of expression during D4–D8, suggests a very important role

for GST throughout the slice wound-healing process. The

presence of superoxide dismutase (SOD), glutaredoxin and

Table 2. Continued

Spotnumber

617 Pathogenesis-related protein PR-1 precursor Disease/defense627 Kunitz proteinase inhibitor homologue (stigma expressed protein) – Merops family I03.017 Disease/defense630 Cystatin Disease/defense

Putative non-specific lipid transfer protein Disease/defenseProbable protease inhibitor P322 precursor Disease/defense

631 Probable protease inhibitor P322 precursor Disease/defense681 Plant basic secretory protein Disease/defense

catalases is also significant when considering protection

from ROS.

The activation of inducible defence mechanisms that

result in the production of a diversity of antimicrobial

compounds, such as phenols [45] and peptides (e.g. PR and

PR-like proteins) [6], is also of crucial importance during the

wound-healing process. Several proteins belonging to some

of the 19 groups of PR families [6], were also detected: beta-

1,3-glucanase (PR-2); chitinases (PR-3); osmotins (PR-5);

protease inhibitors (PR-6); plant peroxidases (PR-9); PR-10

proteins. This observation indicates that PR proteins are

greatly implicated in the metabolic changes that occur upon

slicing. It is known that they are strongly induced by

wounding or infection (fungal, bacterial or viral) and that

they contribute to plant defence [46] but, in addition, parti-

cipate in many physiological and developmental processes,

including embryogenesis and abscission [6]. The fact that

these proteins are well represented during D4–D8 indicates

a role in the later stages of wound-healing, such as protec-

tion and cell-wall reconstruction (see Lulai [3]). Noticeably,

many disease/defence proteins were also detected in the

native periderm, in agreement with a previous report [16],

stressing the protective function of that structure.

Secondary metabolites also play a crucial role in many

plant processes and their synthesis should be intensified

during the healing reconstruction in the slices. Important

compounds such as, lignin, suberin, wall-bound phenolics

and flavonoids derive their building units from the phenyl-

propanoid pathway and are important in defence and tissue

reconstruction [47, 48]. The identification of caffeoyl-CoA

methyltransferase and several peroxidases is of relevance.

The peroxidases detected during D4–D8 could, in addition

to a defence role, participate in the crosslinking of the

hydroxycinamic alcohols that constitute lignin and the

polyphenolic domain of suberin [49, 50]. The detection of a

suberisation-associated anionic peroxidase, also present in

the native periderm, supports the observation of cell-wall

strengthening during the wound-healing process.

Additional information on the succession of events

leading to slice healing is given by the identification of

proteins participating in other important metabolic proces-

ses, such as carbohydrate metabolism, transport, transcrip-

tion, signal transduction and cell structure. For instance, the

identification of metacaspase, proteosoma sub-units and

polyubiquitin reinforces the importance of proteolysis in

these processes, also indicated by the presence of the

protease inhibitors. Furthermore, identification of actin and

annexin is indicative of profound alterations in cellular

metabolism, with emphasis on cell structure reorganisation,

since annexin is known to participate in Ca21-dependent

intracellular signaling, Golgi-mediated polysaccharide

segregation and in the interaction with several cellular

compounds involved in cell organisation [51, 52].

In conclusion, we present proteomic evidence for the

wound-healing mechanisms of potato tissue and highlight

the succession of several interrelated phases where different

classes of proteins participate. The data add information for

a more comprehensive picture of these processes. The

important roles for some proteins are indicated, but their

precise function needs to be investigated in detail in order to

recognise well the key steps of the healing mechanisms in

plants. Since potato slices are a good model system to study

suberin formation, this work could be useful as a starting

point for a broader goal that is the study of suberin and cork

formation.

The technical skills of Isabel Martins and Ana MargaridaSantos in the microscopic observations of the slices areacknowledged. This work was supported by project FCT/POCTI/39011/AGR/2001. I.C. acknowledges an FCT grant (SFRH/BPD/20833/2004).

The authors have declared no conflict of interest.

5 References

[1] Kolattukudy, P. E., Biopolyester Membranes of Plants: Cutin

and Suberin. Science 1980, 208, 990–1000.

[2] Sabba, R. P., Lulai, E. C., Histological analysis of the

maturation of native and wound periderm in potato (Sola-

num tuberosum L.) tuber. Annals of Botany 2002, 90, 1–10.

[3] Lulai, E., Skin-Set, Wound Healing, and Related Defects, in:

Vreugdenhil, D. (Ed.), Potato Biology and Biotechnology:

Advances and Perspectives, Elsevier BV 2007.

[4] Fry, S., Cross-linking of matrix polymers in the growing cell

walls of angiosperms. Annu. Rev. Plant Physiol. 1986, 37,

165–186.

[5] Stark, R. E., Sohn, W., Pacchiano,R. A., Jr., Al-Bashir, M.,

Garbow, J. R., Following suberization in potato wound peri-

derm by histochemical and solid-state 13C nuclear magnetic

resonance methods. Plant Physiol. 1994, 104, 527–533.

[6] van Loon, L. C., Rep, M., Pieterse, C. M. J., Significance of

inducible defense-related proteins in infected plants. Annu.

Rev. Phytopathol. 2006, 44, 135–162.

[7] Bowles, D. J., Defense-related proteins in higher plants.

Annu. Rev. Biochem. 1990, 59, 873–907.

[8] Richards, H. M., The respiration of wounded plants, with

woodcuts 2 and 3. Ann. Bot. 1896, 10, 531–583.

[9] Rees, T. A., Beevers, H., Pentose phosphate pathway as a

major component of induced respiration of carrot and

potato slices. Plant Physiol. 1960, 35, 839–847.

[10] Zhou, L., Thornburg, R. W., in: Reynolds, P., (Ed.), Inducible

Gene Expression in Plants, CAB International, Wallingford,

UK 1999, pp. 127–167.

[11] Gallardo, K. C. S., Vandekerckhove, J. R. T., Burstin, J.,

Proteomics of Medicago truncatula seed development estab-

lishes the time frame of diverse metabolic processes related

to reserve accumulation. Plant Physiol. 2003, 133, 664–682.

[12] Abbasi, F., Komatsu, S., A proteomic approach to analyze

salt-responsive proteins in rice leaf sheath. Proteomics

2004, 4, 2072–2081.

Proteomics 2009, 9, 4154–4175 4173

[13] Zhu, H., Bilgin, M., Snyder, M., Proteomics. Annu. Rev.

Biochem. 2003, 72, 783–812.

[14] Ippel, J., Pouvreau, L., Kroef, T., Gruppen, H. et al., In vivo

uniform 15N-isotope labelling of plants: using the green-

house for structural proteomics. Proteomics 2003, 4,

226–234.

[15] Satu, J., Lehesranta, S., Davies, H., Shepherd, L. et al.,

Comparison of tuber proteomes of potato varieties, land-

races, and genetically modified lines. Plant Physiol. 2005,

138, 1690–1699.

[16] Barel, G., Ginzberg, I., Potato skin proteome is enriched with

plant defence components. J. Exp. Bot. 2008, 59, 3347–3357.

[17] Delaplace, P., Fauconnier, M. L., Sergeant, K., Dierick, J. F.

et al., Potato (Solanum tuberosum L.) tuber ageing induces

changes in the proteome and antioxidants associated with

the sprouting pattern. J. Exp. Bot. 2009, 60, 1273–1288.

[18] Laties, G. G., Controlling influence of thickness on devel-

opment and type of respiratory activity in potato slices.

Plant Physiol. 1962, 37, 679–690.

[19] Krishnamurthy, K. V., Methods in Cell Wall Cytochemistry,

Humana Press, New Jersey 1999.

[20] Ramagli, L. S., in: Link, A. J. (Ed.), Methods in Molecular

Biology, Humana Press, New Jersey 1999, pp. 95–105.

[21] Neuhoff, V., Stamm, R., Eibl, H., Clear background and

highly sensitive protein staining with coomassie blue dyes

in polyacrylamide gels: a systematic analysis. Electrophor-

esis 1985, 6, 427–448.

[22] Smyth, G. K., in: Gentleman, R., Carey, V., Dudoit, S.,

Irizarry, R., Huber, W. (Eds.), Bioinformatics and Computa-

tional Biology Solutions using R and Bioconductor,

Springer, New York 2005, pp. 397–420.

[23] Benjamini, Y., Hochberg, Y., Controlling the false discovery

rate-a practical and powerful approach to multiple testing.

J. R. Stat. Soc. Series B 1995 57, 289–300.

[24] Chessel, D., Dufour, A. B., Thioulouse, J., The ade4 package-

I-One-table methods. R news 2004, 4, 5–10.

[25] Bohler, S., Bagard, M., Oufir, M., Planchon, S. et al., A DIGE

analysis of developing poplar leaves subjected to ozone

reveals major changes in carbon metabolism. Proteomics

2007, 7, 1584–1599.

[26] Mackey, A., Haystead, T., Pearson, W., Getting more from

less: algorithms for rapid protein identification with multi-

ple short peptide sequences. Mol. Cell. Proteomics 2002, 1,

139–147.

[27] Samyn, B., Sergeant, K., Carpentier, S., Debyser, G. et al.,

Functional proteome analysis of the banana plant (Musa

spp.) using de novo sequence analysis of derivatized

peptides. J. Proteome Res. 2007, 6, 70–80.

[28] Bevan, M., Bancroft, I., Bent, E., Love, K. et al., Analysis of

1.9 Mb of contiguous sequence from chromosome 4 of

Arabidopsis thaliana. Nature 1998, 391, 485–488.

[29] Rawlings, N., Morton, F., Kok, C., Kong, J., Barrett, A.,

MEROPS: the peptidase database. Nucleic Acids Res. 2008,

36, D320–D325.

[30] Wadso, L., Gomezb, F., Sjoholmb, I., Rocculic, P., Effect of

tissue wounding on the results from calorimetric

measurements of vegetable respiration. Thermochim. Acta

2004, 422, 89–93.

[31] Fabbri, A. A., Fanelli, C., Reverberi, M., Ricelli, A. et al., Early

physiological and cytological events induced by wounding

in potato tuber. J. Exp. Bot. 2000, 51, 1267–1275.

[32] Yang, W., Bernards, M. A., Metabolomic Analysis of wound-

induced suberization in potato (Solanum tuberosum L.)

tubers. Metabolomics 2007, 3, 147–159.

[33] Bauw, G., Nielsen, H. V., Emmersen, J., Nielsen, K. L. et al.,

Patatins, Kunitz protease inhibitors and other major

proteins in tuber of potato cv. Kuras. FEBS J. 2006, 273,

3569–3584.

[34] Hirschberg, H. J. H. B., Simons, F. A. J., Dekker, N., Egmond,

M. R., Cloning, expression, purification and characterization

of patatin, a novel phospholipase A. Eur. J. Biochem. 2001,

268, 5037–5044.

[35] Kumar, G. N. M., Houtz, R. L., Knowles, N. R., Age-induced

protein modifications and increased proteolysis in potato

seed-tubers. Plant Physiol. 1999, 119, 89–99.

[36] Major, I. T., Constabel, C. P., Functional analysis of the

Kunitz trypsin inhibitor family in poplar reveals biochemical

diversity and multiplicity in defense against herbivores.

Plant Physiol. 2008, 146, 888–903.

[37] Gruden, K., Strukelj, B., Popovic, T., Lenarcic, B. et al., The

cysteine protease activity of Colorado potato beetle (Lepti-

notarsa decemlineata Say) guts, which is insensitive to

potato protease inhibitors, is inhibited by thyroglobulin

type-1 domain inhibitors. Insect Biochem. Mol. Biol. 1998,

28, 549–560.

[38] Solomon, M., Belenghi, B., Delledone, M., Meachem, E.,

Levine, A., The involvement of cysteine proteases inhibitor

genes in the regulation of programmed cell death in plants.

Plant Cell 1999, 11, 431–443.

[39] Habib, H., Fazili, K. M., Plant protease inhibitors: a

defense strategy in plants. Biotechnol. Mol. Biol. Rev. 2007,

2, 68–85.

[40] Lulai, E. C., Corsini, D. L., Differential deposition of suberin

phenolic and aliphatic domains and their roles in resistance

to infection during potato tuber (Solanum tuberosum L.)

wound-healing. Physiol. Mol. Plant Pathol. 1998, 53, 209–222.

[41] Foyer, C., Noctor, G., Oxidant and antioxidant signalling in

plants: a re-evaluation of the concept of oxidative stress in a

physiological context. Plant Cell Environ. 2005, 28, 1056–1071.

[42] Razem, F., Bernards, M., Reactive oxygen species produc-

tion in association with suberization: evidence for an

NADPH-dependent oxidase. J. Exp. Bot. 2003, 54, 935–941.

[43] Saltveit, M. E., Choi, Y. J., Tomas-Barberan, F. A., Involve-

ment of components of the phospholipid-signaling path-

way in wound-induced phenylpropanoid metabolism in

lettuce (Lactuca sativa) leaf tissue. Physiol. Plantarum 2005,

125, 345–355.

[44] Vranova, E., Inze, D. F. V. B., Signal transduction during

oxidative stress. J. Exp. Bot. 2002, 53, 1227–1236.

[45] Bowles, D., Signal transduction in the wound response of

tomato plants. Phil. Trans. Roy. Soc. Lond. B Biol. Sci. 1998,

353, 1495–1510.

[46] Van Loon, L. C., Van Strien, E. A., The families of patho-

genesis-related proteins, their activities, and comparative

analysis of PR-1 type proteins. Physiol. Mol. Plant Pathol.

1999, 55, 85–97.

[47] Hayashi, M., Takahashi, H., Tamura, K., Huang, J. et al.,

Enhanced dihydroflavonol-4-reductase activity and NAD

homeostasis leading to cell death tolerance in transgenic

rice. Proc. Natl. Acad. Sci. USA 2005, 102, 7020–7025.

[48] Xie, D.-Y., Jackson, L. A., Cooper, J. D., Ferreira, D., Paiva,

N. L., Molecular and biochemical analysis of two cDNA

clones encoding dihydroflavonol-4-reductase from Medi-

cago truncatula. Plant Physiol. 2004, 134, 979–994.

[49] Bernards, M. A., Demystifying suberin. Can. J. Bot. 2002, 80,

227–240.

[50] Lewis, N. G., Yamamoto, E., Lignin: occurrence, biogenesis

and biodegradation. Annu. Rev. Plant Physiol. Plant Mol.

Biol. 1990, 41, 455–496.

[51] Delmer, D. P., Potikha, T. S., Structures and functions of

annexins in plants. Cell. Mol. Life Sci. 1997, 53, 546–553.

[52] Hofmann, A., Annexin in the plant kingdom: perspectives

and potentials. Annexins 2004, 1, 51–61.

Proteomics 2009, 9, 4154–4175 4175

Supporting Information

for Proteomics

DOI 10.1002/pmic.200700649

Ines Chaves, Carla Pinheiro, Jorge A. P. Paiva, Sebastien Planchon,

Kjell Sergeant, Jenny Renaut, Jose A. Grac-a, Gonc-alo Costa,

Ana V. Coelho and Candido P. P. Ricardo

Proteomic evaluation of wound-healing processes

in potato (Solanum tuberosum L.) tuber tissue

Table S1: Additional information regarding the polipeptide spots identified in the slices

color code more than one protein ID per spot

not ID with significant score

Sample name Organism Gi Accession EST Gi Accession Experim. Mr Calc. Mr Mass ∆ MC Pept. score Sequences

38 nascent polypeptide associated complex alpha Solanum chacoense 115272654 1518.9574 1518.8809 0.0765 0 103 K.NILFVISKPDVFK.S

1526.8039 1526.7252 0.0787 0 89 K.SPNSDTYVIFGEAK.I

1540.8177 1540.7409 0.0768 0 (83) K.SPNSDTYVIFGEAK.I + Me-ester (DE)

1734.0612 1734.0079 0.0533 1 129 K.SKNILFVISKPDVFK.S

1920.9800 1920.9428 0.0372 0 101 K.IEDLSSQLQSQAAEQFK.A

1934.9944 1934.9585 0.0359 0 (55) K.IEDLSSQLQSQAAEQFK.A + Me-ester (DE)

98 calreticulin Nicotiana plumbaginifolia 21375852 1419088 1464.9140 1464.8340 0.0800 1 58 K.LKYVGVELWQVK.S + kynurenin (W)

2041.9485 2041.9302 0.0183 0 91 K.SGTLFDNVVICDDPEYAK.S

2055.9651 2055.9459 0.0192 0 (90) K.SGTLFDNVVICDDPEYAK.S + Me-ester (DE)

1908.8227 1908.7802 0.0426 0 70 P.EVFFEESFNDGWESR.W + DOUBLE Ox (W)

1880.8227 1880.7852 0.0375 0 71 P.EVFFEESFNDGWESR.W + kynurenin (W)

99 unnamed protein product Vitis vinifera 39834396 157345721 1572.7978 1572.7056 0.0923 1 58 R.KSEYQEPSSEYGR.K + Me-ester (DE)

1584.8256 1584.7420 0.0837 1 43 R.KTEYEEPTAQYGR.K + Me-ester (DE)

1686.8496 1686.7737 0.0760 1 16 R.SEEEDYKKPSYER.R + 2 Me-ester (DE)

1823.8059 1823.7485 0.0574 0 34 K.SEYEEPSSEYGSGYGR.K + 2 Me-ester (DE)

1864.8650 1864.8115 0.0536 1 20 R.KSEYEEPASEYGSGYR.K + Me-ester (DE)

1937.8731 1937.8278 0.0453 1 65 R.KSEYEEPSSEYGSGYGR.K + Me-ester (DE)

1951.8833 1951.8435 0.0398 1 (45) R.KSEYEEPSSEYGSGYGR.K + 2 Me-ester (DE)

1987.9577 1987.9275 0.0302 1 32 R.KSEYEEPKPQYGSGYGR.K + Me-ester (DE)

103 hypothetical protein Vitis vinifera 15260346 225452887 1572.7775 1572.7056 0.0720 1 11 R.KSEYQEPSSEYGR.K + Me-ester (DE)

1596.8087 1596.7420 0.0668 1 30 R.KSEYEEPTPQYGR.K + Me-ester (DE)

1809.8032 1809.7329 0.0703 0 (12) K.SEYEEPSSEYGSGYGR.K + Me-ester (DE)

1823.7998 1823.7485 0.0513 0 27 K.SEYEEPSSEYGSGYGR.K + 2 Me-ester (DE)

1864.8531 1864.8115 0.0417 1 28 R.KSEYEEPASEYGSGYR.K + Me-ester (DE)

1923.8544 1923.8122 0.0422 1 28 R.KSEYEEPSSEYGSGYGR.K

1937.8664 1937.8278 0.0386 1 (25) R.KSEYEEPSSEYGSGYGR.K + Me-ester (DE)

1961.8965 1961.8642 0.0323 1 60 R.KSEYEEPTPEYGSGYGR.K + Me-ester (DE)

Kunitz-type enzyme inhibitor S9C11 - Merops

family I03.017 Solanum tuberosum 62951997 18308088 1309.6583 1309.5687 0.0897 0 85 K.DVNGGFDNGYPR.L

1389.7962 1389.7148 0.0814 0 71 K.LLYCPPQLVCK.D

1763.9610 1763.9134 0.0477 0 104 R.LQALEDDPFPFVFVK.A

1777.9733 1777.9290 0.0443 0 (81) R.LQALEDDPFPFVFVK.A + Me-ester (DE)

2378.2112 2378.2304 -0.0191 0 55 K.CPNDVLLHIPYLGLTGDGTPVK.F

2502.2337 2502.2641 -0.0304 0 183 K.EYIIESPLIEGGSVYLDNIGGHK.C

120 P23 tumor protein-like protein Solanum tuberosum 78748124 76160974 1036.6891 1036.5705 0.1186 1 (25) K.QFVTYIKR.Y + Pyro-glu (N-term Q)

1053.7117 1053.5971 0.1146 1 42 K.QFVTYIKR.Y

1062.6873 1062.5709 0.1164 0 43 K.VVDIVDTFR.L

1202.7343 1202.6295 0.1048 1 60 R.LQEQPAFDKK.Q

1216.7300 1216.6452 0.0849 1 (32) R.LQEQPAFDKK.Q + Me-ester (DE)

1248.7403 1248.6350 0.1054 1 36 K.LEGEAQDAFKK.N + Me-ester (DE)

1663.9053 1663.8457 0.0596 0 117 K.DGSADPTFLYLAPGLK.E

2247.1909 2247.1899 0.0011 2 21 K.VVDIVDTFRLQEQPAFDKK.Q

1389.7989 1389.7148 0.0841 0 71 K.LLYCPPQLVCK.D

2516.2464 2516.2798 -0.0333 0 148 K.EYIIESPLIEGGSVYLDNIGGHK.C + Me-ester (DE)

122 putative drought-induced protein SDi-6-like Olea europaea 21915948 154259313 1826.9159 1826.9050 0.0110 1 95 K.YGKLDETQGIGQYVEK.A

1840.9304 1840.9206 0.0098 1 (65) K.YGKLDETQGIGQYVEK.A + Me-ester (DE)

2500.2066 2500.2233 -0.0167 1 57 K.AETYLHQYGGDKAPAAAPVAEEAK.A + Me-ester (DE)

2514.2232 2514.2390 -0.0158 1 (33) K.AETYLHQYGGDKAPAAAPVAEEAK.A + 2 Me-ester (DE)

Kunitz-type enzyme inhibitor S9C11- Merops

1389.7882 1389.7148 0.0734 0 63 K.LLYCPPQLVCK.D

1763.0098 1762.9657 0.0441 1 88 R.LQALKDDPFPFVFVK.A

2359.1277 2359.1331 -0.0054 1 156 K.VGDEKDFLVTGGTVGNDNTFFK.M

2502.2403 2502.2641 -0.0238 0 135 K.EYIIESPIIEGGSVYLDNIGGHK.C

putative Kunitz-type proteinase inhibitor precursor -

Merops family I03.020 Solanum tuberosum 53695583 20087003 1347.7221 1347.6418 0.0803 0 74 R.YNSDVGPSGTPVR.F

