2009-2010 IOB Master's Programmes

MASTER’SPROGRAMMES2009-2010

DEVELOPMENT EVALUATIONAND MANAGEMENT

GOVERNANCE ANDDEVELOPMENT

GLOBALISATION ANDDEVELOPMENT

A uniqueexchangeexperience in a stronginterdisciplinaryacademicenvironment

CONTENTS

This brochure reflects the views of the Institute at the time of publication.The Institute reserves the right to make changes as deemed necessary.

This brochure is also available in French.

4 THEINSTITUTEOFDEVELOPMENTPOLICYANDMANAGEMENT

ANDTHEUNIVERSITYOFANTWERP

6 THEPROGRAMMES

9 MASTEROFGLOBALISATIONANDDEVELOPMENT

10 TRACk1:GLOBALOPPORTUNITIESFORLOCALDEVELOPMENT

12 TRACk2:EVALUATINGDEVELOPMENTEFFECTIVENESS

15 MASTEROFGOVERNANCEANDDEVELOPMENT

16 TRACk1:POLITICALECONOMYOFTHEGREATLAkESREGION

18 TRACk2:LOCALINSTITUTIONSANDPOVERTYREDUCTION

21 MASTEROFDEVELOPMENTEVALUATIONANDMANAGEMENT

22 TRACk1:EVALUATINGDEVELOPMENTEFFECTIVENESS

24 TRACk2:CONCEPTUALISINGDEVELOPMENTINTERVENTIONS

26 MANAGEMENT

26 ACADEMICSTAFF

28 PRACTICALINFORMATION

30BELGIUMANDTHECITYOFANTWERP

�

IOBis an interdisciplinary academicinstitution in which people of differentopinions,religionsandnationalitiesfeel

at home. It has several decades of experience in organisinginternationaltrainingprogrammesinthefieldofdevelopmentpolicyandmanagement.ItispartoftheUniversityofAntwerp(UA)andislocatedontheUniversity’sCityCampus.

Every year, the Institute is home to some 100 students ofapproximately thirty different nationalities and from diverseacademic and professional backgrounds, which provides foranextraordinarymulticulturalandmultidisciplinarylearningenvironment. Programmes are organised in English butspecialfacilitiesareofferedtostudentsfromotherlinguisticbackgrounds(inparticulartoFrench-speakingstudents).

IOBoffersthreeMaster’sprogrammes,withahighdegreeofspecialisation and a distinct focus: Development Evaluationand Management, Governance and Development, andGlobalisation and Development. The aim of the Master’sprogrammes is to offer a policy-oriented training thatincorporatesthelatestinsightsfromsocialsciencedisciplinesrelevanttothedevelopmentchallenge.Studentsareexpectedtolearnfromeachother’sexperiencesandfromexposuretoliving and working in a developed country. The focus is onstudent-centred learning and the approach applied involvesamixofteachingmethods(ex-cathedralecturing, individualand group assignments, discussions, student presentations,literature-basedindependentstudy,seminars,guestlectures,analysisofcasestudies,simulations,individualtutoring).

Thetargetgroupconsistsmainlyofmid-careerdevelopmentprofessionals from low-income and lower middle-incomecountrieswhosepreviousacademicbackgroundsandcareerrecord suggest that they will significantly profit from anadvancedinternationaltraining.Theyarestronglymotivatedtocontribute,attheirhomeinstitutions,totheidentification,implementation, monitoring and evaluation of developmentpolicies and programmes. Our ideal classroom, however, iscomposedofamixofstudentsfromtheSouthandfromtheNorth. Students from developed countries who are alreadyworkinginorwishtopursueacareerindevelopment,andwhohavesomefieldexperience,arealsoinvitedtoapply.

The three Master’s programmes are offered concurrentlyand take 12 months to complete, starting and ending mid-September. In a first three-month module, students areupdated on development-related theories and researchmethods.ThecoreoftheprogrammerunsfromJanuarytoMay,whenstudentspursuetheirowntrackthroughtworesearch-basedmodules,onthebasisofwhichtheysubsequentlywriteapolicyresearchreport(fromJunetoSeptember).

The Institute also has a tradition of organising stand-aloneshort training courses. These courses are closely connectedwiththeMaster’smodulesontheManagementofAidandonthe Political Economy of the Great Lakes Region, as are thePhDcoursesofferedattheInstitute.

Main entrance of the city campus (“Stadscampus”) Students from all over the world

In the library, connected to the world

WHY STUDY ATTHE INSTITUTE OF DEVELOPMENT POLICYAND MANAGEMENT AT...

�

IOBalsoparticipatesinvariousinter-universitypartnershipswithcollegesandinstitutesindevelopingcountries,suchastheUniversidadCentro-Americana(Managua,Nicaragua),theFacultésCatholiquesdekinshasa(DRCongo),theUniversitiesofBukavu(DRCongo)andNgozi(Burundi),andtheUniversityofWesternCape(SouthAfrica).

TheInstituteislocatedontheUniversity’sCityCampus,closetothecentralrailwaystation,andiseasilyaccessiblebypublictransport. The campus offers a broad range of facilities,includingastudentrestaurantservinghotmealsforapprox-imately 3 Euro, a sports centre and computer rooms withInternet access. The library, which houses approximately20,000 volumes covering all aspects of economic and politicaldevelopment, is also located on the City Campus. The libraryprovidesaccesstonumerousdatabasesandlibrarynetworks.

* For more information about the thematic groups, see http://www.ua.ac.be/iob

IOBstaffconstitutethebackboneofalltrainingprogrammes,thoughexpertsfromNGOs,governmentagencies,andoutsideresearchinstitutesarealsocalledupon.

Research at IOB, be it theoretical or policy-oriented, isorganised in 4 thematic groups*: Aid Policy (AP), PoliticalEconomyoftheGreatLakesRegionofCentralAfrica(PEGL),PovertyandWell-BeingasaLocalInstitutionalProcess(PIP)andImpactofGlobalisation(IG).InadditiontoservingasanorganisationalbasisforresearchactivitiesattheInstitute,thethematicgroups(TGs)alsoguaranteealinkbetweenresearchandteaching.Weendeavourtomakeourprogrammesrelevantfordevelop-mentpractitioners,andregardthisasoneofthedistinguishingfeaturesofourteachingprogrammes.Inordertoachievethisaim, our staff, in addition to their academic and researchduties, frequently engage in policy advisory work. In thepast, research has been carried out for, among others, theBelgian Directorate General for Development Co-operation(DGDC),BelgianTechnicalCo-operation(BTC),theEuropeanCommission, the World Bank, the Food and AgricultureOrganisationoftheUnitedNations(FAO),aswellascountlessnon-governmentalorganisations.Theinsightsthatsuchstaffexposure provides is a major source of inspiration for theteachingprogrammes.

Main entrance of the city campus (“Stadscampus”) Students from all over the world

In the library, connected to the world

...THE UNIVERSITYOF ANTWERP?

Art on CampusFor several years now IOB has been involved in a unique project “Art on Campus”. Dr. Jan Van Alphen, curator of Antwerp’s Ethnographic Museum, emphasises the importance of co-operation between the museum and IOB in “opening up” culture in Antwerp. From its collection of 33.000 pieces the museum has loaned four beautiful art objects for display in the IOB building.From the left to the right:• Detail of a figurative group of the latmul people of Papua New Guinea, a stylistic fusion of a traditional debating chair with “tourist art”.• A D’mba dance mask from the Baga in the Republic of Guinea representing fertility.• Detail of a gilded Seated Buddha from Thailand, sitting in the lotus position, a flame on his head.• a Shoto basket of the Yanomani in Northern Brazil, covered by creative designs representing the snake.

�

THE PROGRAMMES

PROGRAMME STRUCTUREThe three Master’s programmes have a similar structure,eachconsistingoffourmodules.Thefirstintroducestheoriesof development and familiarises the students with researchmethods and techniques, both general and programme-specific. From Module II onwards students of the threeMaster’sprogrammesmaychooseamongtwospecificstudytracks. In modules II and III research-driven interactivetrainingpackagesareoffered.ModulesIIandIIIareorganisedbythestaffofaspecificIOBthematicgroup,i.e.AidPolicies(AP),PoliticalEconomyoftheGreatLakesRegionofCentralAfrica(PEGL),PovertyandWell-BeingasaLocalInstitutionalProcess(PIP)andImpactofGlobalisation(IG).InmoduleIV,studentsundertakeapersonaldevelopmentresearchprojectunderthesupervisionofapromoter.TopicschosenrelatetothethematicfocusofmodulesIIandIII.AlimitednumberofstudentswillbeprovidedanIOBtravelgranttodofieldworkfortheirresearchproject.Thedissertationisthesubjectofapublicpresentationanddefence.