1490.7262 1490.6572 0.0690 0 60 K.SPNSDAPCANGVFR.Y

1799.9820 1799.9457 0.0363 0 65 R.IISTFWGALGGDVYLGK.S + kynurenin (W)

2022.0819 2022.0633 0.0186 1 47 -.LPSDATPVLDVTGKELDPR.L

1608.9002 1608.8412 0.0591 0 R.YFIVSAIWGAGGGGVR.L (Ions score 66)

1624.8932 1624.8361 0.0571 0 27 R.YFIVSAIWGAGGGGVR.L Oxidation (HW) (Ions score 27)

1640.8874 1640.831 0.0564 0 90 R.YFIVSAIWGAGGGGVR.L DOUBLE Ox (W) (Ions score 99)

1527.8102 1527.749 0.0612 0 70 K.YDIISEMSTVNIK.F Oxidation (M) (Ions score 70)

Kunitz proteinase inhibitor homologue (stigma expressed

protein) - Merops family I03.017 Nicotiana alata 53696651 161702913 1125.6240 1125.5124 0.1116 0 46 K.SCVNETVWK.V + kynurenin (W)

1658.8922 1658.8263 0.0659 0 100 K.LGSHFVSENQDVSIK.F

1672.9126 1672.8420 0.0706 0 (86) K.LGSHFVSENQDVSIK.F + Me-ester (DE)

2571.1961 2571.2452 -0.0491 1 89 K.LGSHFVSENQDVSIKFSTSSSSTK.S

2585.2188 2585.2609 -0.0420 1 (55) K.LGSHFVSENQDVSIKFSTSSSSTK.S + Me-ester (DE)

2848.2344 2848.2683 -0.0339 0 15 K.CPNGVVQDSSGEFDNNTPVLFYTMK.L + Oxidation (M); Me-ester (DE)

aspartic protease precursor-like - Merops family

I03.002 Solanum tuberosum 82623417 1420.8527 1420.7966 39.5 0 60 K.AFVLTPEQYILK.T

1393.7827 1393.6911 65.7 0 34 K.VLEYVNQLCEK.I

Kunitz proteinase inhibitor homologue (stigma

expressed protein) - Merops family I03.017 Nicotiana alata 53696651 161702913 1658.8953 1658.8263 0.0690 0 108 K.LGSHFVSENQDVSIK.F

2832.2381 2832.2734 -0.0353 0 (11) K.CPNGVVQDSSGEFDNNTPVLFYTMK.L + Me-ester (DE)

protein) - Merops family I03.017 Nicotiana alata 53696651 161702913 1658.8919 1658.8263 0.0656 0 114 K.LGSHFVSENQDVSIK.F

2571.1951 2571.2452 -0.0501 1 (68) K.LGSHFVSENQDVSIKFSTSSSSTK.S

2585.1988 2585.2609 -0.0620 1 76 K.LGSHFVSENQDVSIKFSTSSSSTK.S + Me-ester (DE)

142 60s acidic ribosomal protein-like protein Solanum tuberosum 15256929 76160941 2354.2598 2354.2692 -0.0094 1 (20) K.ILASVGAEADDDRIELLLSQVK.G

2368.2769 2368.2849 -0.0080 1 25 K.ILASVGAEADDDRIELLLSQVK.G + Me-ester (DE)

2382.2801 2382.3005 -0.0204 1 (22) K.ILASVGAEADDDRIELLLSQVK.G + 2 Me-ester (DE)

142 no significant homology 53696651 2571.2356 2571.2452 -0.0096 1 (23) K.LGSHFVSENQDVSIKFSTSSSSTK.S

2585.2647 2585.2609 0.0039 1 27 K.LGSHFVSENQDVSIKFSTSSSSTK.S + Me-ester (DE)

2834.2437 2834.2527 -0.0089 0 21 K.CPNGVVQDSSGEFDNNTPVLFYTMK.L + Oxidation (M)

164 RAD23-like Solanum tuberosum 11069346 77745475 2141.0996 2141.1004 -0.0007 1 53 K.GTHFEIEVKPEDTVADVKK.S

2483.2837 2483.3271 -0.0433 2 25 K.TLKGTHFEIEVKPEDTVADVKK.S

2556.2251 2556.2642 -0.0391 0 20 K.SIETVQGQDVYPAAQQMLIHQGK.V + Oxidation (M)

11035556 1368.7984 1368.7150 0.0835 0 57 R.LIQEHQADFLR.L

1408.8371 1408.7536 0.0835 0 38 R.ALVLQVFFACNK.N

171 DS2 protein Solanum tuberosum 39819047 23095773 1480.8289 1480.7588 0.0701 1 27 K.KHHFGGLFHHHK.N

2089.1013 2089.0955 0.0058 0 103 K.HLEEIGGLGAVAAGAFALHEK.H

2103.1216 2103.1112 0.0104 0 (59) K.HLEEIGGLGAVAAGAFALHEK.H + Me-ester (DE)

2630.0755 2630.1044 -0.0288 1 24 K.TSYGDSGYGEKPSYGGGDDNKYGEK.T

2691.1446 2691.1460 -0.0013 2 50 K.TSYGDDTYGEKTTTFGDDNKYGEK.T

172 patatin Solanum tuberosum 52619831 21512 1461.7980 1461.7292 0.0688 0 50 K.DIVPFYFEHGPK.I + Me-ester (DE)

1756.9801 1756.9359 0.0442 0 139 R.VHQALTEVAISSFDIK.T

174 patatin Solanum tuberosum 78749067 129640 1132.7007 1132.6492 0.0516 0 50 K.YLLQVLQEK.L

1304.7118 1304.6612 0.0506 0 50 R.LAQEDPAFSSIK.S

78746886 1203.6391 1203.5884 0.0508 0 21 R.AQEDPAFASIR.S

1359.7346 1359.6895 0.0452 1 15 R.RAQEDPAFASIR.S

1855.0692 1855.0454 0.0238 0 58 K.GIIPGTILEFLEGQLQK.M

16215809 1288.7135 1288.6663 0.0472 0 46 R.LAQEDPAFASIK.S

1288.7390 1288.6663 0.0727 0 72 R.LAQEDPAFASIK.S

1595.9058 1595.8558 0.0500 1 66 R.YDGKYLLQVLQEK.L

1436.7431 1436.6783 0.0648 1 52 K.DSPETYEEALKR.F

1450.7575 1450.694 0.0636 1 43 K.DSPETYEEALKR.F + Me-ester (DE)

1464.7749 1464.7096 0.0653 1 46 K.DSPETYEEALKR.F + 2 Me-ester (DE)

179 Ran binding protein-1 Lycopersicon esculentum 13617820 14091665 1408.7427 1408.6735 0.0692 2 31 R.FDKEGSQWKER.G

1559.8295 1559.7732 0.0563 2 49 K.LYRFDKEGSQWK.E + kynurenin (W)

2222.1463 2222.1430 0.0034 0 (76) R.LQEVAVSTGEENEHVLLDLK.S

2236.1587 2236.1586 0.0001 0 107 R.LQEVAVSTGEENEHVLLDLK.S + Me-ester (DE)

2377.1394 2377.1518 -0.0124 0 42 K.ICANHLVLPTMSIQEHAGNEK.S + Oxidation (M)

2391.1507 2391.1674 -0.0167 0 (27) K.ICANHLVLPTMSIQEHAGNEK.S + Oxidation (M); Me-ester (DE)

2630.1211 2630.1529 -0.0318 1 78 K.SCVWHAADFADGELKDETFCIR.F + kynurenin (W)

2658.1204 2658.1478 -0.0274 1 (32) K.SCVWHAADFADGELKDETFCIR.F + DOUBLE Ox (W)

189 glutathione-S-transferase Rheum australe 62890853 197312863 1508.8882 1508.8126 0.0756 1 46 K.VLEPEKLVEYYK.N

1522.8998 1522.8282 0.0716 1 (46) K.VLEPEKLVEYYK.N + Me-ester (DE)

1560.8094 1560.7395 0.0700 0 41 R.LYISYQCPYAQR.V

1668.8576 1668.7995 0.0582 0 119 R.DAQTLAGAQFDYLEK.A

2162.0664 2162.0571 0.0093 0 86 K.FAEELIAYSDTFVPEIYR.S

2176.0806 2176.0728 0.0079 0 (47) K.FAEELIAYSDTFVPEIYR.S + Me-ester (DE)

2938.3727 2938.4559 -0.0832 0 118 M.AAPSVQEVLPPSLDSTSQPPSLFDGTTR.L + Acetyl (N-term)

194 patatin Solanum tuberosum 52568734 169520 1030.5747 1030.4944 0.0803 0 52 R.HSQNNYLR.V

1304.7285 1304.6612 0.0673 0 79 R.LAQEDPAFSSIK.S

1318.7418 1318.6768 0.0650 0 (69) R.LAQEDPAFSSIK.S + Me-ester (DE)

1436.7349 1436.6783 0.0566 1 76 K.DSPETYEEALKR.F

1450.7486 1450.6940 0.0547 1 (60) K.DSPETYEEALKR.F + Me-ester (DE)

1464.7669 1464.7096 0.0573 1 (36) K.DSPETYEEALKR.F + 2 Me-ester (DE)

1527.7564 1527.7214 0.0351 0 2 R.EMYAIHIMFSVR.T + 2 Oxidation (M)

2502.2586 2502.2641 -0.0055 0 194 K.EYIIESPLIEGGSVYLDNIGGHK.C

Kunitz proteinase inhibitor homologue (sexual

organ expressed protein ) - Merops family I03.017 Nicotiana alata 15260995 161702915 1193.6112 1193.5717 0.0396 0 49 K.YETGIPHSYK.L

1207.6266 1207.5873 0.0393 0 (48) K.YETGIPHSYK.L + Me-ester (DE)

1608.8909 1608.8663 0.0246 0 59 R.LALNNKPYPFGFTK.V

Kunitz-type protease inhibitor precursor - Merops

family I03.020 Solanum tuberosum 78747425 73920951 1347.6808 1347.6418 0.0390 0 26 R.YNSDVGPSGTPVR.F

1504.7090 1504.6728 0.0362 0 13 K.SPNSDAPCANGIFR.Y

2938.3169 2938.3542 -0.0372 0 48 K.VGDYDASLGTMLLETGGTIGQADSSWFK.I + Oxidation (M); kynurenin (W)

3070.4822 3070.5399 -0.0577 0 24 R.FIGSSSHFGQGIFENELLNIQFAISTSK.L

1304.7370 1304.6612 0.0758 0 42 R.LAQEDPAFSSIK.S

1436.7357 1436.6783 0.0574 1 70 K.DSPETYEEALKR.F

14643891 1288.7384 1288.6663 0.0721 0 83 R.LAQEDPAFASIK.S

206 patatin Solanum tuberosum 78750474 122201875 1030.4569 1030.4944 -0.0375 0 57 R.HSQNNYLR.V

1304.6361 1304.6612 -0.0251 0 77 R.LAQEDPAFSSIK.S

1318.6502 1318.6768 -0.0266 0 (72) R.LAQEDPAFSSIK.S + Me-ester (DE)

1436.6475 1436.6783 -0.0308 1 88 K.DSPETYEEALKR.F

1450.6635 1450.6940 -0.0304 1 (56) K.DSPETYEEALKR.F + Me-ester (DE)

1464.6789 1464.7096 -0.0307 1 (50) K.DSPETYEEALKR.F + 2 Me-ester (DE)

1975.9969 1976.0214 -0.0245 2 52 K.KPVSKDSPETYEEALKR.F

208 patatin Solanum tuberosum 14644317 122201875 1030.4348 1030.4944 -0.0596 0 45 R.HSQNNYLR.V

1304.6146 1304.6612 -0.0466 0 77 R.LAQEDPAFSSIK.S

1318.6266 1318.6768 -0.0502 0 (71) R.LAQEDPAFSSIK.S + Me-ester (DE)

1436.6353 1436.6783 -0.0430 1 75 K.DSPETYEEALKR.F

1450.6514 1450.6940 -0.0425 1 (74) K.DSPETYEEALKR.F + Me-ester (DE)

1464.6687 1464.7096 -0.0409 1 (42) K.DSPETYEEALKR.F + 2 Me-ester (DE)

2833.4370 2833.3691 0.0679 1 17 K.QMLLLSLGTGTNSEFDKTYTAEEAAK.W + Oxidation (M)

209 pathogenesis-related protein 10 Solanum virginianum 9252603 51317936 2326.1724 2326.1943 -0.0219 1 96 K.YSLIEGDVLGDKLESIAYDVK.F

2340.1880 2340.2100 -0.0220 1 (45) K.YSLIEGDVLGDKLESIAYDVK.F + Me-ester (DE)

1804.9327 1804.8955 0.0372 0 97 M.GVSTFTHESTTTIAPTR.L

putative Kunitz-type proteinase inhibitor precursor -

Merops family I03.020 Solanum tuberosum 46468630 20087003 1347.7448 1347.6418 0.1030 0 40 R.YNSDVGPSGTPVR.F

1490.7504 1490.6572 0.0932 0 31 K.SPNSDAPCANGVFR.Y

214 RNA binding protein-like protein Solanum tuberosum 17071790 76160996 1591.7318 1591.6612 0.0706 0 67 R.GFGFVNFSDEDCAK.E

1605.7399 1605.6769 0.0630 0 (51) R.GFGFVNFSDEDCAK.E + Me-ester (DE)

1805.7864 1805.7352 0.0512 0 19 R.SGGYGGGGDGGYGGGYGGQAR.D

1834.8433 1834.7944 0.0490 1 23 R.SRGFGFVNFSDEDCAK.E

putative Kunitz-type proteinase inhibitor - Merops

family I03.020 Solanum tuberosum 53695392 20386381 1172.6824 1172.5900 0.0925 0 41 K.LCVSYTIWK.V + kynurenin (W)

1347.7252 1347.6418 0.0834 0 60 R.YNSDVGPSGTPVR.F

1799.9325 1799.9457 -0.0132 0 29 R.IISTFWGALGGDVYLGK.S + kynurenin (W)

2938.2854 2938.3542 -0.0687 0 18 K.VGDYDASLGTMLLETGGTIGQADSSWFK.I + Oxidation (M); kynurenin (W)

227 polygalacturonase-like protein-like Solanum tuberosum 17069368 17069368 1607.8733 1607.8307 0.0427 1 21 K.SFADKGGAQLYVPAGK.W

1741.9741 1741.9402 0.0339 0 77 K.TINTVAFQNAIFYLK.S

13179758 2269.0633 2269.0763 -0.0130 0 20 K.SGWDEYGISYGKPTSNVHIR.R + kynurenin (W)

2311.0564 2311.0869 -0.0304 0 (14) K.SGWDEYGISYGKPTSNVHIR.R + DOUBLE Ox (W); Me-ester (DE)

228 Hsp70-interacting protein 1 Vitis labrusca 39818704 166407425 1566.8251 1566.7565 0.0686 1 71 K.LPPAAYDTGDYKEK.S

1635.9327 1635.8654 0.0673 0 15 K.AVLLNPTSAIMYATR.A + Oxidation (M)

228 vacuolar ATPase subunit B

Mesembryanthemum

crystallinum 78748373 26986106 1714.9823 1714.9253 0.0570 0 13 R.VTLFLNLANDPTIER.I

1927.8970 1927.8662 0.0309 0 30 R.GYPGYMYTDLATIYER.A + Oxidation (M)

2254.1729 2254.1745 -0.0016 0 32 R.IFNGSGKPIDNGPPILPEAYR.D

39827621 1595.9727 1595.9035 0.0692 0 28 R.QIYPPINVLPSLSR.L

232 patatin Solanum tuberosum 78750324 84316371 1203.6793 1203.5884 0.0910 0 51 R.AQEDPAFASIR.S

1359.7689 1359.6895 0.0795 1 39 R.RAQEDPAFASIR.S

1477.7735 1477.7048 0.0687 1 47 K.DNPETYEEALKR.F + Me-ester (DE)

1030.5958 1030.4944 0.1014 0 41 R.HSQNNYLR.V

1436.7530 1436.6783 0.0747 1 65 K.DSPETYEEALKR.F

233 patatin Solanum tuberosum 78749311 75221308 1688.8048 1688.9018 -0.0970 0 (100) -.TLGEMVTVLSIDGGGIK.G

1704.8042 1704.8967 -0.0925 0 101 -.TLGEMVTVLSIDGGGIK.G + Oxidation (M)

1756.8496 1756.9359 -0.0863 0 134 R.VHQALTEVAISSFDIK.T

2782.5967 2782.4500 0.1467 1 47 K.GIIPATILEFLEGQLQEVDNNKDAR.L

2796.6099 2796.4657 0.1442 1 (44) K.GIIPATILEFLEGQLQEVDNNKDAR.L + Me-ester (DE)

3642.1880 3641.8035 0.3846 0 40 R.LADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAK.D + Oxidation (M)

14645845 1450.5531 1450.6940 -0.1408 1 57 K.DSPETYEEALKR.F + Me-ester (DE)

234 patatin Solanum tuberosum 78749311 75221308 1688.8900 1688.9018 -0.0118 0 80 -.TLGEMVTVLSIDGGGIK.G

2782.4756 2782.4500 0.0256 1 (46) K.GIIPATILEFLEGQLQEVDNNKDAR.L

2796.4905 2796.4657 0.0248 1 55 K.GIIPATILEFLEGQLQEVDNNKDAR.L + Me-ester (DE)

78749067 1030.4625 1030.4944 -0.0319 0 47 R.HSQNNYLR.V

1450.6708 1450.6940 -0.0231 1 74 K.DSPETYEEALKR.F + Me-ester (DE)

236 patatin Solanum tuberosum 78746886 84316393 1203.6657 1203.5884 0.0774 0 52 R.AQEDPAFASIR.S

1217.6831 1217.6040 0.0791 0 (47) R.AQEDPAFASIR.S + Me-ester (DE)

1359.7564 1359.6895 0.0670 1 42 R.RAQEDPAFASIR.S

237 aspartic proteinase Centaurea calcitrapa 45291712 1665867 1320.7112 1320.6251 0.0861 0 38 K.QSVFSFWFNR.N + kynurenin (W)

1348.7042 1348.6200 0.0842 0 (25) K.QSVFSFWFNR.N + DOUBLE Ox (W)

1531.7699 1531.7064 0.0635 0 64 K.CHFSLACYLHPK.Y

1678.9427 1678.8929 0.0498 0 89 K.FDGILGLGFQEISVGK.A

238 patatin Solanum tuberosum 78751267 84316371 1203.5860 1203.5884 -0.0023 0 63 R.AQEDPAFASIR.S

1217.6013 1217.6040 -0.0027 0 (54) R.AQEDPAFASIR.S + Me-ester (DE)

1359.6865 1359.6895 -0.0029 1 33 R.RAQEDPAFASIR.S

1030.4900 1030.4944 -0.0044 0 42 R.HSQNNYLR.G

1132.6428 1132.6492 -0.0063 0 67 K.YLLQVLQEK.L

1304.7370 1304.6612 0.0758 0 42 R.LAQEDPAFSSIK.S

1436.7357 1436.6783 0.0574 1 70 K.DSPETYEEALKR.F

1288.7384 1288.6663 0.0721 0 83 R.LAQEDPAFASIK.S

242 class II chitinase Solanum tuberosum 39828624 2565307 1296.6712 1296.6172 0.0540 0 (17) R.ELFEQMLSFR.N + Oxidation (M); Pyro-glu (N-term E)

1314.6790 1314.6278 0.0512 0 17 R.ELFEQMLSFR.N + Oxidation (M)

1541.8029 1541.7586 0.0443 0 (59) R.GPIQLTHQSNYER.A

1555.8169 1555.7743 0.0426 0 61 R.GPIQLTHQSNYER.A + Me-ester (DE)

2269.9553 2269.9514 0.0039 0 2 R.YCGMLNVPTGENLDCNNQR.N + Oxidation (M)

2737.3963 2737.4286 -0.0322 0 43 R.AGQGIGVGQDLVNNPDLVATDPIISFK.T

2846.2400 2846.2823 -0.0423 0 49 K.GFYTYDAFIAAANSFPAFGTTGDDTAR.K

246 patatin Solanum tuberosum 78751266 84316399 1046.7288 1046.6124 0.1164 0 52 K.TNKPVIFTK.S

1704.9595 1704.8967 0.0628 0 68 -.TLGEMVTVLSIDGGGIK.G + Oxidation (M)

1785.0147 1784.9672 0.0475 0 (77) R.VHQALTEVAISSFDIK.T + 2 Me-ester (DE)

3641.6216 3641.8035 -0.1818 0 17 R.LADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAK.D + Oxidation (M)

3069.2327 3069.3313 -0.0986 0 41 K.MYDICYSTAAAPTYFPPHYFVTHTSN.G + Oxidation (M)

aspartic protease inhibitor 7 - Merops family

I03.002 Solanum tuberosum 78749727 20137330 1172.6824 1172.5900 0.0925 0 60 K.LCVSYTIWK.V + kynurenin (W)

1517.7273 1517.6569 0.0705 0 59 K.SPNSDAPCPDGVFR.Y

2033.9833 2033.9615 0.0218 0 104 R.TMLLETGGTIGQADSSYFK.I + Oxidation (M)

miraculin (low homology) - Merops family

I03.UNA 53696569 1111.6323 1111.5372 0.0952 0 60 K.LVFCPYGEK.F

1125.6457 1125.5528 0.0929 0 (43) K.LVFCPYGEK.F + Me-ester (DE)

1138.6725 1138.5771 0.0955 1 45 K.AFVFQKDER.I

1608.8990 1608.8412 0.0579 0 (66) R.YFIVSAIWGAGGGGVR.L

1640.8852 1640.8310 0.0542 0 102 R.YFIVSAIWGAGGGGVR.L + DOUBLE Ox (W)

1856.8465 1856.8111 0.0354 0 116 K.FTCQNVGIADENGYNR.L

1870.8578 1870.8268 0.0311 0 (94) K.FTCQNVGIADENGYNR.L + Me-ester (DE)