Module Description Period Weeks ECTS credits

I

General courses: - Theories of Development - Research methods I (compulsory)- Research methods II (options)

Oct-Jan 12 936

II Research-driven education provided by Thematic Groups

Feb-Mar 9 12III Apr-May 9 12IV Dissertation Jun-Sep 15 18

Overview of programme content

“Le Phénomène de La SAPE”, 2003, Cheri Cherin, D.R. Congo, Oil on canvas, Art collection IOB

�

GENERAL ADMISSION REQUIREMENTSThefollowingcandidatesareeligibletoapplyfortheMaster’sprogrammes:

Applicantsmustholdauniversitydegreeofatleast4yearsof study in social sciences (Economics, Political Science,sociology, international relations, or related disciplines).Applicants who hold a Bachelor’s degree of only 3 years ofstudymustdemonstrateverystrongandrelevantprofessionalexperience and/or have successfully completed additionaltraining.Onlyapplicantswithexcellentacademicrecordswillbeaccepted.

Our programmes are intended for participants from low-income and lower middle-income countries. Our idealapplicanthasatleast2yearsofprofessionalexperienceinasector relevant to the programme. Applicants from middleand high-income countries who old a Master’s degree andhavesomefieldexperiencearealsoinvitedtoapply.

ApplicantsmustbeproficientinEnglish.Thosewhoreceiveda university education in English must provide an officialcertificateconfirmingthis.Otherapplicantsmustsubmitoneofthefollowingtestresults:

• TOEFL (Test of English as a Foreign Language): minimumscoreof550forpaper-basedtest,or213forcomputer-basedtest,or79forInternet-basedtest.Informationaboutthistestisavailableatwww.toefl.org.• IELTS (International English Language Testing System):minimumscoreof6.0.Informationaboutthistestisavailableatwww.ielts.org.

Studentswithpaper-basedTOEFLscoresbetween500and550(orTOEFLcomputer-basedbetween173and213orTOEFLInternet-basedbetween61and79)orIELTSscoresbetween5.0and6.0mayalsobeadmittedprovidedtheysuccessfullycompleteatwo-month intensive languagecourseorganisedby the university of Antwerp before the start of the Masterprogramme.ForstudentsselectedforaVLIRscholarship,thecost of this language course is borne by the Institute (seebelowfordetails).

�

�

MASTER OF GLOBALISATION AND DEVELOPMENT

PROGRAMME CONTENTThe Master’s in Globalisation and Development (GD)approaches the phenomenon of globalisation from aneclecticperspective,consideringboththeopportunitiesit creates and threats it poses to development andpovertyalleviationinlowandmiddle-incomecountries,bothatthenationalandthelocallevel.

Mostofourstudentsareengagedindevelopmentwork,professionallyand/orasresearchers.TheobjectiveoftheMaster’sistoprovidethemwithasolidunderstandingoftheglobalisationphenomenonasawholeaswellasitsmainfunctionaldimensions(goodsandservices,capital,labour,culture,..).Itconsidershowglobalisationimpactsonlocaldevelopmentandpovertyalleviationinlowandmiddle-incomecountries,givenitsmultifacetednature.Successful students shall be able to recognise theopportunitiespresentedbyglobalisation,andtoassessand remedy the risks and threats entailed. Moreover,they shall be able to identify and evaluate policy andprogramme interventions to exploit opportunities formore effective development, as well as identify andevaluatedevelopmentinterventionsaimedatremedyingthe adverse effects of globalisation on development ingeneralandonthepoorerandweakergroupsinsocietyin particular, thereby strengthening the agency of thelatter.

TheGlobalisationprogrammeofferstwospecifictrackswith specific objectives and courses, and intended fordifferentaudiences.