2065.0972 2065.0843 0.0129 2 48 R.LVLTENEKAFVFQKDER.I

1138.6825 1138.5771 0.1055 1 49 K.AFVFQKDER.I

255 glycine-rich protein 2 Nicotiana sylvestris 18259841 121631 1047.4699 1047.4192 0.0507 0 33 K.CGEDGHFAR.E

1516.7615 1516.7270 0.0345 0 55 K.DGSSDLFVHQSGIR.S

2053.9165 2053.9075 0.0090 0 (21) R.SLSDGEEVEYVIESGNDGR.S

2067.9314 2067.9232 0.0082 0 52 R.SLSDGEEVEYVIESGNDGR.S + Me-ester (DE)

256 chloroplast small heat shock protein class I Capsicum frutescens 15185963 40646966 1024.6337 1024.4978 0.1360 0 (26) R.ETSVFAYAR.I + Pyro-glu (N-term E)

1042.6399 1042.5083 0.1316 0 48 R.ETSVFAYAR.I

1602.8775 1602.8042 0.0734 1 57 R.IDWKETPEAHVFK.V + kynurenin (W)

1716.8440 1716.7815 0.0625 2 53 R.SKEQEEKNDQWHR.M + kynurenin (W)

1078.6927 1078.5811 0.1116 0 45 M.SLIPTFFGR.S + Acetyl (N-term)

257 Patatin Solanum tuberosum 9252316 122201871 1046.7295 1046.6124 0.1171 0 13 K.TNKPVIFTK.S

258 glycine-rich RNA-binding protein Nicotiana tabacum 57962345 187373099 1526.7337 1526.6609 0.0728 1 13 R.REGGGGGYGGGGGYGGGR.R

1647.8341 1647.7715 0.0627 1 35 R.GFGFVTFKDEQAMR.D + Oxidation (M)

1670.7744 1670.7144 0.0600 1 77 R.EGGGGGGYSGGGGGYGGGRR.E

1874.7987 1874.7567 0.0420 1 (10) R.EGGYGGGGGGYGGGDRYSDR.S + Pyro-glu (N-term E)

1892.8102 1892.7672 0.0430 1 13 R.EGGYGGGGGGYGGGDRYSDR.S

259 pathogenesis-related protein 10 Solanum virginianum 9252603 51317936 1430.8247 1430.7252 0.0995 0 98 K.SIEIVEGDGGAGSIK.Q

2326.1492 2326.1943 -0.0451 1 120 K.YSLIEGDVLGDKLESIAYDVK.F

2340.1634 2340.2100 -0.0466 1 (75) K.YSLIEGDVLGDKLESIAYDVK.F + Me-ester (DE)

2647.2195 2647.3162 -0.0967 1 19 K.SIEIVEGDGGAGSIKQMNFVEGGPIK.Y + Oxidation (M)

1804.9327 1804.8955 0.0372 0 122 M.GVSTFTHESTTTIAPTR.L

260 pathogenesis-related protein 10 Solanum virginianum 21920502 51317936 1268.6077 1268.5859 0.0218 0 68 K.QMNFVEGGPFK.Y + Oxidation (M)

13615144 1421.6156 1421.5921 0.0235 0 68 K.FEAYDNGGCVYK.T

1435.6283 1435.6078 0.0206 0 (39) K.FEAYDNGGCVYK.T + Me-ester (DE)

2887310 1845.9 manual GVNTFTHESTTTIAPTRDB ENTRY GVNTYTYESTTTISPTR

262 pathogenesis-related protein 10 Solanum virginianum 9252603 51317936 1638.9021 1638.8439 0.0582 1 52 K.QMNFVEGGPIKYLK.H + Oxidation (M)

1831.9427 1831.9064 0.0363 0 112 M.GVNTFTHESTTTIAPTR.L

1799.9245 1799.9457 -0.0212 0 (23) R.IISTFWGALGGDVYLGK.S + kynurenin (W)

1827.9707 1827.9406 0.0301 0 28 R.IISTFWGALGGDVYLGK.S + DOUBLE Ox (W)

265 copper-zinc superoxide dismutase Cucurbita ficifolia 57962293 140089382 1119.5731 1119.4945 0.0787 0 (43) R.EHGAPEDEVR.H + Pyro-glu (N-term E)

1133.5869 1133.5101 0.0768 0 67 R.EHGAPEDEVR.H + Me-ester (DE); Pyro-glu (N-term E)

1147.6045 1147.5258 0.0788 0 (17) R.EHGAPEDEVR.H + 2 Me-ester (DE); Pyro-glu (N-term E)

2043.0542 2043.0384 0.0158 1 26 R.AVVVHADPDDLGKGGHELSK.S

268 copper-zinc superoxide dismutase Solanum tuberosum 66836762 13445918 1119.6063 1119.4945 0.1119 0 25 K.EHGAPEDEVR.H + Pyro-glu (N-term E)

1133.6184 1133.5101 0.1083 0 (17) K.EHGAPEDEVR.H + Me-ester (DE); Pyro-glu (N-term E)

2057.0476 2057.0541 -0.0065 1 (30) R.AVVVHADPDDLGKGGHELSK.S + Me-ester (DE)

286 enolase Solanum tuberosum 39820071 119354 1826.8527 1826.8686 -0.0158 0 (47) R.IEEELGSEAVYAGASFR.K

1840.8668 1840.8842 -0.0174 0 53 R.IEEELGSEAVYAGASFR.K + Me-ester (DE)

2003.0868 2003.0951 -0.0083 0 40 K.LVLPVPAFNVINGGSHAGNK.L

2251.1240 2251.1219 0.0021 0 45 R.SGETEDTFIADLAVGLSTGQIK.T

17072417 1803.9212 1803.9366 -0.0154 0 75 R.AAVPSGASTGIYEALELR.D

1909.9562 1909.9645 -0.0083 0 12 R.GNPTVEVDVHVSNGVFAR.A + Me-ester (DE)

297 cytosolic ascorbate peroxidase 1 Solanum lycopersicum 52843951 73543248 1662.8896 1662.8437 0.0459 0 41 K.AEQAHGANNGLDIALR.L + Me-ester (DE)

1924.0171 1923.9914 0.0257 1 28 R.FKAEQAHGANNGLDIALR.L

2045.9184 2045.9006 0.0178 0 43 K.YAADEDAFFADYAEAHLK.L

298 cytosolic ascorbate peroxidase 1 Solanum lycopersicum 528443951 73543248 1627.8443 1627.8755 -0.0312 0 (17) K.ALLCDPAFRPLVEK.Y

1641.8623 1641.8912 -0.0289 0 21 K.ALLCDPAFRPLVEK.Y + Me-ester (DE)

1662.8153 1662.8437 -0.0284 0 38 K.AEQAHGANNGLDIALR.L + Me-ester (DE)

1923.9765 1923.9914 -0.0149 1 109 R.FKAEQAHGANNGLDIALR.L

1937.9933 1938.0071 -0.0138 1 (36) R.FKAEQAHGANNGLDIALR.L + Me-ester (DE)

2045.8952 2045.9006 -0.0054 0 118 K.YAADEDAFFADYAEAHLK.L

2059.9090 2059.9163 -0.0073 0 (97) K.YAADEDAFFADYAEAHLK.L + Me-ester (DE)

I03.UNA 39837051 1594.8765 1594.8507 0.0258 0 37 R.LALNNKPYPFGFSK.V

53778384 1193.6167 1193.5717 0.0451 0 50 K.YETGIPHSYK.L

53696651 1658.8511 1658.8263 0.0248 0 30 K.LGSHFVSENQDVSIK.F

gamma interferon responsive lysosomal thiol

reductase family protein Arabidopsis thaliana 14264429 18390723 1118.6776 1118.5754 0.1023 0 22 K.LVTDCVLSGR.G

1520.9004 1520.8272 0.0732 1 32 K.IFKNGMIDIVDLK.L + Oxidation (M)

2033.0474 2033.0218 0.0257 0 24 K.ELELQYAAETNALQPPHK.Y + Pyro-glu (N-term E)

2236.1428 2236.1487 -0.0059 1 (27) R.GKELELQYAAETNALQPPHK.Y

2250.1582 2250.1644 -0.0062 1 29 R.GKELELQYAAETNALQPPHK.Y + Me-ester (DE)

309 copper-zinc superoxide dismutase Solanum lycopersicum 52824837 3334337 1119.6142 1119.4945 0.1198 0 47 K.EHGAPEDEVR.H + Pyro-glu (N-term E)

1368.8721 1368.7725 0.0996 0 68 K.QIPLTGSQSIIGR.A

2318.0808 2318.1026 -0.0217 0 112 R.HAGDLGNITVGEDGTASFTITDK.Q

putative Kunitz-type tuber invertase inhibitor

precursor - Merops family I03.017 Solanum tuberosum 46467791 18140073 1125.5972 1125.4938 0.1034 0 (19) K.SESDYGDVVR.V

1139.6122 1139.5094 0.1028 0 33 K.SESDYGDVVR.V + Me-ester (DE)

1253.6841 1253.5887 0.0954 1 76 R.KSESDYGDVVR.V

1727.9327 1727.8730 0.0597 0 90 N.LVLPEVYDQDGDPLR.I

330 malate dehydrogenase Nicotiana tabacum 13612298 10798652 1856.9944 1856.9454 0.0490 1 (12) K.EFAPSIPEKNITCLTR.L + Pyro-glu (N-term E)

1874.9994 1874.9560 0.0434 1 14 K.EFAPSIPEKNITCLTR.L

1949.9903 1949.9482 0.0421 0 58 K.NGEWSIVQGLPIDEFSR.K + kynurenin (W)

330 glyceraldehyde 3-phosphate dehydrogenase Clematoclethra scandens subsp. tomentella11069613 166864100 2144.0025 2143.9909 0.0116 0 46 K.GILGYTEDDVVSTDFVGDSR.S

expressed protein) - Merops family I03.017 Nicotiana alata 39837051 161702913 1495.8866 1495.8147 0.0720 0 8 K.VAYSIVGPTHSPLR.F

1594.9129 1594.8507 0.0622 0 98 R.LALNNKPYPFGFSK.V

expressed protein) - Merops family I03.017 Nicotiana alata 39837051 161702913 1193.6361 1193.5717 0.0645 0 62 K.YETGIPHSYK.L

1452.7869 1452.7361 0.0508 0 71 K.AGDYTLGPVNPPPR.F

1563.8349 1563.7933 0.0417 1 63 K.IEKYETGIPHSYK.L

1683.9921 1683.9559 0.0362 0 96 R.FVITGGTLGIPGPNTLK.N

2834.2119 2834.2527 -0.0407 0 66 K.CPNGVVQDSSGEFDNNTPVLFYTMK.F + Oxidation (M)

2987.1692 2987.2234 -0.0542 0 89 R.YCPSQYICPTCQFDCADVGLYENK.G

expressed protein) - Merops family I03.017 Nicotiana alata 39837051 161702913 1236.6344 1236.5887 0.0457 0 45 K.YETGRPHSYK.L

1250.6487 1250.6044 0.0444 0 (28) K.YETGRPHSYK.L + Me-ester (DE)

1495.8484 1495.8147 0.0338 0 64 K.VAYSIVGPTHSPLR.F

2987.1765 2987.2234 -0.0469 0 76 R.YCPSQYICPTCQFDCADVGLYENK.G

family I03.020 Solanum tuberosum 13179154 73920925 1017.5558 1017.4590 0.0969 0 36 K.CGSYTIWK.V + kynurenin (W)

2182.0838 2182.0762 0.0077 0 46 R.LLGYELITCDGALVGTMGQR.V + Oxidation (M)

2196.0962 2196.0918 0.0044 0 (2) R.LLGYELITCDGALVGTMGQR.V + Oxidation (M); Me-ester (DE)

2410.1377 2410.1400 -0.0023 1 7 K.VGPYDNEDRVSFLETGQQNSK.S + 2 Me-ester (DE)

2660.1392 2660.1852 -0.0460 0 92 R.GPYGGDIYLDYSPGSTAPCPDGVFR.Y

2816.2271 2816.2863 -0.0592 1 43 K.RGPYGGDIYLDYSPGSTAPCPDGVFR.Y

344 proteinase inhibitor II - Merops family I20.001 Solanum phureja 78747885 29650887 1880.9007 1880.8107 0.0900 0 69 K.SLIYPTGCTTCCTGYK.G

2756.0965 2756.1743 -0.0777 1 13 K.SLIYPTGCTTCCTGYKGCYYFGK.N

344 cytosolic nucleoside diphosphate kinase Solanum chacoense 8070177 73808794 1711.021 1710.9628 0.0583 1 24 R.KIIGATNPLESAAGTIR.G

1582.95 1582.8678 0.0822 0 18 K.IIGATNPLESAAGTIR.G

chloroplast methionine sulfoxide reductase B2

precursor Nicotiana tabacum 8071442 156105710 1059.6973 1059.5713 0.1261 0 25 R.AILSPEQFR.I

345 proteinase inhibitor II - Merops family I20.001 Solanum phureja 14645448 29650887 1823.8589 1823.8116 0.0473 0 101 K.ACTLECGNLGFGICPR.S

1880.8520 1880.8107 0.0413 0 90 K.SLIYPTGCTTCCTGYK.G

3075.1743 3075.2908 -0.1165 1 43 K.GCNYYSANGAFICEGESDPKNPNVCPR.N

41581920 1952.9054 1952.8318 0.0736 0 70 K.SLIYPTECTTCCTGYK.G

371 catalase isozyme 1-like Solanum tuberosum 78750450 83284011 1072.6123 1072.5050 0.1073 0 40 K.SHIQENWR.I + kynurenin (W)

1083.6416 1083.5349 0.1067 0 55 R.IFAYADTQR.H

1608.9547 1608.8875 0.0672 0 39 K.TWPEDLLPLIPVGR.L + kynurenin (W)

1758.8916 1758.8511 0.0405 0 35 R.HMEGFGVHAYQLINK.E + Oxidation (M)

1918.9710 1918.9325 0.0385 0 (54) R.EGNFDLVGNNVPVFFNR.D + Pyro-glu (N-term E)

1936.9728 1936.9431 0.0298 0 81 R.EGNFDLVGNNVPVFFNR.D

1046.7213 1046.6124 0.1089 0 13 K.TNKPVIFTK.S

1436.7570 1436.6783 0.0787 1 34 K.DSPETYEEALKR.F

2677.3516 2677.3962 -0.0446 0 42 R.YEFNLVDGAVATVGDPALLSLSVATR.L

384 endochitinase 2 Solanum tuberosum 13610128 1705808 1831.8860 1831.8423 0.0437 0 39 R.GPIQISHNYNYGPCGR.A

2093.9422 2093.9258 0.0164 0 56 R.YCGILGVSPGDNLDCGNQR.S

2314.2312 2314.2420 -0.0107 0 15 R.AIGVDLLNNPDLVATDSIISFK.S

2888.2503 2888.3405 -0.0901 0 16 K.GNFYSYNAFISAAGSFPGFGTTGDITAR.K

Kunitz proteinase inhibitor homologue (sexual

organ expressed protein) - Merops family I03.017 Nicotiana alata 52824402 161702915 1236.6868 1236.5887 0.0981 0 48 K.YETGRPHSYK.L

1475.8279 1475.7521 0.0758 0 80 K.AGDYTLGPVHPPPR.F

2263.2290 2263.2364 -0.0074 1 (30) R.FVITGGTLGIPGPNTLKNWFK.I + kynurenin (W)

2291.2241 2291.2313 -0.0072 1 70 R.FVITGGTLGIPGPNTLKNWFK.I + DOUBLE Ox (W)

2979.1504 2979.2448 -0.0944 0 35 R.YCPSQFICPTCHFDCADVGLYQNK.G

2585.2088 2585.2609 -0.0520 1 (37) K.LGSHFVSENQDVSIKFSTSSSSTK.S + Me-ester (DE)

aspartic proteinase inhibitor precursor P1E9 -

Merops family I03.002 Solanum tuberosum 22022155 19919828 1172.6226 1172.5900 0.0327 0 58 K.LCVSYTIWK.V + kynurenin (W)

1200.6189 1200.5849 0.0340 0 (55) K.LCVSYTIWK.V + DOUBLE Ox (W)

1410.6436 1410.6197 0.0239 0 62 R.YNSDVGCSGTPVR.F

2548.1797 2548.2015 -0.0218 1 19 R.GALGGDVYLGKSPNSDAPCPDGVFR.Y

435 peroxidase Nicotiana tabacum 39826310 14031049 1088.4910 1088.4960 -0.0050 0 26 K.YYVDLMNR.Q + Oxidation (M)

1140.6194 1140.6251 -0.0057 0 80 R.QDIGQAAGLLR.L

1813.7917 1813.8595 -0.0677 1 42 R.QGLFTSDQDLYTDRR.T

1840.7946 1840.8631 -0.0685 0 42 R.DSVFFSGGPDYDLPLGR.R

1854.8139 1854.8788 -0.0648 0 (18) R.DSVFFSGGPDYDLPLGR.R + Me-ester (DE)

1996.8797 1996.9642 -0.0845 1 27 R.DSVFFSGGPDYDLPLGRR.D

2227.9553 2228.0572 -0.1018 0 17 K.GLSWTFYDSICPNAESIIR.R

444 osmotin-like protein Solanum phureja 39799290 53830831 1110.5921 1110.4512 0.1409 0 17 R.TNCNFDGAGR.G

1144.7401 1144.5989 0.1412 0 24 R.GQTWVINAPR.G + kynurenin (W)

1172.7317 1172.5938 0.1379 0 (17) R.GQTWVINAPR.G + DOUBLE Ox (W)

1919.9571 1919.8948 0.0623 0 17 R.NNCPYTVWAASTPIGGGR.R

2986.0901 2986.2022 -0.1120 0 15 R.CPDAYSYPQDDPTSTFTCPSGSTNYR.V

cysteine protease inhibitor 3 - Merops family

I03.017 Solanum tuberosum 115274899 20137687 1391.7512 1391.6802 0.0710 0 40 K.LLHCPSHLQCK.N

2053.0972 2053.0771 0.0201 2 39 R.LATVDDDKDFIPFVFIKA.-

2081.1243 2081.1084 0.0159 2 (11) R.LATVDDDKDFIPFVFIKA.- + 2 Me-ester (DE)

12587344 1727.9251 1727.8730 30.2 0 35 N.LVLPEVYDEDGNPLR.F

447 osmotin-like protein Solanum phureja 39835010 53830831 1528.9419 1528.8110 0.1309 1 34 R.LDRGQTWVINAPR.G + kynurenin (W)

1919.9552 1919.8948 0.0604 0 (45) R.NNCPYTVWAASTPIGGGR.R

1935.9464 1935.8897 0.0567 0 (24) R.NNCPYTVWAASTPIGGGR.R + Oxidation (HW)

1951.9319 1951.8846 0.0473 0 52 R.NNCPYTVWAASTPIGGGR.R + DOUBLE Ox (W)

2165.9478 2165.9517 -0.0039 0 34 K.CHAIHCTANINGECPGSLR.V

2986.0039 2986.2022 -0.1982 0 24 R.CPDAYSYPQDDPTSTFTCPSGSTNYR.V

1688.0229 1687.9620 0.0609 1 3 R.IISIGRGALGGDVYLGK.S

2047.9947 2047.9772 0.0176 0 (73) R.TMLLETGGTIGQADSSYFK.I + Oxidation (M); Me-ester (DE)

451 proteinase inhibitor II - Merops family I20.001 Solanum lycopersicum 53697332 1161572 1293.6774 1293.5910 0.0864 0 (39) K.FVCEGESIEPK.A

1307.6966 1307.6067 0.0899 0 43 K.FVCEGESIEPK.A + Me-ester (DE)

1376.6831 1376.5965 0.0866 0 54 K.ECGNLGYGICPR.S + Pyro-glu (N-term E)

1394.6868 1394.6071 0.0798 0 (41) K.ECGNLGYGICPR.S

3128.2368 3128.3388 -0.1019 2 43 K.TLIYPTGCTTCCTGYKDCYYFGKDGK.F

Merops family I03.002 Solanum tuberosum 22022155 19919828 1172.7117 1172.5900 0.1218 0 (55) K.LCVSYTIWK.V + kynurenin (W)

1200.7047 1200.5849 0.1198 0 58 K.LCVSYTIWK.V + DOUBLE Ox (W)

2802.4578 2802.5319 -0.0741 0 48 R.FIPLSTNIFENQLLNIQFNIPTVK.L

453 proteinase inhibitor II - Merops family I20.001 Solanum lycopersicum 78748001 1161572 1376.6229 1376.5965 0.0264 0 (62) K.ECGNLGYGICPR.S + Pyro-glu (N-term E)

1394.6319 1394.6071 0.0249 0 66 K.ECGNLGYGICPR.S

2046.8550 2046.8081 0.0469 0 32 R.SEGSTENPICTNCCAGYK.G

2828.2664 2828.1954 0.0710 1 71 K.TLIYPTGCTTCCTGYKDCYYFGK.D

3128.4190 3128.3388 0.0803 2 83 K.TLIYPTGCTTCCTGYKDCYYFGKDGK.F

455 proteinase inhibitor II - Merops family I20.001 Solanum lycopersicum 15260949 1161572 1307.7172 1307.6067 0.1105 0 50 K.FVCEGESIEPK.A + Me-ester (DE)

1376.7057 1376.5965 0.1092 0 (71) K.ECGNLGYGICPR.S + Pyro-glu (N-term E)

1394.7121 1394.6071 0.1051 0 84 K.ECGNLGYGICPR.S

2046.8334 2046.8081 0.0253 0 79 R.SEGSTENPICTNCCAGYK.G

2618.0989 2618.1529 -0.0540 1 92 K.GCNYYSANGIFICEGQSDPKNPK.A

2828.1111 2828.1954 -0.0843 1 73 K.TLIYPTGCTTCCTGYKDCYYFGK.D

456 proteinase inhibitor type-2 - Merops family I20.002 Solanum tuberosum 78748001 3913931 1293.7230 1293.5910 0.1320 0 74 K.FVCEGESIEPK.A

459 proteinase inhibitor II - Merops family I20.001 Solanum phureja 14645448 29650887 1309.6626 1309.5496 0.1130 0 59 K.FVCEGESDEPK.A + Me-ester (DE)