© VLIR-UOS, photo by Philippe Reynaers

10


TRACk 1: GLOBAL OPPORTUNITIES fORLOCAL DEvELOPMENT

The ‘Global Opportunities for Local Development’ trackfocuses on the analysis of the interaction between externalandlocalactors,globalisation,anddevelopmentprocessesinordertoidentifythechangingopportunitiesforandconstraintstomoreeffective,reform-driveninstitutionaldevelopment.Itconceptualises political and economic development as theoutcomeofinteractionsbetweenaconditioninginstitutionalenvironment and the agency of international, national andlocal actors. This track covers the entire policy range, fromglobal action to micro-interventions. It analyses strengthsand weaknesses of the prevailing globalisation paradigmand its actual consequences for local development. Specialattentionispaidtotheimportanceofmicro-levelinstitutionsand processes, and how these condition the effectiveness,atthelocallevel,ofdevelopmenteffortsaimedatexploitingtheopportunitiesraisedbyglobalisationand/oratremedyingtheir adverse effects on the poorer and weaker groups insociety. It analyses how the interactions of actor strategiesand institutional structures produce inequality and povertyaswellaswell-being.

This track is intended for participants with work experiencein civil society in the South (e.g. at research institutesor universities, or with local NGOs or entrepreneurialassociations),ininternationalforums(e.g.withinternationalNGOs,bilateralandmultilateralinstitutions)andgovernmentinstitutions.Thecandidateshouldbeinvolvedindevelopmentinterventions or poverty-reduction initiatives, in micro ormeso-level projects and programmes, and/or should havean interest in macro-level policymaking. Professionally, thecandidateshouldholdmiddle-managementpositionsinvolvingpolicy responsibilities and/or managerial responsibilities attheinterfacebetweendifferentpolicylevels(internationaltolocal, national to international) or between different arenas(e.g. civil society-government, government-internationalforumsandinstitutions,INGO-nationalNGO,etc).

11

“Linkingglobalisationandpovertyisquiteinteresting,asitenables

youtoalsolookatthesocialaspectsofglobalisation,rather

thanjustatthemacro-economiceffects.Itisveryenrichingto

studytheopportunitiesandchallengesposedbyglobalisationin

termsofpovertyandinequalityatthemicrolevelandtolookat

itsimpactondifferentcommunitiesanddifferentcultures.”

Ngong Bonjeh Irene from Cameroon(2007-2008 academic year)

*for more detailed information about the courses, see http://www.ua.ac.be/iob

COURSES*

MODULE I(12 weeks – 18 credits)• TheoriesofDevelopment:providesanoverviewofrecent evolutionsintheliteratureonthepoliticsandeconomics ofdevelopment,andonpovertyandinequality.• ResearchMethodsIandII:updateofcontemporary quantitativeandqualitativeresearchmethods, possibilitiesforcombiningthesemethodsandapplying themwithinongoingdevelopmentprocesses.

MODULE II: Globalisation and Development(9 weeks – 12 credits)This module is organised by the Thematic Group on “TheImpactofGlobalisation”.Differentdimensionsofglobalisationare covered in a multidisciplinary fashion. Case studies areused to demonstrate how developing countries can obtainsignificant benefits from globalisation in general, whilereducingorremedyingitsrisksandconstraintsthroughmoreeffectivedevelopmentpoliciesandprogrammes.Thetopicisdiscussedatalllevelsofanalysis,fromtheglobaltothelocallevel, drawing on insights from, among other methods, the“globalchain”approach.

MODULE III: Local Institutions and Poverty Reduction(9 weeks – 12 credits)ThismoduleisorganisedbytheThematicGroupon“Povertyand Well-being as a Local Institutional Process”. Themodule analyses how the interactions of actor strategiesandinstitutionalstructuresgenerate inequalityandpovertyas well as well-being. It applies this analysis to specifictopics,suchasaccesstoproductor(micro)financialmarkets,gender,publicservicesprovisioning,managementofnaturalresources,localgovernanceanddecentralisation.

MODULE Iv: Dissertation(15 weeks – 18 credits)TobedevelopedonthebasisofoneoftheassignmentswrittenattheendofeithermoduleIIorIII.

© VLIR-UOS, photo: Philippe Reynaers

12


TRACk 2: EvALUATING DEvELOPMENT EffECTIvENESS

The track ‘Evaluating Development Effectiveness’ focuseson the analysis of the interaction between globalisationevents, government policies and development processesandoutcomes.Thepurposeoftheprogrammeistohelpthestudent use appropriate analytical frameworks and applyrelevantscientificmethodsinevaluatingresultsanddrawingpolicy conclusions. It provides development professionalswith multidisciplinary theoretical and practical tools thatimprove their capacity to contribute to the formulation,implementation, monitoring and evaluation of developmentpoliciesandprogrammeslinkedtoglobalisationevents(suchastradepolicyandregionalintegration,financialglobalisation,globalproductionchains…).Itintroducesstudentstodifferentkinds of evaluation, relying on quantitative and qualitativetechniques.

This study track is intended for participants who have workexperience in government institutions (including publicresearchinstitutions),donoragencies(includinginternationalNGOs, bilateral and multilateral donors), civil society(includingresearchinstitutes,universities).Candidatesshouldbe working in the field of development interventions andpoverty reduction initiatives, and should have an interest inglobal/macrolevelpolicymaking.Professionally,thecandidateshould hold middle-management positions involvingpolicy responsibilities and/or managerial responsibilitiesat the interface between different policy levels (national tointernational, national to local) or between different arenas(government-international forums, INGO-international,government-local(NGO),etc.).

© VLIR-UOS, photo: Philippe Reynaers

13

“Theprogrammeoffersapracticalapproachtochallengesthatdeveloping

countriesarefacinginaglobalisationcontext.Theknowledgegainedfrom

theprogrammeisavaluableinputinpolicyadvocacyandpolicymaking,

particularlyintermsofimprovementindistributionofwelfaretowardsthe

poorasthemostvulnerablegroup.Ihadanopportunitytoexperiencenot

onlyanexcellentstudyingenvironment,encouragingcriticalthoughtand

knowledgesharing,butalsoinspirationforthedevelopmentofsociety.”

Vu Hoang Nam from Vietnam(2007-2008 academic year)


COURSES*

MODULE I(12 weeks – 18 credits)• TheoriesofDevelopment:providesanoverviewofrecent evolutionsintheliteratureonthepoliticsandeconomics ofdevelopment,andonpovertyandinequality• ResearchMethodsIandII:updateofcontemporary quantitativeandqualitativeresearchmethods, possibilitiesforcombiningthesemethodsandapplying themwithinongoingdevelopmentprocesses.

MODULE II: Globalisation and Development(9 weeks – 12 credits)This module is organised by the Thematic Group on “TheImpactofGlobalisation”.Differentdimensionsofglobalisationare covered in a multidisciplinary fashion. Case studies areused to demonstrate how developing countries can obtainsignificant benefits from globalisation in general, whilereducingorremedyingitsrisksandconstraintsthroughmoreeffectivedevelopmentpoliciesandprogrammes.Thetopicisdiscussedatalllevelsofanalysis,fromtheglobaltothelocallevel, drawing on insights from, among other methods, the“globalchain”approach.

MODULE III: Evaluating Development Effectiveness(9 weeks – 12 credits)This module is organised jointly by the Thematic Groups on“AidPolicies”and“TheImpactofGlobalisation”.Itintroducesstudentstodifferentkindsofevaluation,relyingonadvancedquantitative and qualitative techniques or a combination ofthetwo.


1�

1�

MASTER OFGOVERNANCE ANDDEVELOPMENT

PROGRAMME CONTENTThe future of inclusive and sustainable developmentdepends critically on better governance at the local,national and regional levels, as well as on betterinternational governance. Conflict is one part of thegovernancepuzzleinmanycountries.Developmentandviolent conflict are incompatible, and conflict feeds onfailed processes of state formation and development.The study programme considers governance problemsandpotentialsolutionsinthespecifichistoricalpathwaysofcountriesandfromthelocaltothegloballevel.

Most of our students are engaged in development,professionally and/or as researchers. The objective ofthe Master’s is to provide them with multidisciplinarytheoretical and practical tools that will improve theircapacity to analyse governance issues at differentlevels, and how they connect to processes of conflictand development. Graduates shall understand andbe able to analyse, from the local to the global level,the governance problems which confront developingcountries today. Insights, tools and best practices fordealingwiththesechallengesareexploredinorderthatgraduatescouldapplythemintheirfutureprofessionalcontexts.

The Governance programme offers two tracks withspecificobjectivesandcoursesandintendedfordifferentaudiences.