1823.8610 1823.8116 0.0494 0 80 K.ACTLECGNLGFGICPR.S

1837.8754 1837.8273 0.0481 0 (64) K.ACTLECGNLGFGICPR.S + Me-ester (DE)

3075.1519 3075.2908 -0.1389 1 24 K.GCNYYSANGAFICEGESDPKNPNVCPR.N

460 proteinase inhibitor II - Merops family I20.001 Solanum tuberosum 53701576 21522 1309.6006 1309.5496 0.0510 0 19 K.FVCEGESDEPK.A + Me-ester (DE)

1644.7726 1644.7388 0.0338 0 58 K.ACPLNCDPHIAYSK.C

461 proteinase inhibitor II - Merops family I20.001 Solanum tuberosum 46469835 73920935 1644.8026 1644.7388 0.0638 0 59 K.ACPLNCDPHIAYSK.C

1658.8131 1658.7545 0.0586 0 (57) K.ACPLNCDPHIAYSK.C + Me-ester (DE)

2786.0969 2786.1848 -0.0879 1 39 K.SLIYPTGCTTCCTGYKGCYYFSK.N

1951.9379 1951.9066 0.0313 1 118 -.KACTLECGNLGFGICPR.S

2048.9827 2048.9594 0.0234 1 58 D.PKACTLECGNLGFGICPR.S

I03.002 Solanum tuberosum 78748147 20137330 1968.1042 1968.0679 0.0363 1 13 R.RLALVNENPLDVLFQEV.-

53777192 2033.9950 2033.9979 -0.0029 1 57 -.TMLLETGGTIGKADSSYFK.I + Oxidation (M)

509 proteinase inhibitor type-2 - Merops family I20.006 Solanum tuberosum 78748001 3913931 1307.6952 1307.6067 0.0885 0 18 K.FVCEGESIEPK.A + Me-ester (DE)

1394.6933 1394.6071 0.0863 0 (49) K.ECGNLGYGICPR.S

2618.1118 2618.1529 -0.0411 1 58 K.GCNYYSANGIFICEGQSDPKNPK.A

2017.9914 2017.9666 0.0248 0 131 R.TMLLETGGTIGQADSSYFK.I

2033.9881 2033.9615 0.0266 0 (130) R.TMLLETGGTIGQADSSYFK.I + Oxidation (M)

Kunitz-type trypsin inhibitor - Merops family

I03.017 Solanum tuberosum 16215578 24745615 1125.6037 1125.4938 0.1099 0 (37) K.SESDYGDVVR.V

1139.6189 1139.5094 0.1095 0 43 K.SESDYGDVVR.V + Me-ester (DE)

1253.6912 1253.5887 0.1025 1 63 R.KSESDYGDVVR.V

1267.7073 1267.6044 0.1029 1 (45) R.KSESDYGDVVR.V + Me-ester (DE)

1748.9745 1748.9209 0.0536 0 65 N.LVLPEVYDQNGHPLR.I

516 pathogenesis-related protein P2 Solanum lycopersicum 13609938 19976 2020.9969 2020.9755 0.0214 0 46 R.ATYHLYNPQNINWDLR.T + kynurenin (W)

proteinase inhibitor II precursor - Merops family

I20.001 Solanum tuberosum 78748901 73920935 1644.8057 1644.7388 0.0669 0 74 K.ACPLNCDPHIAYSK.C

1837.8760 1837.8273 0.0487 0 (53) K.ACTLECGNLGFGICPR.S + Me-ester (DE)

1951.9419 1951.9066 0.0353 1 120 -.KACTLECGNLGFGICPR.S

2236.9173 2236.9153 0.0020 0 97 K.GCNYYSANGAFICEGQSDPK.K

611 ankyrin-repeat protein HBP1 Nicotiana tabacum 62950350 13310811 1292.7023 1292.6261 0.0762 0 48 K.NTALHYAAGYGR.K

1311.7176 1311.6459 0.0717 1 53 R.YWNDQDVLKK.I + kynurenin (W)

1420.7880 1420.7211 0.0669 1 67 K.NTALHYAAGYGRK.E

1451.7520 1451.6867 0.0653 0 61 R.TALHFACGYGEVK.C

1465.7696 1465.7023 0.0673 0 (51) R.TALHFACGYGEVK.C + Me-ester (DE)

1534.8256 1534.7640 0.0616 1 44 K.NKNTALHYAAGYGR.K

2176.1006 2176.1024 -0.0018 2 10 K.VDALDKNKNTALHYAAGYGR.K

706 unnamed protein product Vitis vinifera 52844302 157355687 1843.9651 1843.9162 0.0489 0 54 K.ISLSEVVDEAGVGGEVER.T

1857.9761 1857.9319 0.0442 0 (31) K.ISLSEVVDEAGVGGEVER.T + Me-ester (DE)

1871.9901 1871.9475 0.0426 0 (29) K.ISLSEVVDEAGVGGEVER.T + 2 Me-ester (DE)

1936.0425 1936.0094 0.0331 0 (29) R.YGPLKPYAVVWVDPNSK.C + kynurenin (W)

1948.0437 1948.0094 0.0343 0 31 R.YGPLKPYAVVWVDPNSK.C + Oxidation (HW)

1964.0536 1964.0043 0.0493 0 (14) R.YGPLKPYAVVWVDPNSK.C + DOUBLE Ox (W)

733 cathepsin D inhibitor - Merops family I03.002 Solanum tuberosum 46829636 470323 1172.7000 1172.5900 0.1101 0 (51) K.LCVSYTIWK.V + kynurenin (W)

1200.6929 1200.5849 0.1080 0 54 K.LCVSYTIWK.V + DOUBLE Ox (W)

1827.9842 1827.9406 0.0436 0 (62) R.IISTFWGALGGDVYLGK.S + DOUBLE Ox (W)

762 metacaspase 1 Lycopersicon esculentum 39820138 23343885 1079.5919 1079.4883 0.1036 0 14 R.NVEDAFESR.G + Me-ester (DE)

1804.9749 1804.9359 0.0390 0 36 K.LRPTLFDVFGEDASPK.V + Me-ester (DE)

2634.1302 2634.2132 -0.0830 0 6 K.ALSDLVGSAESGDCLFVHYSGHGTR.L

2648.1499 2648.2288 -0.0789 0 (4) K.ALSDLVGSAESGDCLFVHYSGHGTR.L + Me-ester (DE)

2689.1785 2689.2395 -0.0609 0 (12) R.FGFAEEDITVLIDTDDSYTQPTGR.N

2703.1863 2703.2551 -0.0688 0 34 R.FGFAEEDITVLIDTDDSYTQPTGR.N + Me-ester (DE)

769 DS2 protein Solanum tuberosum 39819047 23095773 1352.7422 1352.6639 0.0784 0 70 K.HHFGGLFHHHK.N

1480.8256 1480.7588 0.0668 1 57 K.KHHFGGLFHHHK.N

2089.1092 2089.0955 0.0137 0 153 K.HLEEIGGLGAVAAGAFALHEK.H

2103.1258 2103.1112 0.0146 0 (72) K.HLEEIGGLGAVAAGAFALHEK.H + Me-ester (DE)

2317.0093 2317.0121 -0.0028 1 47 K.TTYEETTYGESEKTSTYGEK.T + Me-ester (DE)

2630.0640 2630.1044 -0.0403 1 48 K.TSYGDSGYGEKPSYGGGDDNKYGEK.T

2644.0740 2644.1200 -0.0460 1 (15) K.TSYGDSGYGEKPSYGGGDDNKYGEK.T + Me-ester (DE)

2691.1021 2691.1460 -0.0438 2 46 K.TSYGDDTYGEKTTTFGDDNKYGEK.T

780 peroxidase 1 Sesbania rostrata 39819119 117957301 1872.8888 1872.8490 0.0399 0 113 R.IYDETNNIDSTFASQR.Q

1886.9059 1886.8646 0.0413 0 (83) R.IYDETNNIDSTFASQR.Q + Me-ester (DE)

2024.0670 2024.0439 0.0232 1 28 R.DSVVALHGPTWEVELGRR.D + kynurenin (W)

2052.0620 2052.0388 0.0232 1 (12) R.DSVVALHGPTWEVELGRR.D + 2 Oxidation (HW)

2143.0176 2142.9930 0.0246 1 23 R.NRIYDETNNIDSTFASQR.Q

786 cysteine protease Nicotiana tabacum 13609813 8347420 1666.7201 1666.6535 0.0666 0 (60) K.NSWGADWGEDGYFK.M + DOUBLE Ox (W); kynurenin (W)

1694.7172 1694.6485 0.0688 0 70 K.NSWGADWGEDGYFK.M + 2 DOUBLE Ox (W)

1760.8438 1760.7893 0.0545 0 (103) K.FNGGLDTEEAYPYTGK.N

1774.8585 1774.8049 0.0536 0 128 K.FNGGLDTEEAYPYTGK.N + Me-ester (DE)

1846.1194 1846.0715 0.0479 0 50 K.YAVALVRPVSVAFEVVK.G

1860.1298 1860.0872 0.0426 0 (21) K.YAVALVRPVSVAFEVVK.G + Me-ester (DE

1399.8119 1399.7095 0.1024 1 41 K.DWREDGIVSPVK.A

797 plasma membrane polypeptide Nicotiana tabacum 19802835 2764992 1446.8826 1446.7969 0.0857 0 52 K.VIEIYEAAAVEIK.S

2007.9297 2007.8949 0.0349 2 (35) K.TFDEAKEEYSKEFEEK.K

2021.9341 2021.9105 0.0236 2 56 K.TFDEAKEEYSKEFEEK.K + Me-ester (DE)

2497.2373 2497.2739 -0.0366 0 55 K.AVSEASSNFGPSYVSGPILFVLEK.V

2339.1509 2339.1586 -0.0076 0 77 R.FVITGGTLGFPGPNNIDNWFK.I + DOUBLE Ox (W); Me-ester (DE)

1193.6059 1193.5717 0.0343 0 (62) K.YETGIPHSYK.L

1207.6222 1207.5873 0.0349 0 62 K.YETGIPHSYK.L + Me-ester (DE)

1563.8162 1563.7933 0.0230 1 70 K.IEKYETGIPHSYK.L

810 patatin Solanum tuberosum 46828317 84316395 1756.9519 1756.9359 0.0160 0 136 R.VHQALTEVAISSFDIK.T

826 proteinase inhibitor - Merops family I20.001 Solanum tuberosum 45243152 165906348 2007.8336 2007.8156 0.0180 0 93 K.DYTFICDGESTDWQSGK.A

2537.0469 2537.0692 -0.0223 1 48 K.YFSKDYTFICDGESTDWQSGK.A + kynurenin (W)

2565.0330 2565.0642 -0.0311 1 (34) K.YFSKDYTFICDGESTDWQSGK.A + DOUBLE Ox (W)

2579.0391 2579.0798 -0.0407 1 (29) K.YFSKDYTFICDGESTDWQSGK.A + DOUBLE Ox (W); Me-ester (DE)

1747.7527 1747.7150 21.6 1 66 D.GICINCCSGYKECK.Y

865 actin Gossypium hirsutum 39819729 32186908 1518.7990 1518.7368 0.0623 0 62 K.IWHHTFYNELR.V + kynurenin (W)

1773.9315 1773.8897 0.0419 0 98 K.NYELPDGQVITIGAER.F

1787.9448 1787.9053 0.0395 0 (60) K.NYELPDGQVITIGAER.F + Me-ester (DE)

1882.9633 1882.9312 0.0321 0 101 K.LAYVALDYEQELETAR.S

1896.9772 1896.9469 0.0304 0 (91) K.LAYVALDYEQELETAR.S + Me-ester (DE)

1953.0822 1953.0571 0.0252 0 79 R.VAPEEHPVLLTEAPLNPK.A

1967.0966 1967.0727 0.0239 0 (48) R.VAPEEHPVLLTEAPLNPK.A + Me-ester (DE)

3150.5261 3150.6349 -0.1087 0 45 R.TTGIVLDSGDGVSHTVPIYEGYALPHAILR.L

872 aspartic proteinase 2 Nepenthes alata 39828832 12231174 1320.6359 1320.6251 0.0108 0 (38) K.QSVFSFWFNR.N + kynurenin (W)

1348.6314 1348.6200 0.0114 0 68 K.QSVFSFWFNR.N + DOUBLE Ox (W)

1531.7124 1531.7064 0.0060 0 81 K.CHFSLACYLHPK.Y

1678.8865 1678.8929 -0.0064 0 75 K.FDGILGLGFQEISVGK.A

1732.9002 1732.8970 0.0032 0 49 K.AVPVWYNMVNQGLVK.Q + Oxidation (M)

1999.9918 1999.9891 0.0028 0 40 K.FTVIFDTGSSNLWVPSAK.C + DOUBLE Ox (W)

1744.8415 1744.8349 0.0067 0 23 K.AAPQQICSQINLCSR.D

875 annexin p34 Solanum tuberosum 39832852 8247363 1022.5811 1022.4668 0.1143 0 52 R.YGGDEVDLR.L

1407.8040 1407.7180 0.0860 0 85 K.SNFVLVEIACTR.S

1719.9550 1719.8984 0.0567 0 71 K.GLVYPEHYFVEVLR.D

1733.9678 1733.9140 0.0538 0 (17) K.GLVYPEHYFVEVLR.D + Me-ester (DE)

1856.9098 1856.8653 0.0446 1 76 K.SLEEDVAYHTTGDHRK.L

2226.0827 2226.0838 -0.0010 0 56 M.ASLTVPAEVPSVAEDCEQLR.S + Acetyl (N-term); Me-ester (DE)

881 class II chitinase Solanum tuberosum 13607404 1236160 1541.8128 1541.7586 0.0542 0 42 R.GPIQLTHQSNYER.A

1555.8256 1555.7743 0.0513 0 (14) R.GPIQLTHQSNYER.A + Me-ester (DE)

2846.2425 2846.2823 -0.0398 0 14 K.GFYTYDAFIAAANSFPAFGTTGDDTAR.K

1314.6630 1314.6278 0.0352 0 21 R.ELFEQMLSFR.N + Oxidation (M)

46828401 1803.9777 1803.9651 0.0126 1 59 -.KLEEMVTVLSIDGGGIK.G + Oxidation (M)

950 superoxide dismutase [Mn], mitochondrial Nicotiana plumbaginifolia 42509219 134672 1003.6616 1003.5450 0.1166 0 43 K.NVRPDYLK.N

1417.7567 1417.6738 0.0829 0 49 K.HHQTYITNYNK.A

1963.0664 1963.0374 0.0290 1 15 K.ALEQLHDAISKGDAPTVAK.L

expressed protein) - Merops family I03.017 Nicotiana alata 78749955 161702913 1452.8183 1452.7361 0.0822 0 61 K.AGDYTLGPVNPPPR.F

955 cystatin-like protein Solanum tuberosum 45241310 76160986 1925.9350 1925.9846 -0.0496 0 51 K.SVPVHDPVVEEAAEHAIK.T

1953.9649 1954.0159 -0.0510 0 (35) K.SVPVHDPVVEEAAEHAIK.T + 2 Me-ester (DE)

1436.7570 1436.6783 0.0787 1 (56) K.DSPETYEEALKR.F

2949.4497 2949.5334 -0.0837 1 28 -.GDKYEFNLGDGAVATVGDPALLSLSVATK.L + 3 Me-ester (DE)

964 pathogenesis-related protein STH-2 Solanum tuberosum 41581943 131026 1540.8606 1540.7959 0.0647 1 52 K.MNFVEGSPIKYLK.H + Oxidation (M)

1802.9203 1802.8799 0.0405 0 60 M.GVTSYTHETTTPVAPSR.L

1334.6309 1334.5495 0.0814 0 50 K.FEAHGNGGCVCK.S

53776585 1651.9021 1651.8457 0.0565 0 54 K.AVEDYLLANPSVYAK.-

41581943 2390.1327 2390.1562 -0.0235 1 63 K.YSMIEGDVIGDKLESISYDLK.F + Oxidation (M)

969 pathogenesis-related protein STH-2 Solanum tuberosum 21371482 131026 1510.8517 1510.7853 0.0664 1 73 K.MNFVEGGPIKYLK.H + Oxidation (M)

1651.8976 1651.8457 0.0520 0 89 K.AVEDYLLANPSVYAK.-

1665.9116 1665.8613 0.0503 0 (68) K.AVEDYLLANPSVYAK.- + Me-ester (DE)

21371481 1806.9080 1806.8748 0.0332 0 73 M.GVTTYTHEATSTVSPTR.L

MANUALAVEDYLLTNPSVYAK isoform of 1652 AVEDYLLANPSVYAK

982 catalase isozyme 1-like protein Solanum tuberosum 78750450 83284011 1083.6105 1083.5349 0.0756 0 34 R.IFAYADTQR.H

1636.9356 1636.8824 0.0532 0 52 K.TWPEDLLPLIPVGR.L + DOUBLE Ox (W)

1650.9472 1650.8981 0.0491 0 (32) K.TWPEDLLPLIPVGR.L + DOUBLE Ox (W); Me-ester (DE)

1772.8345 1772.7893 0.0452 0 25 K.DLYDSIAAGNYPEWK.L + DOUBLE Ox (W)

1918.9811 1918.9325 0.0486 0 (58) R.EGNFDLVGNNVPVFFNR.D + Pyro-glu (N-term E)

1936.9829 1936.9431 0.0399 0 105 R.EGNFDLVGNNVPVFFNR.D

1024 Ran protein/TC4 protein Solanum lycopersicum 13179660 453563 1227.7237 1227.6135 0.1102 0 60 K.NLQYYEISAK.S

1483.8853 1483.8034 0.0819 2 77 R.KKNLQYYEISAK.S

1760.9450 1760.8885 0.0565 0 63 K.SNYNFEKPFLYLAR.K

1774.9584 1774.9042 0.0542 0 (43) K.SNYNFEKPFLYLAR.K + Me-ester (DE)

1956.0474 1956.0172 0.0302 1 67 R.VCENIPIVLCGNKVDVK.N

2245.0215 2245.0296 -0.0080 0 2 R.DGYYIHGQCAIIMFDVTAR.L + Oxidation (M)

2450.1631 2450.1940 -0.0308 1 39 K.KYEPTIGVEVHPLDFFTNCGK.I

1250.6936 1250.6044 0.0893 0 (27) K.YETGRPHSYK.L + Me-ester (DE)

1606.8711 1606.8103 0.0608 1 17 K.IEKYETGRPHSYK.L

putative mitochondrial NAD-dependent malate

dehydrogenase Solanum tuberosum 39830014 21388544 1589.9802 1589.9140 0.0662 0 111 K.ALEGADIVIIPAGVPR.K

1603.9986 1603.9297 0.0690 0 (47) K.ALEGADIVIIPAGVPR.K + Me-ester (DE)

2940.5374 2940.6436 -0.1061 0 8 K.VNVAEVNLPVVGGHAGITILPLFSQATPK.A

2979.4639 2979.5665 -0.1025 0 38 K.LNPLVSSLSLYDIAGTPGVAADVSHINTR.S

1067 eukaryotic initiation factor 3I1 subunit Arabidopsis thaliana 66837423 12407664 1653.8863 1653.8263 0.0601 0 87 K.GHFGPINALAFNPDGK.S

1688.8882 1688.8311 0.0572 1 78 R.LHHFDQDYFNIKI.-

I03.017 Solanum tuberosum 20137684 1717 manual : NPIPEVYDEDGDPIR db VLPEVYDQDGEPLR

1741 manual : NPIPEVYDEDGDPIR + methylationdb VLPEVYDQDGEPLR + methylation

1076 wound-induced protein Lycopersicon esculentum 39817147 1888561 1466.7547 1466.6765 0.0783 0 66 K.YGWTAFCGPVGPR.G

1482.7476 1482.6714 0.0763 0 (58) K.YGWTAFCGPVGPR.G + Oxidation (HW)

1498.7405 1498.6663 0.0742 0 (42) K.YGWTAFCGPVGPR.G + DOUBLE Ox (W)

1681.8610 1681.8034 0.0576 1 (28) R.SKYGWTAFCGPVGPR.G

1697.8577 1697.7984 0.0594 1 37 R.SKYGWTAFCGPVGPR.G + Oxidation (HW)

1713.8490 1713.7933 0.0558 1 (19) R.SKYGWTAFCGPVGPR.G + DOUBLE Ox (W)

1083 proteinase inhibitor II - Merops family I20.001 Solanum lycopersicum 15260949 1161572 1203.6330 1203.5342 0.0988 0 51 R.NCDPHIAYSK.C

1293.6865 1293.5910 0.0955 0 51 K.FVCEGESIEPK.A

1307.7001 1307.6067 0.0934 0 (42) K.FVCEGESIEPK.A + Me-ester (DE)

1394.6940 1394.6071 0.0870 0 (61) K.ECGNLGYGICPR.S

1083 ASR1 Lycopersicon cheesmaniae 46829636 68500142 1131.6594 1131.5573 0.1021 1 48 K.KAEGGHHHLF.-

1228.7123 1228.6115 0.1009 0 26 K.HHHHLFHHK.D

1399.8297 1399.7459 0.0838 0 88 K.LGTVAAGAYALHEK.H

1865.0187 1864.9795 0.0393 1 90 K.LGTVAAGAYALHEKHEAK.K

1932.9140 1932.9165 -0.0025 1 33 -.MEEEKHHHHLFHHK.D + Oxidation (M); 3 Me-ester (DE)

2176.0030 2176.0385 -0.0354 2 18 -.MEEEKHHHHLFHHKDK.E + Oxidation (M); Acetyl (N-term)

proteinase inhibitor II precursor - Merops family

I20.001 Solanum tuberosum 13180525 73920935 1644.8050 1644.7388 0.0662 0 58 K.ACPLNCDPHIAYSK.C

78747075 1658.8181 1658.6497 0.1684 0 14 K.ACPXNCDPHIAYSK.C + Oxidation (HW)

1284 suberization-associated anionic peroxidase Solanum tuberosum 39835307 110825730 1510.8539 1510.7714 0.0825 0 53 R.EMVALAGAHTVGFAR.C + Pyro-glu (N-term E)