1�

The‘PoliticalEconomyoftheGreatLakesRegion’trackfocuseson the distribution of power, income and wealth in each ofthe countries of the region and in the region as a whole, astransborderspilloversofthestruggleforinfluenceandwealthclearly determine national developments. This is especiallythe case in the Great Lakes region, where competition forstate power in one country, combined with the collapseof the state in others, led to the first international Africanwar.Theconflictsignifiedatremendoussetback intermsofhuman development, with far-reaching consequences forthefuture.Hence,thestudytrackpresentedtothestudentscoverstheoriesaboutfailedstates,ananalysisofthecausesofconflictsandtheirconsequences intermsofpost-conflictreconstructionpoliciesthataimtosetcountriesandpeoplesonasustainableandpro-poorgrowthpath.

The study track is intended for participants who areprofessionally active in or interested in research of theregion. They will acquire insights and methods that aremultidisciplinary and prepare them for tasks in the domainofhumanitarianinterventionorpoliticalandsocio-economicgovernance.Participantsshouldhaveworkexperienceinthepublic action domain, either within government institutions(including public research institutions), donor agencies(including international NGOs, bilateral and multilateraldonors) or civil society (including research institutes,universities).

MASTER OF GOVERNANCE AND DEVELOPMENT

TRACk 1: POLITICAL ECONOMyOf ThE GREAT LAkES REGION

1�

CourSES*

MODULE I(12 weeks – 18 credits)• TheoriesofDevelopment:providesanoverviewofrecentevolutionsintheliteratureonthepoliticsandeconomicsofdevelopment,andonpovertyandinequality• ResearchMethodsIandII:updateofcontemporaryquantitativeandqualitativeresearchmethods,possibilitiesforcombiningthesemethodsandapplyingthemwithinongoingdevelopmentprocesses.MODULE II: from Conflict to Inclusive Development(9 weeks – 12 credits)This module deals with the particular nature of the state indevelopingcountriesandhowitimpactson(under)developmentandconflict.Conflictcyclesanddynamicsaswellaspoliciesof reconstruction and development after periods of violentconflict are the main topics of this module. The module isorganisedbytheThematicGroupon“ThePoliticalEconomyoftheGreatLakes”.

MODULE III: Political Economy of the Great Lakes Region(9 weeks – 12 credits)This module is organised by the Thematic Group on “ThePoliticalEconomyoftheGreatLakes”.Buildingonthepreviousmodule, it analyses the contemporary political economyof the Great Lakes Region as a product of local, national,regionalandinternationalfactors.Thehistoricalperspectiveof state formation and decay, and the historical pathway ofeachindividualcountry,aremajortopicsinthismodule.

MoDuLE IV: Dissertation(15 weeks – 18 credits)TobedevelopedonthebasisofoneoftheassignmentswrittenattheendofeithermoduleIIorIII.


“StudyingatIOBfirstofallgivesstudentstheimpetustoaccept

eachotherdespitetheirculturaldiversity.Wecameasindividuals,

butweareleavingasaglobalfamily.The‘PoliticalEconomyofthe

GreatLakesRegion’trackprovidesstudentswiththetheoriesand

toolstoconceptualise,articulateandthinkindependently.Ibelieve

theprogrammehasmademeandmycolleaguesmoreconfidentand

proactiveinapproachingcriticaldevelopmentchallenges.Ithasopened

upourmindsonworldviewsandhowwecanrelatesuchviewsandtheir

ultimateconsequencesatgrassrootslevel,asamechanismofaddressing

thepertinentconcernsoflocalpeopleintheGreatLakesRegion.”

Paul Okello Collins from Uganda(2008-2009 academic year)

1�

The‘LocalInstitutionsandPovertyReduction’trackfocuseson the interaction between (trans)national and local actorsin governance processes. Decentralisation has become animportant part of the agenda for governance reform anddemocratisation in many countries. Likewise, public serviceprovisionandpropertyrightsissuescanhardlybediscussedwithout taking into account local-level institutions andpolitical dynamics. The partial autonomy of local levels ofdecision-makingispartandparcelofcountriescharacterisedby weak or fragile national-level state structures and itrequires careful attention at the moment of conceptualisingdevelopmentinitiatives.

Thetrackisintendedforparticipantswhoareprofessionallyactive or interested in research on the interface betweenthe (trans)national and the local level and/or betweenstate and non-state development actors. They shouldhave work experience in the public action domain, eitherwithin government institutions (including public researchinstitutions), donor agencies (including international NGOs,bilateral and multilateral donors) or civil society (includingresearchinstitutes,universities).