1528.8583 1528.7820 0.0764 0 (52) R.EMVALAGAHTVGFAR.C

1544.8527 1544.7769 0.0759 0 (20) R.EMVALAGAHTVGFAR.C + Oxidation (M)

1587.8444 1587.7715 0.0729 0 (35) R.QQLTPEACVFSAVR.G + Pyro-glu (N-term Q)

1601.8538 1601.7872 0.0667 0 37 R.QQLTPEACVFSAVR.G + Me-ester (DE); Pyro-glu (N-term Q)

1350 unnamed protein product Vitis vinifera 52844302 157355687 1843.9618 1843.9162 0.0456 0 (34) K.ISLSEVVDEAGVGGEVER.T

1857.9757 1857.9319 0.0438 0 38 K.ISLSEVVDEAGVGGEVER.T + Me-ester (DE)

1871.9862 1871.9475 0.0387 0 (29) K.ISLSEVVDEAGVGGEVER.T + 2 Me-ester (DE)

1936.0415 1936.0094 0.0321 0 37 R.YGPLKPYAVVWVDPNSK.C + kynurenin (W)

1964.0563 1964.0043 0.0520 0 (14) R.YGPLKPYAVVWVDPNSK.C + DOUBLE Ox (W)

14644957 3641.6985 3641.8035 -0.1049 0 17 R.LADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAK.D + Oxidation (M)

1527.7991 1527.7490 0.0501 0 12 K.YDIISEMSTVNIK.F + Oxidation (M)

1608.9020 1608.8412 0.0609 0 (22) R.YFIVSAIWGAGGGGVR.L

1450 annexin p34 Solanum tuberosum 39832852 8247363 1022.5827 1022.4668 0.1159 0 37 R.YGGDEVDLR.L

1407.8037 1407.7180 0.0857 0 61 K.SNFVLVEIACTR.S

1719.9556 1719.8984 0.0573 0 60 K.GLVYPEHYFVEVLR.D

1733.9666 1733.9140 0.0526 0 (13) K.GLVYPEHYFVEVLR.D + Me-ester (DE)

1856.9065 1856.8653 0.0413 1 64 K.SLEEDVAYHTTGDHRK.L

2226.0827 2226.0838 -0.0010 0 53 M.ASLTVPAEVPSVAEDCEQLR.S + Acetyl (N-term); Me-ester (DE)

1451 cyprosin Cynara cardunculus 14267177 556819 1320.7028 1320.6251 0.0777 0 38 K.QSVFSFWFNR.N + kynurenin (W)

1531.7638 1531.7064 0.0574 0 52 K.CHFSLACYLHPK.Y

17071350 1744.8828 1744.8349 0.0480 0 26 K.AAPQQICSQINLCSR.D

cathepsin B-like cysteine proteinase - Merops

family C01.049 Nicotiana rustica 78748115 609175 1047.5336 1047.4297 0.1039 0 21 R.GWGDDGYFK.I + kynurenin (W)

1075.5285 1075.4247 0.1039 0 (20) R.GWGDDGYFK.I + DOUBLE Ox (W)

2100.9900 2100.9792 0.0108 0 104 K.NGPVEVSFTVYEDFAHYK.S

1458 cyprosin Cynara cardunculus 14267177 556819 1320.7216 1320.6251 0.0965 0 25 K.QSVFSFWFNR.N + kynurenin (W)

1531.7792 1531.7064 0.0728 0 84 K.CHFSLACYLHPK.Y

1460 caffeoyl-CoA O-methyltransferase 6 Nicotiana tabacum 21371965 30580343 1112.6391 1112.6090 0.0301 1 19 K.AGVAHKIDFR.E

1458.7704 1458.7507 0.0198 1 43 R.YYRDFVLELNK.A

2459.3028 2459.2981 0.0047 1 34 K.ILAMDINKENYEEIGLPIIQK.A + Oxidation (M)

1462 proteasome subunit alpha type, putative Ricinus communis 20170811 223547282 1084.6449 1084.5301 0.1148 1 32 R.KQAEQYYR.L

1544.9666 1544.8926 0.0740 1 30 R.LYKESIPVTQLVR.E

1586.9472 1586.8780 0.0693 1 89 K.NIEIGIIGNDKVFR.V

1600.9560 1600.8936 0.0624 1 (37) K.NIEIGIIGNDKVFR.V + Me-ester (DE)

1569.9724 1569.8977 0.0747 1 50 K.KLPSILVDETSVQK.I + Me-ester (DE)

2120.0655 2120.0571 0.0084 0 6 K.IQTLTPNIGVVYSGMGPDSR.V + Oxidation (M)

2135.1341 2135.1949 -0.0608 0 20 K.LVQIEHALTAVGSGQTSLGIK.A + Me-ester (DE)

1463 putative carboxymethylenebutenolidase Arabidopsis thaliana 16217033 3298540 1506.8213 1506.7507 0.0707 0 62 K.TAGVPHEVYFYPK.T

1520.8386 1520.7663 0.0723 0 (41) K.TAGVPHEVYFYPK.T + Me-ester (DE)

2135.0073 2134.9959 0.0114 0 108 K.APVQAHFGEDDAFVGFSDVK.T

2149.0196 2149.0116 0.0081 0 (73) K.APVQAHFGEDDAFVGFSDVK.T + Me-ester (DE)

1463 caffeoyl-CoA O-methyltransferase Solanum tuberosum 56776109 30580349 1140.7361 1140.6403 0.0958 1 56 K.AGLAHKIEFR.E

1458.8219 1458.7507 0.0713 1 45 R.YYRDFVLELNK.A

1472.8368 1472.7663 0.0705 1 (12) R.YYRDFVLELNK.A + Me-ester (DE)

1842.9756 1842.9332 0.0425 0 44 R.IEICQLPVGDGITLCR.R

1827.9711 1827.9406 0.0305 0 (21) R.IISTFWGALGGDVYLGK.S + DOUBLE Ox (W)

1539 endochitinase 1 Solanum tuberosum 62951517 1705805 1327.7083 1327.6269 0.0814 0 40 R.WQPSGVDQAANR.V

1831.8817 1831.8423 0.0394 0 35 R.GPIQISHNYNYGPCGR.A

2300.2127 2300.2263 -0.0136 0 37 R.AIGVDLLNNPDLVATDSVISFK.S

46292290 2888.2622 2888.3405 -0.0782 0 31 K.GNFYSYNAFISAAGSFPGFGTTGDITAR.K

1543 putative transcription factor Btf3 Capsicum annuum 9251551 121551087 1961.0528 1961.0218 0.0311 0 120 K.VQASIAANTWVVSGTPQTK.K + kynurenin (W)

1989.0436 1989.0167 0.0269 0 (86) K.VQASIAANTWVVSGTPQTK.K + DOUBLE Ox (W)

2666.4519 2666.5119 -0.0599 2 16 K.KLQDILPQIIHQLGPDNLENLKK.L

1546 elicitor-inducible protein EIG-J7 Capsicum annuum 78748674 40287496 2085.0552 2085.0378 0.0174 0 17 K.GGTDSIISLTLYDANGYGIR.I

2684.3445 2684.4020 -0.0575 1 26 R.TGSIIKGGTDSIISLTLYDANGYGIR.I

13607428 1490.7227 1490.6347 0.0880 0 49 G.SEEDCVYSAYIR.T

1504.7327 1504.6504 0.0823 0 50 G.SEEDCVYSAYIR.T + Me-ester (DE)

1547 elicitor-inducible protein EIG-J7 Capsicum annuum 78748674 40287496 2085.0518 2085.0378 0.0140 0 50 K.GGTDSIISLTLYDANGYGIR.I

2684.3430 2684.4020 -0.0590 1 26 R.TGSIIKGGTDSIISLTLYDANGYGIR.I

13607428 1490.7127 1490.6347 0.0780 0 61 G.SEEDCVYSAYIR.T

1504.7227 1504.6504 0.0723 0 57 G.SEEDCVYSAYIR.T + Me-ester (DE)

1564 mitochondrial malate dehydrogenase Lycopersicon esculentum 39830014 52139816 1589.9911 1589.9140 0.0771 0 51 K.ALEGADIVIIPAGVPR.K

1604.0056 1603.9297 0.0760 0 (37) K.ALEGADIVIIPAGVPR.K + Me-ester (DE)

2940.5237 2940.6436 -0.1198 0 17 K.VNVAEVNLPVVGGHAGITILPLFSQATPK.A

2979.4512 2979.5665 -0.1152 0 26 K.LNPLVSSLSLYDIAGTPGVAADVSHINTR.S

78747756 1872.9942 1872.9468 0.0474 0 34 K.NGVEEVLGLGPLNEYEK.Q + Me-ester (DE)

1887.0059 1886.9625 0.0435 0 (11) K.NGVEEVLGLGPLNEYEK.Q + 2 Me-ester (DE)

1567 fructose-bisphosphate aldolase-like protein Solanum tuberosum 39820733 83283995 1314.6707 1314.6720 -0.0013 0 63 K.KPWSLSFSFGR.A + kynurenin (W)

1342.6662 1342.6669 -0.0007 0 (55) K.KPWSLSFSFGR.A + DOUBLE Ox (W)

1359.7411 1359.7398 0.0014 0 (35) K.VAPEVIAEYTIR.A

1373.7565 1373.7554 0.0011 0 43 K.VAPEVIAEYTIR.A + Me-ester (DE)

2037.0276 2037.0238 0.0038 0 144 K.IGANEPSQLAINDNANGLAR.Y

2051.0442 2051.0395 0.0047 0 (101) K.IGANEPSQLAINDNANGLAR.Y + Me-ester (DE)

2388.1272 2388.1233 0.0039 2 97 K.YAGASNLSEGASESLHVKDYKY.-

3131.5948 3131.6324 -0.0376 0 48 R.YAIICQQNGLVPIVEPEILVDGAHDIQK.C

2362.9507 2362.9695 -0.0188 0 25 R.EQGSPGDYCTPSNQWPCAPGR.K

2491.0320 2491.0645 -0.0324 1 19 R.EQGSPGDYCTPSNQWPCAPGRK.Y

2888.2488 2888.3405 -0.0916 0 47 K.GNFYSYNAFISAAGSFPGFGTTGDITAR.K

protein) - Merops family I03.017 Nicotiana alata 39837051 161702913 1236.6795 1236.5887 0.0908 0 40 K.YETGRPHSYK.L

I03.017 Solanum tuberosum 115274899 20137687 1982.0757 1982.0400 0.0357 1 46 R.LATVDDDKDFIPFVFIK.A

2053.1048 2053.0771 0.0277 2 66 R.LATVDDDKDFIPFVFIKA.-

1572 wound-induced protein WIN2 Solanum tuberosum 46294477 139699 2033.9838 2033.9840 -0.0002 0 91 R.IVDQCSNGGLDLDINVFR.Q

2047.9971 2047.9996 -0.0025 0 (48) R.IVDQCSNGGLDLDINVFR.Q + Me-ester (DE)

62950067 1466.6795 1466.6765 0.0031 0 39 K.YGWTAFCGPVGPR.G

1482.6724 1482.6714 0.0011 0 (13) K.YGWTAFCGPVGPR.G + Oxidation (HW)

1498.6709 1498.6663 0.0046 0 (20) K.YGWTAFCGPVGPR.G + DOUBLE Ox (W)

1681.8061 1681.8034 0.0027 1 35 R.SKYGWTAFCGPVGPR.G

1697.8012 1697.7984 0.0029 1 (24) R.SKYGWTAFCGPVGPR.G + Oxidation (HW)

1713.7938 1713.7933 0.0006 1 (17) R.SKYGWTAFCGPVGPR.G + DOUBLE Ox (W)

I03.017 Solanum tuberosum 10806248 20141344 1726.9427 1727.8730 -0.9302 0 83 N.LVLPEVYDEDGNPLR.F

1578 proteinase inhibitor - Merops family I20.UPW Solanum tuberosum 10446369 165906348 1857.8627 1858.8083 -0.9456 1 76 K.YFSKDYTFICDGESK.D

1578 putative ubiquitin extension protein UBQ2 Arabidopsis thaliana 42511939 13430798 1522.8527 1522.7739 0.0788 1 72 K.IQDKEGIPPDQQR.L

1580 glutaredoxin Solanum tuberosum 45292649 156891145 1407.6616 1407.6677 -0.0061 0 52 K.HIGGCDATTALHR.E

1734.8200 1734.8172 0.0028 0 53 K.DGSEIQAALAEWTGQR.T + kynurenin (W)

1815.8898 1815.8899 -0.0001 1 13 K.TYCPFCVSVKDLLSK.L

2420.2339 2420.2382 -0.0043 1 32 R.TVPNVFIGGKHIGGCDATTALHR.E

2606.2473 2606.2459 0.0014 1 (10) K.AVELDSEKDGSEIQAALAEWTGQR.T + kynurenin (W)

2620.2605 2620.2616 -0.0011 1 21 K.AVELDSEKDGSEIQAALAEWTGQR.T + kynurenin (W); Me-ester (DE)

1593 peroxidase Nicotiana tabacum 39822997 14031049 1088.4553 1088.4960 -0.0407 0 26 K.YYVDLMNR.Q + Oxidation (M)

1140.5933 1140.6251 -0.0318 0 73 R.QDIGQAAGLLR.L

1657.7422 1657.7584 -0.0161 0 44 R.QGLFTSDQDLYTDR.R

2228.0635 2228.0572 0.0064 0 27 K.GLSWTFYDSICPNAESIIR.R

aspartic proteinase inhibitor - Merops family

I03.002 Solanum tuberosum 53696529 255215 1172.6809 1172.5900 0.0910 0 44 K.LCVSYTIWK.V + kynurenin (W)

1602 patatin precursor Solanum tuberosum 11035219 73426675 1030.5963 1030.4944 0.1019 0 30 R.HSQNNYLR.V

1450.765 1450.694 0.0711 1 27 K.DSPETYEEALKR.F Me-ester (DE)

1622 peroxidase Nicotiana tabacum 39826310 14031049 1088.5030 1088.4960 0.0070 0 16 K.YYVDLMNR.Q + Oxidation (M)

1140.6360 1140.6251 0.0109 0 70 R.QDIGQAAGLLR.L

1657.7687 1657.7584 0.0104 0 55 R.QGLFTSDQDLYTDR.R

1813.8644 1813.8595 0.0050 1 36 R.QGLFTSDQDLYTDRR.T

1840.8675 1840.8631 0.0044 0 (23) R.DSVFFSGGPDYDLPLGR.R

1854.8845 1854.8788 0.0058 0 24 R.DSVFFSGGPDYDLPLGR.R + Me-ester (DE)

1996.9668 1996.9642 0.0026 1 31 R.DSVFFSGGPDYDLPLGRR.D

2100.9839 2100.9786 0.0053 1 16 R.LYPNQDSSMDKTFANNLK.I + Oxidation (M)

family I20.001 Solanum tuberosum 15185219 3913935 1200.6869 1200.5849 0.1020 0 44 K.LCVSYTIWK.V + DOUBLE Ox (W)

1391.7646 1391.6802 0.0844 0 50 K.LLHCPSHLQCK.N

1790 miraculin (low homology) - Merops family I03.UNA 53696569 1355.6737 1355.6793 -0.0056 1 35 R.DIEGNPLNKNSR.Y

1527.7451 1527.7490 -0.0039 0 82 K.YDIISEMSTVNIK.F + Oxidation (M)

1608.8369 1608.8412 -0.0042 0 (29) R.YFIVSAIWGAGGGGVR.L

1624.8316 1624.8361 -0.0045 0 (28) R.YFIVSAIWGAGGGGVR.L + Oxidation (HW)

1640.8267 1640.8310 -0.0043 0 54 R.YFIVSAIWGAGGGGVR.L + DOUBLE Ox (W)

1863 ascorbate peroxidase Solanum tuberosum 39834182 24636598 1595.7412 1595.6779 0.0633 0 66 K.YAADEDAFFADYAK.A

1609.7591 1609.6936 0.0655 0 (36) K.YAADEDAFFADYAK.A + Me-ester (DE)

1627.9362 1627.8755 0.0607 0 10 K.ALLCDPAFRPLVEK.Y

1641.9496 1641.8912 0.0584 0 (1) K.ALLCDPAFRPLVEK.Y + Me-ester (DE)

1662.9026 1662.8437 0.0589 0 14 K.AEQAHGANNGLDIALR.L + Me-ester (DE)

1924.0247 1923.9914 0.0333 1 94 R.FKAEQAHGANNGLDIALR.L

1864 dehydroascorbate reductase-like protein Solanum tuberosum 14644563 76160951 1464.8363 1464.7612 0.0751 1 30 K.AEEKYVIAGWAPK.V + kynurenin (W)

1553.9291 1553.8718 0.0574 1 88 K.LYHLEVALGHFKK.W

1758.8808 1758.8359 0.0450 0 80 K.AAVGAPDVLGDCPFSQR.V

1872.9976 1872.9621 0.0355 0 89 K.YPNPSLIAPPEFASVGSK.I

1864 glutathione S-transferase Solanum commersonii 11505012 148616162 2557.2791 2557.3176 -0.0385 1 16 R.AITQYIAHTYADKGTQLLPNDPK.K

2685.3494 2685.4126 -0.0631 2 16 R.AITQYIAHTYADKGTQLLPNDPKK.M

2759.2835 2759.3377 -0.0541 0 13 K.YLGGESFTLADLHHAPSLHYLMGSK.V + Oxidation (M)

family I03.020 Solanum tuberosum 15185806 73920943 1172.6905 1172.5900 0.1006 0 49 K.LCVSYTIWK.V + kynurenin (W)

1436.7193 1436.6783 0.0410 1 50 K.DSPETYEEALKR.F

1926 fructose-bisphosphate aldolase-like protein Solanum tuberosum 39816804 83283995 1342.7152 1342.6669 0.0483 0 58 K.KPWSLSFSFGR.A + DOUBLE Ox (W)

1359.7887 1359.7398 0.0490 0 46 K.VAPEVIAEYTIR.A

2037.0297 2037.0238 0.0059 0 49 K.IGANEPSQLAINDNANGLAR.Y

1929 chitinase Solanum tuberosum 62892722 467822 1831.8834 1831.8423 0.0411 0 55 R.GPIQISHNYNYGPCGR.A

1622.8330 1622.7728 0.0602 0 101 K.NNFYSYNAFITAAK.S

2092.9561 2092.9418 0.0143 0 73 R.YCGILGVSPGNNLDCGNQR.S

1399.7227 1399.6368 0.0860 0 47 R.SFPGFGTSGDTTAR.K

superoxide dismutase [Mn], mitochondrial

precursor Nicotiana plumbaginifolia 15257786 134672 1417.7533 1417.6738 0.0795 0 81 K.HHQTYITNYNK.A

1963.0602 1963.0374 0.0228 1 69 K.ALEQLHDAISKGDAPTVAK.L

2009.0331 2009.0105 0.0226 0 15 K.GSLGWAIDTNFGSLEALVK.K + DOUBLE Ox (W)

2565.2871 2565.3267 -0.0396 0 (30) K.GANLVPLLGIDVWEHAYYLQYK.N + kynurenin (W)

2593.2757 2593.3216 -0.0459 0 68 K.GANLVPLLGIDVWEHAYYLQYK.N + DOUBLE Ox (W)

2190 miraculin (low homology) - Merops family I03.UNA 52568616 1452.8123 1452.7361 0.0762 0 28 K.AGDYTLGPVNPPPR.F

2227 putative vacuolar proton ATPase subunit E Lycopersicon esculentum 53696751 9652289 1120.6985 1120.5989 0.0997 2 12 K.KIRQEYER.K

1162.6955 1162.5982 0.0973 1 18 R.FIRQEAEEK.A + Me-ester (DE)

1418.9381 1418.8609 0.0772 0 63 K.LLHDLIVQSLLR.L

1821.8914 1821.8632 0.0283 0 26 K.ANEISVSAEEEFNIEK.L + Me-ester (DE)

2238 glutathione S-transferase Solanum commersonii 13608117 14816162 2557.2744 2557.3176 -0.0432 1 55 R.AITQYIAHTYADKGTQLLPNDPK.K

2685.3543 2685.4126 -0.0582 2 31 R.AITQYIAHTYADKGTQLLPNDPKK.M

2759.2696 2759.3377 -0.0680 0 28 K.YLGGESFTLADLHHAPSLHYLMGSK.V + Oxidation (M)

1493.8227 1493.7514 0.0713 0 65 R.AITQYIAHTYADK.G

2238 dehydroascorbate reductase Solanum tuberosum 8071403 160347100 1758.8889 1758.8359 0.0531 0 61 K.AAVGAPDVLGDCPFSQR.V

2275 catalase isozyme 1-like protein Solanum tuberosum 78750450 83284011 1083.6592 1083.5349 0.1243 0 87 R.IFAYADTQR.H

1608.9568 1608.8875 0.0693 0 34 K.TWPEDLLPLIPVGR.L + kynurenin (W)

1636.9510 1636.8824 0.0686 0 (34) K.TWPEDLLPLIPVGR.L + DOUBLE Ox (W)

1918.9676 1918.9325 0.0351 0 47 R.EGNFDLVGNNVPVFFNR.D + Pyro-glu (N-term E)

1936.9748 1936.9431 0.0318 0 (23) R.EGNFDLVGNNVPVFFNR.D

2276 peroxidase Solanum lycopersicum 62808663 295355 1029.7052 1029.5971 0.1081 0 39 K.FGIPNLTLR.G

1263.6179 1263.5277 0.0902 0 25 R.MHFHDCFVR.G + Oxidation (M)

1442.9141 1442.8357 0.0784 0 31 K.HIPNAPSLAAALIR.M

1703.8988 1703.8478 0.0510 0 16 R.DSVVVTGGPSWSVPTGR.R + kynurenin (W)

2285.1226 2285.1395 -0.0169 0 12 K.IIEDECPGVVSCADIVALVAR.D

21925940 1035.5976 1035.4913 0.1063 0 30 R.TFDLSYYK.L

protein) - Merops family I03.017 Nicotiana alata 78748725 161702913 1452.8040 1452.7361 0.0679 0 58 K.AGDYTLGPVNPPPR.F

2287 osmotin-like protein Solanum phureja 52844276 53830832 1110.5452 1110.4512 0.0940 0 57 R.TNCNFDGAGR.G

1582.7426 1582.7205 0.0222 0 22 R.GQSWWFWAPPGTK.M + DOUBLE Ox (W); kynurenin (W)

1594.8526 1594.7205 0.1322 0 (11) R.GQSWWFWAPPGTK.M + DOUBLE Ox (W); Oxidation (HW)

2420 patatin Solanum tuberosum 14644615 84316419 1046.7282 1046.6124 0.1158 0 50 K.TNKPVIFTK.S

2785.4495 2785.5377 -0.0882 1 30 R.VHQALTEVAISSFDIKTNKPVIFTK.S

3339.4248 3339.5229 -0.0981 0 22 K.MYDICYSTAAAPIYFPPHHFVTHTSNGAR.Y + Oxidation (M)

3641.6040 3641.8035 -0.1994 0 18 R.LADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAK.D + Oxidation (M)

2438 glycine-rich protein 2 Nicotiana sylvestris 18259841 121631 1047.5519 1047.4192 0.1327 0 34 K.CGEDGHFAR.E

1516.8170 1516.7270 0.0901 0 58 K.DGSSDLFVHQSGIR.S

2053.9344 2053.9075 0.0269 0 31 R.SLSDGEEVEYVIESGNDGR.S

2067.9444 2067.9232 0.0212 0 (23) R.SLSDGEEVEYVIESGNDGR.S + Me-ester (DE)

1436.7538 1436.6783 0.0755 1 57 K.DSPETYEEALKR.F

2949.4636 2949.5334 -0.0698 1 17 -.GDKYEFNLGDGAVATVGDPALLSLSVATK.L + 3 Me-ester (DE)

2464 pathogenesis-related protein 10 Solanum virginianum 14643623 51317936 1638.9003 1638.8439 0.0564 1 50 K.QMNFVEGGPIKYLK.H + Oxidation (M)

2491 polyprotein Potato virus Y strain Boushehr 134035927 1177.6980 1177.5913 0.1067 2 1 R.NKKEPYMPR.Y + Oxidation (M)

1396.7177 1396.6299 0.0878 0 58 R.YAFDFYEVTSR.T

1410.7317 1410.6455 0.0862 0 (41) R.YAFDFYEVTSR.T + Me-ester (DE)

1864.9220 1864.8802 0.0418 0 (65) R.LFGLDGGISTQEENTER.H

1878.9342 1878.8959 0.0384 0 87 R.LFGLDGGISTQEENTER.H + Me-ester (DE)

1892.9475 1892.9115 0.0360 0 (49) R.LFGLDGGISTQEENTER.H + 2 Me-ester (DE)

2501 Chitin-binding lectin 1 Solanum tuberosum 39826282 46396546 1217.3627 1217.5135 -0.1508 0 44 M.QCPDPYPEGR.C

2506 Chitin-binding lectin 1 Solanum tuberosum 39826282 46396546 1217.6027 1217.5135 0.0892 0 47 M.QCPDPYPEGR.C

2510 formate dehydrogenase, mitochondrial Solanum tuberosum 52844473 26454627 1688.9201 1688.8457 0.0745 0 28 R.LKPFNCNLLYHDR.L

3522.4915 3522.5819 -0.0904 0 32 R.GAIMDTQAVVDACNSGHIAGYSGDVWYPQPAPK.D + Oxidation (M); DOUBLE Ox (W)

39825596 2469.1385 2469.1052 0.0333 0 (14) K.ANEYAEMNPNFLGCAENALGIR.E + Oxidation (M)

2526.3015 2526.3383 -0.0368 0 18 K.HIPDLHVLISTPFHPAYVTAER.I + Me-ester (DE)

2483.2251 2483.1208 0.1043 0 27 K.ANEYAEMNPNFLGCAENALGIR.E + Oxidation (M); Me-ester (DE)

2511 peroxidase Nicotiana tabacum 39793501 63253080 1570.8686 1570.7925 0.0761 0 (35) R.EMVALVGSHTVGFAR.C + Oxidation (M); Pyro-glu (N-term E)

1588.8756 1588.8031 0.0725 0 40 R.EMVALVGSHTVGFAR.C + Oxidation (M)

1746.9514 1746.8974 0.0540 0 36 R.DSVAMLGGIPYPVSLGR.K + Oxidation (M)

1962.9680 1962.9325 0.0355 0 15 K.TMCPGAAVSCADILALAAR.D + Oxidation (M)

2651.1529 2651.2148 -0.0619 0 29 R.LFFHDCFVDGCDAGILLDDIPGR.F

2300.2083 2300.2263 -0.0180 0 62 R.AIGVDLLNNPDLVATDSVISFK.S

1622.8330 1622.7728 0.0602 0 86 K.NNFYSYNAFITAAK.S

family I03.020 Solanum tuberosum 13178940 73920947 2182.0821 2182.0762 0.0060 0 7 R.LLGYELITCDGALVGTMGQR.V + Oxidation (M)

2660.1399 2660.1852 -0.0453 0 50 R.GPYGGDIYLDYSPGSTAPCPDGVFR.Y

2816.2312 2816.2863 -0.0551 1 27 K.RGPYGGDIYLDYSPGSTAPCPDGVFR.Y

2549 CBS domain-containing protein Solenostemon scutellarioides 45290910 118162023 1505.8859 1505.8201 0.0658 1 30 K.SIAGIITERDYLR.K

1633.9688 1633.9151 0.0537 2 46 K.SIAGIITERDYLRK.I

2554 miraculin (low homology) - Merops family I03.UNA 53696569 1111.5687 1111.5372 0.0316 0 52 K.LVFCPYGEK.F

1138.6090 1138.5771 0.0320 1 51 K.AFVFQKDER.I

1904.9419 1904.9342 0.0078 1 45 K.SLGGSTYKLVFCPYGEK.F

2950.3010 2950.3377 -0.0367 1 10 K.LVFCPYGEKFTCQNVGIADENGYNR.L

34 kDa outer mitochondrial membrane protein

porin-like Solanum tuberosum 39826100 83283993 1560.9169 1560.8511 0.0658 1 109 K.KGDLFLADVNTQLK.N

1943.0502 1943.0251 0.0251 0 71 K.FTITTYSPTGVAITSSGLK.K

2085.0908 2085.0755 0.0153 0 32 R.VNNFGTATALIQHEWRPK.S + kynurenin (W)

2099.0994 2099.0912 0.0083 0 (7) R.VNNFGTATALIQHEWRPK.S + kynurenin (W); Me-ester (DE)

2113.0825 2113.0704 0.0121 0 (14) R.VNNFGTATALIQHEWRPK.S + DOUBLE Ox (W)

2127.1040 2127.1059 -0.0018 0 8 K.VDTNSNLLATVTVDEAAPGLK.T

2830.3301 2830.4025 -0.0723 1 102 R.DYQTDHKFTITTYSPTGVAITSSGLK.K

1438.8427 1438.7681 0.0747 0 28 K.ASALLQHEWRPK.S + kynurenin (W)

2683 glutathione S-transferase Pisum sativum 62890853 37051105 1508.9450 1508.8126 0.1324 1 51 K.VLEPEKLVEYYK.N

1560.8559 1560.7395 0.1165 0 35 R.LYISYQCPYAQR.V

1668.8870 1668.7995 0.0876 0 124 R.DAQTLAGAQFDYLEK.A

1987.0519 1987.0527 -0.0007 0 18 K.INLVPIDLQNRPDWYK.E + kynurenin (W)

2162.0039 2162.0571 -0.0532 0 94 K.FAEELIAYSDTFVPEIYR.S

2176.0132 2176.0728 -0.0595 0 (66) K.FAEELIAYSDTFVPEIYR.S + Me-ester (DE)

2741 dehydroascorbate reductase-like protein Solanum tuberosum 53694867 76160951 1197.6330 1197.6797 -0.0467 0 43 K.IFPTFVSFLK.S

1553.8388 1553.8718 -0.0329 1 73 K.LYHLEVALGHFKK.W

1758.8172 1758.8359 -0.0186 0 55 K.AAVGAPDVLGDCPFSQR.V

2741 glutathione S-transferase Solanum commersonii 13608117 148616162 2557.3386 2557.3176 0.0210 1 38 R.AITQYIAHTYADKGTQLLPNDPK.K

2685.4483 2685.4126 0.0358 2 38 R.AITQYIAHTYADKGTQLLPNDPKK.M

2759.3777 2759.3377 0.0401 0 18 K.YLGGESFTLADLHHAPSLHYLMGSK.V + Oxidation (M)

I03.002 53788849 20137330 1200.5568 1200.5849 -0.0281 0 61 K.LCVSYTIWK.V + DOUBLE Ox (W)

1347.6117 1347.6418 -0.0301 0 55 R.YNSDVGPSGTPVR.F

2018.0266 2017.9666 0.0600 0 (42) R.TMLLETGGTIGQADSSYFK.I

2449.2473 2449.2311 0.0162 0 31 K.YGANICEDQLLNIQFNIPTVK.L

1436.7658 1436.6783 0.0875 1 (61) K.DSPETYEEALKR.F

1464.7937 1464.7096 0.0841 1 69 K.DSPETYEEALKR.F + 2 Me-ester (DE)

1976.0487 1976.0214 0.0273 2 78 K.KPVSKDSPETYEEALKR.F

1990.0580 1990.0371 0.0210 2 (55) K.KPVSKDSPETYEEALKR.F + Me-ester (DE)

5554 peroxidase Nicotiana tabacum 39822997 14031049 1140.6216 1140.6251 -0.0035 0 75 R.QDIGQAAGLLR.L

1345.7011 1345.7023 -0.0012 0 53 R.VVSCADITAIAAR.D

1657.7532 1657.7584 -0.0051 0 56 R.QGLFTSDQDLYTDR.R

2228.0574 2228.0572 0.0003 0 27 K.GLSWTFYDSICPNAESIIR.R

5647 proteasome-like protein alpha subunit-like Solanum tuberosum 53780748 82621184 1633.9196 1633.8563 0.0634 0 19 R.LTVEDPVTVEYITR.Y

1647.9365 1647.8719 0.0646 0 (19) R.LTVEDPVTVEYITR.Y + Me-ester (DE)

1661.9488 1661.8876 0.0613 0 (1) R.LTVEDPVTVEYITR.Y + 2 Me-ester (DE)

1850.0471 1850.0083 0.0388 1 96 R.KIVNLDDHIALACAGLK.A

5647 transcription factor APFI Arabidopsis thaliana 17069739 13507025 2417.2771 2417.3066 -0.0295 1 3 K.APVVDKDVFVAPGATVIGDVHVGR.N

2527.1968 2527.2376 -0.0408 1 54 R.KLTDEEIAFIAQSATNYCNLAR.V

5647 class I chitinase Solanum tuberosum 10450479 6707113 1831.8927 1831.8423 0.0504 0 23 R.GPIQISHNYNYGPCGR.A

Table S2: Additional information regarding the polipeptide spots identified in native periderm

color code more than one protein ID per spot

not ID with significant score

Sample name Organism Gi Accession EST Gi Accession Experim. Mr Calc. Mr Mass ∆ MC Pept. score

4 tobacco calretulin Nicotiana tabacum 732893 1880.8324 1880.7852 0.0472 0 41

1908.8296 1908.7802 0.0495 0 (20)

15260522 2041.9518 2041.9302 0.0216 0 56

2352.0716 2352.0984 -0.0267 1 13

11131769 1464.9127 1464.8340 0.0787 1 46

4 26S proteasome regulatory subunit S5A Mesembryanthemum crystallinum 3202042 1435.8966 1435.8074 0.0892 1 58

1029.7427 1029.6222 0.1205 0 60

6 suberization-associated anionic peroxidase 2 precursor (TMP2). Solanum lycopersicum 39810096 129811 1544.8321 1544.7769 0.0553 0 34

1572.8452 1572.7929 0.0523 0 44

1526.8227 1526.7663 0.0564 0 38

20 nascent polypeptide-associated complex subunit alpha-like protein 3 Arabidopsis thaliana 71151986 1518.9096 1518.8809 0.0287 0 99

1734.0271 1734.0079 0.0192 1 125

1920.9567 1920.9428 0.0139 0 119

115442127 1526.7525 1526.7252 0.0273 0 96

Kunitz proteinase inhibitor homologue (sexual organ expressed protein) -

Merops family I03.017 Nicotiana alata 52824402 161702915 2744.3030 2744.3544 -0.0514 0 81

40 calmodulin-5/6/7/8 Solanum tuberosum 6528685 55976467 1808.9227 1808.9056 0.0171 1 29

46 calreticulin precursor Nicotiana plumbaginifolia 11131769 1708.9599 1708.8308 0.1291 0 66

2327.9815 2328.0078 -0.0263 0 82

2456.0362 2456.1028 -0.0665 1 43

11131631 2352.0569 2352.0984 -0.0414 1 43

2041.9794 2041.9302 0.0492 0 74

732893 1880.8848 1880.7852 0.0996 0 89

1908.8798 1908.7802 0.0997 0 (66)

47 abscisic stress ripening protein Solanum chacoense 607905 1480.8285 1480.7588 0.0697 1 35

2089.1055 2089.0955 0.0100 0 121

2302.9993 2302.9964 0.0029 1 68

2604.0442 2604.0775 -0.0333 0 46

2630.0757 2630.1044 -0.0286 1 80

2691.1248 2691.1460 -0.0211 2 47

48 abscisic stress ripening protein Solanum chacoense 607905 2089.1065 2089.0955 0.0110 0 36

2302.9964 2302.9964 -0.0000 1 30

2604.0520 2604.0775 -0.0255 0 76

2630.0713 2630.1044 -0.0330 1 62

2651.2344 2651.2628 -0.0284 2 9

70 Chain A, the crystal structure of semet patatin Solanum cardiophyllum 31615943 2725.4236 2725.3922 0.0314 0 122

3611.8435 3611.7929 0.0506 0 32

129644 1447.7302 1447.7135 0.0167 0 12

1756.9535 1756.9359 0.0176 0 125

72 patatin precursor Solanum tuberosum 129644 1447.7881 1447.7135 0.0746 0 20

1756.9778 1756.9359 0.0419 0 129

31615943 2725.3318 2725.3922 -0.0604 0 112

3611.6443 3611.7929 -0.1486 0 8

1447.7361 1447.7135 0.0226 0 20

1756.9514 1756.9359 0.0155 0 129

31615943 2725.3894 2725.3922 -0.0028 0 28

3611.7532 3611.7929 -0.0397 0 20

1629.8262 1629.8072 0.0190 1 37

1756.9501 1756.9359 0.0142 0 132

113a drought-induced protein SDi-6 Helianthus annuus 53781963 7489327 1826.9455 1826.9050 0.0406 1 104

2486.1743 2486.2077 -0.0333 1 85

2969.3675 2969.4505 -0.0829 2 83

113a patatin precursor Solanum tuberosum 11069214 122217718 1447.7927 1447.7136 0.0792 0 64

1546.8489 1546.7820 0.0670 0 38

113b no significant homologue found 45291200 1478.7766 1478.7252 0.0514 0 63

1826.9334 1826.9050 0.0285 1 101

2206.0869 2206.0865 0.0004 2 58

2486.1836 2486.2077 -0.0240 1 80

114 Kunitz-type enzyme inhibitor S9C11 - Merops family I03.017 Solanum tuberosum 18308088 1309.6511 1309.5687 0.0825 0 81

1389.7827 1389.7148 0.0679 0 65

2378.2105 2378.2304 -0.0198 0 47

115 Kunitz-type enzyme inhibitor S9C11 - Merops family I03.017 Solanum tuberosum 18308088 1309.5434 1309.5687 -0.0252 0 69

2378.2442 2378.2304 0.0139 0 67

2516.3015 2516.2798 0.0218 0 95

116 cysteine protease inhibitor - Merops family I03.017 Solanum tuberosum 20137685 2261.0777 2261.0811 -0.0033 0 135

IVIPEVYDVDGDPIR manually determined

117 cysteine protease inhibitor - Merops family I03.017 Solanum tuberosum 20137685 2261.0796 2261.0811 -0.0014 0 114

169584 IVIPEVYDVDGDPIR manually determined

128 miraculin (low homology) - Merops family I03.UNA 22022174 1527.7705 1527.7490 0.0215 0 68

1612.8643 1612.8361 0.0282 0 (73)

1624.8637 1624.8361 0.0276 0 (37)

1640.8574 1640.8310 0.0264 0 85

2157.0396 2157.0232 0.0164 0 153

1640.8390 1640.8310 0.0080 0 (43)

2157.0310 2157.0232 0.0078 0 102

129 chloroplast processing enzyme Arabidopsis thaliana 53696651 2827039 1658.8318 1658.8263 0.0055 0 104

1527.8023 1527.7490 0.0533 0 69

1612.8937 1612.8361 0.0576 0 (59)

1624.8899 1624.8361 0.0538 0 (36)

1640.8853 1640.8310 0.0543 0 86

4000.7139 4000.8973 -0.1834 0 24

131 Kunitz-type proteinase inhibitor - Merops family I03.020 Solanum brevidens 61611884 1206.5680 1206.5413 0.0267 0 17

1347.6695 1347.6418 0.0277 0 37

1490.6820 1490.6572 0.0248 0 32

1799.9403 1799.9457 -0.0054 0 12

2938.3206 2938.3542 -0.0335 0 61

147 proteinase inhibitor - Merops family I13.UPW Solanum tuberosum 46830347 70779535 1470.7552 1470.7870 -0.0318 0 54

1758.9315 1758.9417 -0.0101 1 51

1786.9280 1786.9366 -0.0085 1 (21)

1931.0449 1931.0549 -0.0100 1 23

2746.4114 2746.3595 0.0519 0 45

3286.7862 3286.6866 0.0996 1 24

13617346 1743.9425 1743.9671 -0.0246 1 22

148 proteinase inhibitor - Merops family I20.UPW Solanum tuberosum 45243152 165906348 2011.8264 2011.8105 0.0159 0 35

2039.8164 2039.8055 0.0110 0 (17)

2537.0520 2537.0692 -0.0172 1 (56)

2565.0437 2565.0642 -0.0204 1 67

171 patatin precursor Solanum brevidens 563125 1030.6010 1030.4944 0.1066 0 40

1166.7278 1166.6335 0.0943 0 60

1436.7512 1436.6783 0.0729 1 60

1756.9735 1756.9359 0.0376 0 126

2782.4087 2782.4500 -0.0413 1 22

3254.3843 3254.4805 -0.0962 0 28

3641.6634 3641.8035 -0.1400 0 20

1132.6925 1132.6492 0.0434 0 52

1304.7035 1304.6612 0.0423 0 69

1436.7156 1436.6783 0.0373 1 88

1756.9541 1756.9359 0.0182 0 115

2677.3775 2677.3962 -0.0187 0 145

3641.7381 3641.8035 -0.0653 0 16

1132.6850 1132.6492 0.0359 0 34

1304.7047 1304.6612 0.0435 0 63

1436.7079 1436.6783 0.0296 1 82

1756.9574 1756.9359 0.0215 0 133

3641.7532 3641.8035 -0.0502 0 28

175 peroxidase 1 Sesbania rostrata 39819119 117957301 1418.6747 1418.6751 -0.0004 1 45

1872.8640 1872.8490 0.0151 0 116

1990.9547 1990.9483 0.0064 0 73

2024.0490 2024.0439 0.0052 1 30

2557.3069 2557.3098 -0.0028 1 34

2807.3250 2807.3184 0.0066 0 87

177 patatin precursor Solanum brevidens 563125 1030.5731 1030.4944 0.0787 0 43

1166.7019 1166.6335 0.0684 0 41

1436.7311 1436.6783 0.0528 1 65

1756.9678 1756.9359 0.0319 0 116

3641.6592 3641.8035 -0.1442 0 38

203 pathogenesis-related protein 10 Solanum virginianum 9252603 51317936 1430.7985 1430.7252 0.0733 0 78

2326.1660 2326.1943 -0.0283 1 134

2647.2405 2647.3162 -0.0757 1 23

204 miraculin (low homology) - Merops family I03.UNA 53696569 14329818 1111.5463 1111.5372 0.0092 0 54

1138.5858 1138.5771 0.0088 1 53

1612.8531 1612.8361 0.0170 0 (86)

1640.8504 1640.8310 0.0194 0 99

1856.8294 1856.8111 0.0183 0 164

2326.1873 2326.1943 -0.0070 1 123

205 chloroplast small heat shock protein class I Capsicum frutescens 13615181 40646966 1042.5823 1042.5083 0.0740 0 42

3055.4922 3055.5614 -0.0692 1 23

2326.1765 2326.1943 -0.0178 1 129

2647.2703 2647.3162 -0.0459 1 54

221 Kunitz-type enzyme inhibitor S9C11 - Merops family I03.017 Solanum tuberosum 18308088 1309.6487 1309.5687 0.0801 0 84

1389.7799 1389.7148 0.0651 0 63

1606.8697 1606.8276 0.0421 1 48

2373.1358 2373.1487 -0.0129 1 147

228 enolase Solanum lycopersicum 119354 1803.9573 1803.9366 0.0207 0 60

1826.8900 1826.8686 0.0215 0 68

1910.9734 1910.9633 0.0101 0 28

2003.0977 2003.0951 0.0026 0 97

2251.1197 2251.1219 -0.0022 0 41

273 proteinase inhibitor - Merops family I03.030 Theobroma bicolor 115273255 19171721 1074.6544 1074.6226 0.0319 0 53

1095.6066 1095.5713 0.0354 0 59

1123.5996 1123.5662 0.0334 0 (55)

1573.8919 1573.8616 0.0303 1 52

1601.8842 1601.8565 0.0277 1 (27)

2564.1392 2564.1385 0.0007 0 41

274 Kunitz-type protease inhibitor precursor - Merops family I03.020 Solanum tuberosum 13178940 73920925 1017.5379 1017.4590 0.0790 0 35

2182.0794 2182.0762 0.0033 0 26

2660.1577 2660.1852 -0.0275 0 111

2816.2473 2816.2863 -0.0390 1 54

1416.7331 1416.7095 0.0236 0 58

2326.1931 2326.1943 -0.0012 1 128

2667.2805 2667.2849 -0.0044 1 61

276 putative miraculin - Merops family I03.UNA Atropa belladonna 15186341 14329818 1031.5807 1031.5837 -0.0030 0 26

1095.5724 1095.5713 0.0012 0 57

1223.6680 1223.6662 0.0018 1 47

2550.1321 2550.1229 0.0093 0 48

293 catalase Solanum tuberosum 587568 1083.5564 1083.5349 0.0215 0 72

1556.8207 1556.8020 0.0187 0 6

1608.9145 1608.8875 0.0270 0 58

1744.8220 1744.7944 0.0276 0 75

1758.8618 1758.8511 0.0107 0 33

1936.9794 1936.9431 0.0364 0 104

2359.1570 2359.1201 0.0369 0 17

3400.7327 3400.6687 0.0640 0 22

294 propolyphenol oxidase Solanum tuberosum 404585 1242.6090 1242.5880 0.0210 0 47

1172579 1950.9822 1950.9534 0.0288 1 47

13611498 1391.7727 1391.7521 0.0206 0 42

294 catalase Solanum tuberosum 587568 1936.9781 1936.9431 0.0351 0 25

1083.5627 1083.5349 0.0278 0 48

312 formate dehydrogenase Solanum lycopersicum 56562181 1688.8534 1688.8457 0.0078 0 56

1818.8858 1818.8828 0.0031 1 70

1906.0553 1906.0523 0.0030 0 114

2376.1216 2376.1202 0.0014 0 27

2469.1184 2469.1052 0.0132 0 28

2483.2415 2483.2570 -0.0154 0 19

2512.3167 2512.3226 -0.0059 0 58

2648.3030 2648.2962 0.0068 0 7

313 endochitinase 2 precursor Solanum tuberosum 1705808 1329.5952 1329.6062 -0.0109 0 44

1831.8410 1831.8423 -0.0013 0 85

2093.9324 2093.9258 0.0066 0 105

2250.0337 2250.0269 0.0068 1 22

2314.2449 2314.2420 0.0030 0 138

2362.9885 2362.9695 0.0190 0 18

2455.2144 2455.1913 0.0231 0 85

2888.3780 2888.3405 0.0376 0 85

Merops family I03.017 Nicotiana alata 62952120 161702915 1236.5867 1236.5887 -0.0020 0 44

1331.7270 1331.7350 -0.0079 0 66

1475.7434 1475.7521 -0.0087 0 83

1683.9347 1683.9559 -0.0212 0 74

2291.2080 2291.2313 -0.0233 1 14

2744.3235 2744.3544 -0.0309 0 108

2979.2212 2979.2448 -0.0236 0 92

Merops family I03.017 Nicotiana alata 39837051 161702915 1236.6856 1236.5887 0.0969 0 53

1495.8850 1495.8147 0.0704 0 58

1594.9057 1594.8507 0.0550 0 94

1658.8843 1658.8263 0.0580 0 94

2987.1480 2987.2234 -0.0754 0 48

3434.3269 3434.4464 -0.1195 1 19

53696651 2834.1919 2834.2527 -0.0607 0 56

cold inducible; similar to other osmotic stress induced gene products

including: Tomato abscisic st Solanum tuberosum 4098248 1003.5482 1003.4624 0.0859 0 43

1131.6366 1131.5573 0.0793 1 41

1399.8059 1399.7459 0.0600 0 62

1865.0087 1864.9795 0.0293 1 76

385 peroxidase Nicotiana tabacum 39793501 63253080 1294.6713 1294.6669 0.0044 0 76

1588.7987 1588.8031 -0.0044 0 37

1746.8944 1746.8974 -0.0030 0 62

1962.9328 1962.9325 0.0003 0 44

2204.1116 2204.1115 0.0001 1 56

2651.2241 2651.2148 0.0093 0 109

1588.8476 1588.8031 0.0445 0 44

1746.9303 1746.8974 0.0329 0 59

1962.9503 1962.9325 0.0178 0 25

2336.1663 2336.1794 -0.0130 0 54

2651.1800 2651.2148 -0.0348 0 97

387 putative mitochondrial NAD-dependent malate dehydrogenase Solanum tuberosum 21388546 1589.9290 1589.9140 0.0150 0 86

1753.9877 1753.9825 0.0052 0 37

1810.0351 1810.0385 -0.0034 0 41

1858.9378 1858.9312 0.0067 0 92

2940.6333 2940.6436 -0.0102 0 51

2979.5579 2979.5665 -0.0085 0 99

388 fructose-1,6-bisphosphate aldolase Lycopersicon esculentum 14484932 1314.7154 1314.6720 0.0434 0 65

1345.7638 1345.7241 0.0397 0 29

2912.4702 2912.5065 -0.0363 0 26

3131.5496 3131.6688 -0.1192 1 65

162462282 2658.2805 2658.2984 -0.0178 2 11

389 peroxidase Solanum lycopersicum 17072810 295355 1029.7030 1029.5971 0.1059 0 29

1263.6149 1263.5277 0.0872 0 8

1442.9140 1442.8357 0.0783 0 16

1703.9054 1703.8478 0.0576 0 54

2285.1375 2285.1395 -0.0020 0 23

407 osmotin-like protein Solanum nigrum 53787638 1528.9571 1528.8110 0.1461 1 26

1923.9654 1923.8897 0.0757 0 81

1935.9613 1935.8897 0.0716 0 (21)

1951.9560 1951.8846 0.0714 0 (7)

3044.0008 3044.2077 -0.2068 0 116

1584.8710 1584.7493 0.1217 0 68

2613.1885 2613.2782 -0.0897 0 44

3233.3845 3233.6177 -0.2331 1 39

Merops family I03.017 Nicotiana alata 16830501 161702915 1236.6815 1236.5887 0.0928 0 35

1475.8225 1475.7521 0.0704 0 83

1684.0059 1683.9559 0.0500 0 78

2979.1548 2979.2448 -0.0900 0 41

410 Proteasome subunit alpha type-7 Lycopersicon esculentum 3334299 1633.8733 1633.8563 0.0171 0 76

1721.9348 1721.9134 0.0214 0 83

1850.0185 1850.0083 0.0102 1 81

1998.9951 1998.9996 -0.0045 0 69

2495.2107 2495.2154 -0.0047 0 13

419 putative pathogen-induced protein Solanum lycopersicum 20269125 1470.6909 1470.6714 0.0196 0 52

1482.6878 1482.6714 0.0165 0 (46)

1498.6845 1498.6663 0.0182 0 (21)

1685.8175 1685.7984 0.0192 1 38

1697.8125 1697.7984 0.0142 1 (23)

420 pathogenesis-related protein Solanum lycopersicum 19315 1528.9604 1528.8110 0.1494 1 39

1923.9618 1923.8897 0.0721 0 86

2165.9641 2165.9517 0.0124 0 59

2986.0139 2986.2022 -0.1882 0 123

3445.0801 3445.4002 -0.3201 0 5

421 aspartic protease inhibitor precursor Solanum tuberosum 20137277 1347.6984 1347.6418 0.0566 0 36

1517.7196 1517.6569 0.0628 0 73

2033.9668 2033.9615 0.0053 0 117

cold inducible; similar to other osmotic stress induced gene products

including: Tomato abscisic st Solanum tuberosum 4098248 1003.5227 1003.4624 0.0604 0 34

1131.6099 1131.5573 0.0526 1 35

1228.6652 1228.6115 0.0538 0 36

1399.7918 1399.7459 0.0459 0 66

1864.9953 1864.9795 0.0159 1 63

448 peroxidase Nicotiana tabacum 14031049 1088.5486 1088.4960 0.0526 0 16

1140.6850 1140.6251 0.0599 0 67

1657.7910 1657.7584 0.0327 0 44

1813.8770 1813.8595 0.0176 1 47

2232.0562 2232.0521 0.0041 0 68

1781328 1996.9751 1997.0806 -0.1055 2 34

449 propolyphenol oxidase Solanum tuberosum 404585 1242.5907 1242.5880 0.0027 0 26

1665.8468 1665.8474 -0.0006 0 26

2972.3482 2972.3365 0.0118 2 16

1172579 1950.9503 1950.9534 -0.0031 1 41

1796.8753 1796.8329 0.0424 1 (19)

1813.8878 1813.8595 0.0284 1 70

2232.0618 2232.0521 0.0097 0 31

2918.2539 2918.2963 -0.0423 0 45

1781328 1996.9851 1997.0806 -0.0955 2 40

471 endochitinase 4 precursor Solanum tuberosum 1705810 1373.6988 1373.6211 0.0777 0 83

1663.8311 1663.7742 0.0569 0 123

2310.2351 2310.2470 -0.0119 0 118

3273663 1857.8892 1857.8468 0.0425 0 100

13548695 2093.9475 2093.9258 0.0217 0 75

2250.0266 2250.0269 -0.0003 1 32

1796.8461 1796.8329 0.0132 1 (28)

1813.8679 1813.8595 0.0085 1 68

55296784 1757.9140 1757.8584 0.0556 0 62

1389835 1989.9374 1989.9254 0.0120 1 26

1746.9461 1746.8974 0.0487 0 47

1962.9636 1962.9325 0.0311 0 9

2336.1682 2336.1794 -0.0111 0 34

2651.1619 2651.2148 -0.0529 0 71

474 peroxidase precursor Euphorbia characias 56385009 39836715 1088.5415 1088.4960 0.0455 0 14

1757.9248 1757.8947 0.0301 0 67

1813.8781 1813.8595 0.0187 1 39

1989.9386 1989.9254 0.0132 1 34

2192.0381 2192.0201 0.0180 0 94

2768.3128 2768.3187 -0.0059 0 51

474 glyceraldehyde 3-phosphate dehydrogenase Solanum tuberosum 22094840 2144.0061 2143.9909 0.0152 0 68

1657.7862 1657.7584 0.0279 0 45

1796.8604 1796.8329 0.0275 1 (10)

1813.8740 1813.8595 0.0146 1 50

55296784 1757.9226 1757.8584 0.0642 0 41

476 glucan endo-1,3-beta-glucosidase Solanum tuberosum 1706545 1250.6464 1250.6295 0.0169 1 29

1353.7237 1353.7081 0.0156 0 37

1452.7606 1452.7473 0.0133 0 53

1665.9291 1665.9301 -0.0009 0 51

1876.8402 1876.8335 0.0067 0 23

2358.1223 2358.1161 0.0062 0 58

481 porin Mesembryanthemum crystallinum 39830131 1724100 1560.8677 1560.8511 0.0166 1 68

2085.0855 2085.0755 0.0100 0 54

2830.3848 2830.4025 -0.0176 1 72

481 1,3-beta-glucan glucanohydrolase Solanum tuberosum 3192863 1353.7320 1353.7081 0.0239 0 26

19869 1045.5327 1045.5345 -0.0017 0 43

461979 1452.7427 1452.7473 -0.0046 0 56

516 cysteine protease inhibitor precursor - Merops family I03.017 Solanum tuberosum 585699 1253.6447 1253.5887 0.0560 1 71

1391.7316 1391.6802 0.0514 0 63

2010.0840 2010.0713 0.0127 1 63

2081.1150 2081.1084 0.0066 2 92

435816 1726.9219 1726.8889 0.0330 0 62

517 aspartic proteinase inhibitor precursor - Merops family I03.002 Solanum tuberosum 19919828 1172.6258 1172.5900 0.0359 0 46

1410.6514 1410.6197 0.0317 0 77

1517.6872 1517.6569 0.0304 0 74

1967.0990 1967.0839 0.0151 1 34

2033.9689 2033.9615 0.0074 0 120

518 Kunitz-type protease inhibitor precursor - Merops family I03.020 Solanum tuberosum 13178940 73920925 2073.0093 2072.9942 0.0152 1 78

2182.0830 2182.0762 0.0069 0 16

2660.1675 2660.1852 -0.0177 0 69

2816.2566 2816.2863 -0.0297 1 47

539 Kunitz-type trypsin inhibitor - Merops family I03.017 Solanum tuberosum 78747594 24745615 1253.6132 1253.5887 0.0245 1 71

1303.7116 1303.6884 0.0232 1 78

2440.2901 2440.2936 -0.0035 0 11

557 peroxidase Sesamum indicum 45291574 82698813 1229.7193 1229.7132 0.0062 0 36

1437.6469 1437.6493 -0.0024 0 11

1504.8834 1504.8765 0.0069 1 69

1888.9784 1888.9682 0.0102 0 55

1911.9245 1911.9148 0.0097 0 66

13609458 1063.4618 1063.4610 0.0008 0 53

1361.6282 1361.6285 -0.0003 0 56

53699787 1859.9409 1859.9417 -0.0008 0 50

558 putative peroxidase Solanum tuberosum 14485511 1371.7422 1371.6856 0.0566 0 64

1485.7699 1485.7252 0.0447 0 98

1518.9417 1518.8922 0.0495 1 74

1729.9397 1729.8998 0.0399 0 120

1829.8896 1829.8618 0.0279 0 80

1897.9279 1897.8992 0.0287 0 74

2444.2805 2444.2910 -0.0105 1 21

559 polygalacturonase inhibitor protein Solanum lycopersicum 46293457 469457 1402.7681 1402.7456 0.0225 1 28

1591.8512 1591.7882 0.0630 0 62

2116.2281 2116.2044 0.0237 0 72

2849.4143 2849.4711 -0.0568 0 86

46292112 1160.6618 1160.5502 0.1117 1 43

1388.7232 1388.6400 0.0832 0 48

1485.7871 1485.7173 0.0698 0 62

561 peroxidase precursor Euphorbia characias 56385009 39836715 1757.9027 1757.8947 0.0080 0 77

1813.8621 1813.8595 0.0027 1 35

1885.9987 1885.9897 0.0090 1 4

1989.9308 1989.9254 0.0054 1 18

2192.0344 2192.0201 0.0143 0 39

2261.0967 2261.0786 0.0181 0 15

2768.3404 2768.3187 0.0217 0 29

1522.8062 1522.7568 0.0494 0 68

1650.8900 1650.8518 0.0383 1 59

1786.9439 1786.9069 0.0370 0 8

1911.0003 1910.9697 0.0306 0 151

2110.9531 2110.9517 0.0014 0 50

2832.4234 2832.4803 -0.0569 1 15

581 glucan endo-1,3-beta-glucosidase Solanum tuberosum 1706545 1353.7628 1353.7081 0.0547 0 52

1452.7978 1452.7473 0.0505 0 62

1665.9394 1665.9301 0.0094 0 51

1876.8480 1876.8335 0.0145 0 18

2358.1023 2358.1161 -0.0138 0 59

3186.4534 3186.5217 -0.0682 0 34

1522.8103 1522.7568 0.0535 0 60

1650.8939 1650.8518 0.0422 1 59

1786.9395 1786.9069 0.0326 0 16

1910.9981 1910.9697 0.0284 0 83

2113.0745 2113.0803 -0.0058 0 93

583 endochitinase 1 precursor Solanum tuberosum 52844197 1705805 1608.8281 1608.7572 0.0709 0 76

1857.9009 1857.8468 0.0542 0 80

2271.1958 2271.2110 -0.0152 0 107

46295720 2092.9639 2092.9418 0.0221 0 63

2249.0330 2249.0429 -0.0099 1 11

585 acid phosphatase Glycine max 17072634 3341443 1475.7250 1475.7006 0.0244 1 36

1701.0441 1701.0188 0.0253 0 77

2130.0779 2130.0705 0.0075 0 154

2571.2808 2571.2968 -0.0160 1 68

2921.3460 2921.3719 -0.0258 1 120

2949.3426 2949.3668 -0.0242 1 (102)

1432.7567 1432.7310 0.0257 0 67

putative Kunitz-type tuber invertase inhibitor precursor - Merops family

I03.017 Solanum tuberosum 18140067 1253.6088 1253.5887 0.0201 1 85

2032.1421 2032.1033 0.0388 1 85

2103.1804 2103.1404 0.0400 2 94

20137687 1151.5905 1151.5645 0.0260 0 51

597 cysteine protease inhibitor - Merops family I03.002 Solanum tuberosum 20137684 1253.6928 1253.5887 0.1041 1 45

1952.0644 1952.0294 0.0350 1 59

2023.0891 2023.0666 0.0226 2 65

2261.0779 2261.0811 -0.0031 0 73

1515.8380 1515.7544 0.0836 0 30

598 psmotin-like protein OSML81 precursor Solanum commersonii 1709497 1908.8935 1908.8141 0.0794 0 63

1923.9591 1923.8897 0.0694 0 64

1935.9660 1935.8897 0.0763 0 (18)

1951.9661 1951.8846 0.0815 0 (12)

2985.9986 2986.2022 -0.2035 0 25

616 cyclophilin Solanum tuberosum subsp. tuberosum 4559302 1365.7292 1365.6850 0.0443 0 66

1419.8035 1419.7510 0.0525 0 79

2706.1880 2706.2053 -0.0173 0 69

2753.2532 2753.2901 -0.0368 0 27

616 aspartic protease inhibitor - Merops family I03.002 Solanum tuberosum 124148 2548.1875 2548.2015 -0.0140 1 57

124012 1517.7227 1517.6569 0.0659 0 45

21413 1347.6827 1347.6418 0.0409 0 66

617 pathogenesis-related protein PR-1 precursor Capsicum annuum 13560653 1365.7777 1365.6789 0.0988 0 75

1378.7215 1378.6299 0.0916 0 15

1407.7631 1407.6717 0.0914 0 48

1534.8061 1534.7310 0.0751 1 13

2614.2132 2614.2597 -0.0465 0 86

Kunitz proteinase inhibitor homologue (stigma expressed protein) - Merops

family I03.017 Nicotiana alata 53778384 161702913 1193.5994 1193.5717 0.0278 0 61

1563.8150 1563.7933 0.0218 1 60

53787991 1594.8700 1594.8507 0.0193 0 91

2311.1604 2311.1636 -0.0032 0 (50)

2339.1543 2339.1585 -0.0042 0 60

630 cystatin Actinidia deliciosa 45289584 40807637 1291.7392 1291.6520 0.0872 0 50

1568.8844 1568.8238 0.0606 0 48

1596.8861 1596.8188 0.0674 0 (34)

1624.8769 1624.8137 0.0632 0 (30)

2724.3645 2724.4081 -0.0436 2 40

1608.8727 1608.8188 0.0540 0 31

630 putative non-specific lipid transfer protein Solanum tuberosum 62119569 21952514 1544.8626 1544.8020 0.0606 0 76

630 probable protease inhibitor P322 precursor Solanum tuberosum 129350 1137.5679 1137.4774 0.0906 0 26

631 probable protease inhibitor P322 precursor Solanum tuberosum 129350 1137.5852 1137.4774 0.1079 0 36

1293.6696 1293.5785 0.0912 1 19

681 plant basic secretory protein Arabidopsis thaliana 15226060 1213.6044 1213.5363 0.0681 0 63

1429.8178 1429.7565 0.0614 0 108

5360263 1728.8731 1728.8332 0.0400 0 18

Sequences

-.EVFFEESFNDGWESR.W + kynurenin (W)

-.EVFFEESFNDGWESR.W + DOUBLE Ox (W)

K.SGTLFDNVVICDDPEYAK.S

K.APMIDNPDFKDDPDLYVFPK.L + Oxidation (M)

K.LKYVGVELWQVK.S + kynurenin (W)

R.IIVFAGSPVKYDK.K

R.IIVFAGSPVK.Y

R.EMVALAGAHTVGFAR.C + Oxidation (M)

K.MGNLPTSAGAQLEIR.D + Oxidation (M)

R.EMVALAGAHTVGFAR.C+ Oxidation (M) + Pyro-glu (N-term E)

K.NILFVISKPDVFK.S

K.SKNILFVISKPDVFK.S

K.IEDLSSQLQSQAAEQFK.A

K.SPNSDTYVIFGEAK.I

K.INEEYSILSVFPGGGSTYLADLGNTK.C

R.VFDKDQNGFISAAELR.H

K.QSGSLYSDWDLLPPK.T + kynurenin (W)

K.FGGDTPYSIMFGPDICGYSTK.K + Oxidation (M)

K.KFGGDTPYSIMFGPDICGYSTK.K + Oxidation (M)

K.APMIDNPDFKDDPDIYVFPK.L + Oxidation (M)

K.SGTLFDNVLVCDDPEYAK.Q

-.EVFFEESFNDGWESR.W + kynurenin (W)

-.EVFFEESFNDGWESR.W + DOUBLE Ox (W)

-.KHHFGGLFHHHK.N

K.HLEEIGGLGAVAAGAFALHEK.H

K.TTYEETTYGESEKTSTYGEK.T

K.TSYGDDTYGEKPTSYGGDNTYGEK.T

K.TSYGDSGYGEKPSYGGGDDNKYGEK.T

K.TSYGDDTYGEKTTTFGDDNKYGEK.T

K.HLEEIGGLGAVAAGAFALHEK.H

K.TTYEETTYGESEKTSTYGEK.T

K.TSYGDDTYGEKPTSYGGDNTYGEK.T

K.TSYGDSGYGEKPSYGGGDDNKYGEK.T

-.KHHFGGLFHHHKNEEEDTPVEK.T

R.GIIPATILEFLEGQLQEXDNNADAR.L

R.LADYFDVIGGTSTGGLLTAXISTPNENNRPFAAAK.E

K.DIVPFYFEHGPK.I

R.VHQALTEVAISSFDIK.T

K.DIVPFYFEHGPK.I

K.YLMQVLQEK.L + Oxidation (M)

K.DIVPFYFEHGPK.I

K.YDGKYLMQVLQEK.L + Oxidation (M)

K.YGKLDETQGIGQYVEK.A

K.AETYLHQYGGDKAPAAAPVAEEAK.A

K.APAPAPESAPASEPAPAPVVEEDKEEEKK.S

K.DIIPFYFDHGPK.I

K.IFEPSGFHLFEPK.Y

K.LDETQGIGQYVEK.A

K.YGKLDETQGIGQYVEK.A

K.VLADAAQSQFNKDSDKIDNK.K

K.AETYLHQYGGDKAPAAAPVAEEAK.A

K.DVNGGFDNGYPR.L

K.LLYCPPQLVCK.D

K.CPNDVLLHIPYLGLTGDGTPVK.F

K.DVNGGFDNGYPR.L

K.CPNDVLLHIPYLGLTGDGTPVK.F

K.EYIIETPIIEGGSVYLDNIGGHK.C

K.VNDEELVVTGGNVGNENDIFK.I

db-entry LVLPEVYDQDGEPLR

K.YDIISEMSTVNIK.F + Oxidation (M)

R.YFIVSAIWGAGGGGVR.L + kynurenin (W)

R.YFIVSAIWGAGGGGVR.L + Oxidation (HW)

R.YFIVSAIWGAGGGGVR.L + DOUBLE Ox (W)

R.LANLGNQGQNDCPTSVVQSR.N

K.LGSHFVSENQDVSIK.F

R.TIRDIEGNPLNK.N

K.YDIISEMSTVNIK.F + Oxidation (M)

R.YFIVSAIWGAGGGGVR.L + Oxidation (HW)

R.LANLGNQGQNDCPTSVVQSHNDLDNGIAVYITPHDPK.Y

K.MCVSYTIWK.V + Oxidation (M); kynurenin (W)

R.YNSDVGPSGTPVR.F

K.SPNSDAPCANGVFR.Y

R.IISTFWGALGGDVYLGK.S + kynurenin (W)

K.VGDYDASLGTMLLETGGTIGQADSSWFK.I + Oxidation (M); kynurenin (W)

R.WPELIGVPAQYAK.G

K.QRWPELIGVPAQYAK.G + kynurenin (W)

K.QRWPELIGVPAQYAK.G + DOUBLE Ox (W)

R.VRIAVNILDYAVSMPVVG.- + Oxidation (M)

K.ENTLIADVQIILNGSPVTADFSCNR.V

K.GIIEKENTLIADVQIILNGSPVTADFSCNR.V

K.LRWPELIGVPAQYAK.G + kynurenin (W)

K.DYTFICDGESTDWQSGK.A + kynurenin (W)

K.DYTFICDGESTDWQSGK.A + DOUBLE Ox (W)

K.YFSKDYTFICDGESTDWQSGK.A + kynurenin (W)

K.YFSKDYTFICDGESTDWQSGK.A + DOUBLE Ox (W)

R.HSQNNYLR.V

K.YFLQVLQEK.L

K.DSPETYEEALKR.F

K.GIIPATILEFLEGQLQEVDNNKDAR.L

R.VQENALTGTTTEMDDASEANMELLVQVGEK.L + 2 Oxidation (M)

R.LADYFDVIGGTSTGGLLTAMITTPNENNRPFAAAK.D + Oxidation (M)

R.HSQNNYLR.V

K.YLLQVLQEK.L

R.LAQEDPAFSSIK.S

K.DSPETYEEALKR.F

R.YEFNLVDGAVATVGDPALLSLSVATR.L

R.HSQNNYLR.V

K.YLLQVLQEK.L

R.LAQEDPAFSSIK.S

K.DSPETYEEALKR.F

R.TFSKDFAESMIK.M + Oxidation (M)

R.IYDETNNIDSTFASQR.Q

R.SGGDSNLASLDPTPALFDSK.Y

R.DSVVALHGPTWEVELGRR.D + kynurenin (W)

R.TTANNDIPTPLMDLPALIDNFKK.Q + Oxidation (M)

K.QGLDEEDLVALSGGHTLGFAQCSTFR.N

R.HSQNNYLR.V

K.YFLQVLQEK.L

K.DSPETYEEALKR.F

K.SIEIVEGDGGAGSIK.Q

K.YSLIEGDVLGDKLESIAYDVK.F

K.SIEIVEGDGGAGSIKQMNFVEGGPIK.Y + Oxidation (M)

K.LVFCPYGEK.F

K.AFVFQKDER.I

K.FTCQNVGIADENGYNR.L

K.SIEVVEGDGGAGSIK.Q

R.ETSVFAYAR.I

R.SIIVDPLSQDIRDPFEGFPIANPSSSVR.E

K.SIEIVEGDGGAGSIK.Q

K.SIEIVEGDGGAGSIKQMNFVEGGPIK.Y + Oxidation (M)

K.DVNGGFDNGYPR.L

K.LLYCPPQLVCK.D

K.IEMELPDLKNVYK.L + Oxidation (M)

K.VGDEKDFLVTGGTVGNENTFFK.M

R.AAVPSGASTGIYEALELR.D

R.IEEELGSEAVYAGASFR.K

K.LAMQEFMILPVGAANFK.E + 2 Oxidation (M)

K.LVLPVPAFNVINGGSHAGNK.L

R.SGETEDTFIADLAVGLSTGQIK.T

R.GWPVIFKPK.A + kynurenin (W)

K.NVASWFQIK.K + kynurenin (W)

K.NVASWFQIK.K + DOUBLE Ox (W)

R.DLDRGWPVIFKPK.A + kynurenin (W)

R.DLDRGWPVIFKPK.A + DOUBLE Ox (W)

K.LMFCPYGEPICTDIGIDYTAGR.R + Oxidation (M)

K.CGSYTIWK.V + kynurenin (W)

R.LLGYELITCDGALVGTMGQR.V + Oxidation (M)

R.GPYGGDIYLDYSPGSTAPCPDGVFR.Y

K.RGPYGGDIYLDYSPGSTAPCPDGVFR.Y

K.QMNFVEGGPFK.Y + Oxidation (M)

K.SIEVVEGDGGAGSIK.Q

K.SIEVVEGDGGAGSIKQMNFVEGGPFK.Y + Oxidation (M)

K.GMPVIFKPK.A + Oxidation (M)

K.NVASWFQIK.K + kynurenin (W)

K.NVASWFQIKK.T + kynurenin (W)

K.LMFCPYGEPICSDIGIDYTAGR.R + Oxidation (M)

R.IFAYADTQR.H

R.IGPNYMQLPVNAPK.C + Oxidation (M)

K.TWPEDLLPLIPVGR.L + kynurenin (W)

K.DLYDSIAAGNYPEWK.L + kynurenin (W)

R.HMEGFGVHAYQLINK.E + Oxidation (M)

R.EGNFDLVGNNVPVFFNR.D

R.FDPCRPAEQYPIPACVLNGR.R

K.YRPSSAYDTPFLTTNAGGPVYNNVSSLTVGPR.G

K.IAYDDTQYVR.F

R.TTQEKNEQEEILTFNK.V

R.AISFSITRPASSR.T

R.EGNFDLVGNNVPVFFNR.D

R.IFAYADTQR.H

R.LKPFNCNLLYHDR.L

R.YFKGEDFPAENYIVK.D

K.NLQLLLTAGIGSDHVDLK.A

R.YMPNQAMTPHISGTTIDAQLR.Y + 2 Oxidation (M)

K.ANEYAEMNPNFLGCAENALGIR.E + Oxidation (M)

R.NFLPGHHQVINGEWNVAAIAHR.A + kynurenin (W)

K.HIPDLHVLISTPFHPAYVTAER.I

K.AAAAAGLTVAEVTGSNTVSVAEDELMR.I + Oxidation (M)

R.WQPSGTDQAANR.V

R.GPIQISHNYNYGPCGR.A

R.YCGILGVSPGDNLDCGNQR.S

R.RYCGILGVSPGDNLDCGNQR.S

R.AIGVDLLNNPDLVATDSIISFK.S

R.EQGSPGDYCTPSNQWPCAPGR.K

R.VPGFGVITNIINGGLECGHGSDSR.V

K.GNFYSYNAFISAAGSFPGFGTTGDITAR.K

K.YETGRPHSYK.L

R.LALNNKPYPFR.F

K.AGDYTLGPVHPPPR.F

R.FVITGGTLGIPGPNTLK.N

R.FVITGGTLGIPGPNTLKNWFK.I + DOUBLE Ox (W)

K.INEEYSILSVFPGGGSTYLADLGNTK.C

R.YCPSQFICPTCHFDCADVGLYQNK.G

K.YETGRPHSYK.L

K.VAYSIVGPTHSPLR.F

R.LALNNKPYPFGFSK.V

K.LGSHFVSENQDVSIK.F

R.YCPSQYICPTCQFDCADVGLYENK.G

R.YCPSQYICPTCQFDCADVGLYENKGYAR.L

K.CPNGVVQDSSGEFDNNTPVLFYTMK.L + Oxidation (M)

K.AEGGHHHLF.-

K.KAEGGHHHLF.-

K.LGTVAAGAYALHEK.H

K.LGTVAAGAYALHEKHEAK.K

R.TYNSNPALFLR.E

R.EMVALVGSHTVGFAR.C + Oxidation (M)

R.DSVAMLGGIPYPVSLGR.K + Oxidation (M)

K.TMCPGAAVSCADILALAAR.D + Oxidation (M)

R.IKTMCPGAAVSCADILALAAR.D + Oxidation (M)

R.LFFHDCFVDGCDAGILLDDIPGR.F

R.TYNSNPALFLR.E

R.EMVALVGSHTVGFAR.C + Oxidation (M)

R.NQGLLFSDQVLMGSTATANVVR.T + Oxidation (M)

K.ALEGADIVIIPAGVPR.K

K.QGLEALKPELLSSIEK.G

K.VAVLGAAGGIGQPLSLLMK.L + Oxidation (M)

K.NGVEEVLGLGPLNEYEK.Q

K.VNVAEVNLPVVGGHAGITILPLFSQATPK.A

K.LNPLVSSLSLYDIAGTPGVAADVSHINTR.S

K.KPWSLSFSFGR.A + kynurenin (W)

K.VAPEVIAEYTVR.A

K.ALNDHHVLLEGTLLKPNMVTPGSESPK.V + Oxidation (M)

R.YAIICQQNGLVPIVEPEILVDGAHDIKK.C

K.VDKGTIEVVGTDKETTTQGHDDLGK.R + Oxidation (HW)

K.FGIPNLTLR.G

R.MHFHDCFVR.G + Oxidation (M)

K.HIPNAPSLAAALIR.M

R.DSVVVTGGPSWSVPTGR.R + kynurenin (W)

K.IIEDECPGVVSCADIVALVAR.D

R.LDRGQTWVINAPR.G + kynurenin (W)

R.NNCPYTVWAASTPIGGGR.R + kynurenin (W)

R.NNCPYTVWAASTPIGGGR.R + Oxidation (HW)

R.NNCPYTVWAASTPIGGGR.R + DOUBLE Ox (W)

R.CPDAYSYPQDDPTSTFTCPSDSTNYR.V

R.LGLSETPIYFQFK.L

K.DVTDNGIAVYFMPK.D + Oxidation (M)

R.EDVPLNGHTISTGGELVNPADHVSR.W

K.VDHLREDVPLNGHTISTGGELVNPADHVSR.W

K.YETGRPHSYK.L

K.AGDYTLGPVHPPPR.F

R.FVITGGTLGIPGPNTLK.N

R.YCPSQFICPTCHFDCADVGLYQNK.G

R.LTVEDPVTVEYITR.Y

K.IVNLDDHIALACAGLK.A

R.KIVNLDDHIALACAGLK.A

K.QLEEAEIDAIVAEIEAEK.A

R.AITVFSPDGHLFQVEYAMEAVR.K + Oxidation (M)

K.YGWTAFCGPVGPR.G + kynurenin (W)

K.YGWTAFCGPVGPR.G + Oxidation (HW)

K.YGWTAFCGPVGPR.G + DOUBLE Ox (W)

R.SKYGWTAFCGPVGPR.G + kynurenin (W)

R.SKYGWTAFCGPVGPR.G + Oxidation (HW)

R.LDRGQTWVINAPR.G + kynurenin (W)

K.CHAIHCTANINGECPGSLR.V

R.CPDAYSYPQDDPTSTFTCPSGSTNYR.V

R.VPGGCNNPCTTFGGQQYCCTQGPCGPTDLSR.F

R.YNSDVGPSGTPVR.F

K.SPNSDAPCPDGVFR.Y

R.TMLLETGGTIGQADSSYFK.I + Oxidation (M)

K.AEGGHHHLF.-

K.KAEGGHHHLF.-

K.HHHHLFHHK.D

K.LGTVAAGAYALHEK.H

K.LGTVAAGAYALHEKHEAK.K

K.YYVDLMNR.Q + Oxidation (M)

R.QDIGQAAGLLR.L

R.QGLFTSDQDLYTDR.R

R.QGLFTSDQDLYTDRR.T

K.GLSWTFYDSICPNAESIIR.S + kynurenin (W)

R.DGVQLLGGPTWNVKLGRR.D + DOUBLE Ox (W)

K.IAYDDTQYVR.F

R.IRPPAHAADEEYVAK.Y

R.DLSNKDWLNSEFFFYDENRNPYR.V + kynurenin (W)

R.TTQEKNEQEEILTFNK.V

R.QGLFTSDQDLYTDR.R

R.QGLFTSDQDLYTDRR.T + Pyro-glu (N-term Q)

R.QGLFTSDQDLYTDRR.T

K.GLSWTFYDSICPNAESIIR.S + kynurenin (W)

R.LHFHDCFVQGCDGSVLLDGSASGPSEK.D

R.DGVQLLGGPTWNVKLGRR.D + DOUBLE Ox (W)

R.SFGGFGTTGDTTAR.K

K.NNFYSYNAFINAAR.S

R.AIGVDLLNNPDLVATDPVISFK.S

R.GPIQISYNYNYGPCGR.A

R.YCGILGVSPGDNLDCGNQR.S

R.RYCGILGVSPGDNLDCGNQR.S

R.QGLFTSDQDLYTDRR.T

R.DAVDLTGGPSWSVPLGR.R + DOUBLE Ox (W)

R.SPNVFDNKYYVDLMNR.Q + Oxidation (M)

K.FYYEDLIR.N

R.NQGLLFSDQVLMGSTATANVVR.T + Oxidation (M)

R.DSVVLTGGPNYDVPLGR.K

R.QGLFTSDQDLYTDRR.T

R.IQDECGQVVSCSDITAIAAR.D

K.GLDATDAVALSGAHTIGISHCPSFTDR.L

K.GILGYTEDDVVSTDFVGDSR.S

R.QGLFTSDQDLYTDR.R

R.QGLFTSDQDLYTDRR.T

R.DAVDLTGGPSWSVPLGR.R + DOUBLE Ox (W)

K.NVKDFWPDVK.I + kynurenin (W)

R.WFTDPIVGFLR.D + kynurenin (W)

R.LYDPNHGALNALR.G

R.GSNIEVILGLPNVDVK.H

R.NLFDAMLDSVYAAMER.T + 2 Oxidation (M)

K.VSTSVDMTLIGNSYPPSQGSFR.N + Oxidation (M)

R.TYNSNPALFLR.E

K.KGDLFLADVNTQLK.N

R.VNNFGTATALIQHEWRPK.S + kynurenin (W)

R.DYQTDHKFTITTYSPTGVAITSSGLK.K

K.HFGLFSPNK.Q

R.LYDPNHGALNALR.G

R.KSESDYGDVVR.V

K.LLHCPSHLQCK.N

R.LVTVDDDKDFLPFVFIK.A

R.LVTVDDDKDFLPFVFIKA.-

-.LVLPEVYDQDGNPLR.I

K.LCVSYTIWK.V + kynurenin (W)

R.YNSDVGCSGTPVR.F

K.SPNSDAPCPDGVFR.Y

R.RLALVNENPLDVLFQQV.-

R.TMLLETGGTIGQADSSYFK.I + Oxidation (M)

R.VALVSNFSLDFDFEKVED.-

R.LLGYELITCDGALVGTMGQR.V + Oxidation (M)

R.GPYGGDIYLDYSPGSTAPCPDGVFR.Y

K.RGPYGGDIYLDYSPGSTAPCPDGVFR.Y

R.KSESDYGDVVR.V

K.VGNENDIFKIR.K

-.AVLQHMSIPQFLGEGTPVVFVR.K + Oxidation (M)

K.QTFVTVPAVLR.L

K.QYAAQLQGMCPR.N + Oxidation (M)

K.FKQTFVTVPAVLR.L

R.DVIQLSGGPWYPVELGR.L + kynurenin (W)

K.TNYYANICPNVESIVR.N

R.TFDNNYYK.N

K.SFQNAFTTAMTK.L + Oxidation (M)

R.IYNFSPQNPIDPTLNK.Q

K.VFQTAFVNAMTK.L + Oxidation (M)

R.AFDNVYFQNLQK.G

K.FKQTFVTIPAVLR.L

R.DVIQLSGGPGYAVELGR.L

K.GMGLFTSDQVLFTDQR.S + Oxidation (M)

K.TNFYAQTCPNVESIVR.N

R.DVIQLSGGPGYAVELGRLDGLTSK.S

R.NKLSGPIPESFSK.L

K.GLGNPYDLITWDPK.T + kynurenin (W)

K.LVGTIPPSLSQLPHLEFLR.L

K.IEDVGHLSPAIGDLPYLTSFSIHNVR.N

R.NKFEFDFSK.L

R.FEIYEYFHNK.C

R.NMLEGDISFLFGK.D + Oxidation (M)

R.DSVVLTGGPNYDVPLGR.K

R.QGLFTSDQDLYTDRR.T

R.DSVVLTGGPNYDVPLGRK.D

R.IQDECGQVVSCSDITAIAAR.D

K.GLSWSFYQSSCPQLESIIR.K + kynurenin (W)

K.GLDATDAVALSGAHTIGISHCPSFTDR.L

R.DSVVILGGPNWDVK.L + kynurenin (W)

R.FDNHYFINLVNK.K

R.FDNHYFINLVNKK.G

K.VCPGVVSCADILAVTAR.D

R.ASGSGDNNLAPLDLLTPTR.F

K.SYSNNPSSFTSDFVTAMIK.M + Oxidation (M)

R.LISSFSAVGLSTKDMVALSGAHTIGQAR.C + Oxidation (M)

R.LYDPNHGALNALR.G

R.GSNIEVILGLPNVDVK.H

R.NLFDAMLDSVYAAMER.T + 2 Oxidation (M)

K.VSTSVDMTLIGNSYPPSQGSFR.N + Oxidation (M)

R.TGGGSVGIVVSESGWPSAGAFGATQDNAATYLR.N + kynurenin (W)

R.DSVVILGGPNWDVK.L + kynurenin (W)

R.FDNHYFINLVNK.K

R.FDNHYFINLVNKK.G

K.VCPGVVSCADILAVTAR.D

R.ASGSGDNNLAPLDLLTPTR.F

K.GLLHSDQQLFNGGSVDSIVK.S

K.NNFYSYNAFISAAK.S

R.GPIQISYNYNYGPCGR.A

R.AIGADLLNNPDLVATNSVISFK.S

R.YCGILGVSPGNNLDCGNQR.S

R.RYCGILGVSPGNNLDCGNQR.S

R.TFKVPDPMYYIS.- + Oxidation (M)

K.TVLSLGIKPVFITGTR.E

R.IVGNIGDQWTDLIGENVGAR.T + kynurenin (W)

K.VGYTNWAALILKGENDSGSAVQFK.S + kynurenin (W)

K.LGGDGKDVWVFDIDETTLSNSPYYAR.S + kynurenin (W)

K.LGGDGKDVWVFDIDETTLSNSPYYAR.S + DOUBLE Ox (W)

R.LAVETNNLQNWK.L + kynurenin (W)

R.KSESDYGDVVR.V

R.LVTVHDDKDFIPFVFIK.A

R.LVTVHDDKDFIPFVFIKA.-

K.LCVDQTVWK.V + kynurenin (W)

R.KSESDYGDVVR.V

R.LAAVDDDKDFIPFVFIK.A

R.LAAVDDDKDFIPFVFIKA.-

K.FGYNLLYCPITR.H

K.CHAIHCTANINGECPR.A

R.NNCPYTVWAASTPIGGGR.R + Oxidation (HW)

R.NNCPYTVWAASTPIGGGR.R + DOUBLE Ox (W)

R.CPDAYSYPQDDPTSTFTCPSGSTNYR.V

R.VVMELFADTTPK.T + Oxidation (M)

R.VFFDLTIGGAPAGR.V

R.VIPGFMCQGGDFTAGNGTGGESIYGAK.F + Oxidation (M)

K.HTGTGILSMANAGPGTNGSQFFICTAK.T + Oxidation (M)

R.GALGGDVYLGKSPNSDAPCPDGVFR.Y

K.SPNSDAPCPDGVFR.Y

R.YNSDVGPSGTPVR.F

R.LAAFAQNYANQR.I

R.QVGVGPMTWDNR.L + Oxidation (M); kynurenin (W)

K.VCGHYTQVVWR.N + kynurenin (W)

R.RQVGVGPMTWDNR.L + Oxidation (M); kynurenin (W)

R.MQHSGGPYGENLAAAFPQLNAAGAVK.M + Oxidation (M)

K.YETGIPHSYK.L

K.IEKYETGIPHSYK.L

R.LALNNKPYPFGFSK.V

R.FVITGGTLGFPGPNNIENWFK.I + kynurenin (W)

R.FVITGGTLGFPGPNNIENWFK.I + DOUBLE Ox (W)

K.GESQVVAGINYR.L

K.YLVVVWDKPWEK.I + 2 kynurenin (W)

K.YLVVVWDKPWEK.I + DOUBLE Ox (W); kynurenin (W)

K.YLVVVWDKPWEK.I + 2 DOUBLE Ox (W)

K.EAGTKLEFQSITKGESQVVAGINYR.L

K.YLVVVWDKPWEK.I + DOUBLE Ox (W); Oxidation (HW)

K.AAGIPSVCGVNIPYK.I

R.FSGGNCHGFR.R

R.FSGGNCHGFRR.R

R.WDQGYDVTAR.F + kynurenin (W)

R.APGGLIEGIADYVR.L

K.AGFAPSHWVKPGQGDR.W + kynurenin (W); Oxidation (HW)

Proteomic evaluation of wound-healing processes in potato ( Solanum tuberosum L.) tuber tissue

Documents