MASTER OF GOVERNANCE AND DEVELOPMENT

TRACk 2: LOCAL INSTITUTIONS AND POvERTy REDUCTION

“The Nile” meeting room

1�

CourSES*

MODULE I(12 weeks – 18 credits)• TheoriesofDevelopment:providesanoverviewofrecent evolutionsintheliteratureonthepoliticsandeconomics ofdevelopment,andonpovertyandinequality• ResearchMethodsIandII:updateofcontemporary quantitativeandqualitativeresearchmethods, possibilitiesforcombiningthesemethodsandapplying themwithinongoingdevelopmentprocesses.MODULE II: from Conflict to Inclusive Development(9 weeks – 12 credits)This module deals with the particular nature of the state indevelopingcountriesandhowitimpactson(under)developmentandconflict.Conflictcyclesanddynamicsaswellaspoliciesof reconstruction and development after periods of violentconflict are the main topics of this module. The module isorganisedbytheThematicGroupon“ThePoliticalEconomyoftheGreatLakes”.

MODULE III: Local Institutions and Poverty Reduction(9 weeks – 12 credits)ThismoduleisorganisedbytheThematicGroupon“PovertyandWell-beingasaLocalInstitutionalProcess”.Themoduleanalyses how the interactions of actor strategies andinstitutionalstructuresgenerateinequalityandpovertyaswellaswell-being.Itappliesthisanalysistospecifictopics,suchas public services provision, natural resource management,gender issues, local administration, microfinance and valuechainanalysis.



“Themodule‘FromConflicttoInclusiveDevelopment’enabledmeto

understandtheweaknessesofthestateinsub-SaharanAfrica(SSA)

andhowthattendstocontributetoconflicts.Igainedknowledge

abouthowtoanalyseconflictsandwhatpoliciestoadoptforthe

reconstructionanddevelopmentafterperiodsofviolentconflict.The

nextmodule,‘LocalInstitutionsandPovertyReduction’,helpedme

shakeoffissueswhichIpreviouslytookforgranted.Themodule’scentral

themeisthatpeopleareprimemoversofdevelopmentandthusneed

tobeinvolvedindecidingonissuesthataffecttheirwell-being.”

Rudo Mumba Maambo Phiri from Zambia(2007-2008 academic year)

20

21

MASTER OFDEVELOPMENTEVALUATION ANDMANAGEMENT

PROGRAMME CONTENTThe Master of Development Evaluation and Manage-ment focuses on the efforts made by a wide range ofpublic and private actors to promote development inlow-incomecountries.Itprovidesasolidunderstandingof the aid policies of multilateral and bilateral donors,and of the major aid modalities and instruments. Theinstitutional characteristics of the actors involved – bethey governments, community-based organisations,international NGOs, bilateral or multilateral donors –are analysed so as to attain a better understanding ofprocesses and outcomes. The Master’s offers insightsinto the nature of development evaluation, and itsrelevance and challenges, at a methodological andinstitutionallevel.

Most of our students are engaged in development,professionallyand/orasresearchers.TheMaster’swillimprove their capacity to assess the strengths andweaknesses of the prevailing aid paradigms and thechanging approaches to aid. Students will learn toappreciate the importance of different institutionalarenas,andhowtheyworkandinteract.Theywillhavebeenfamiliarisedwithmultidisciplinaryanalyticaltoolsthat improve their capacity to analyse the interactionsandcontributetoanenhancedconceptualisation,imple-mentation, monitoring and evaluation of developmentpoliciesandprogrammes.

The DEM programme offers two specific tracks withspecificobjectivesandcoursepackagesandintendedfordifferentaudiences.


22

The‘EvaluatingDevelopmentEffectiveness’trackfocusesonthe analysis of the interaction between external actors, aidanddevelopmentprocesses.Thebasicquestionaddressediswhydevelopmenteffortsaresometimessuccessfulbutmoreoftenfail.Thisleadstofurther,moreoperational,questions.What lessons have been learned from the study of pastfailures and successes, and how convincing are the presentpolicy prescriptions and paradigms? The programme helpsthestudenttouseappropriateanalyticalframeworksandtoapply relevant scientific methods in evaluating results anddrawingpolicyconclusions.Itintroducesstudentstodifferentkinds of evaluation, relying on quantitative and qualitativetechniques.

This track is intended for participants who have workexperience in government institutions (including publicresearchinstitutions),donoragencies(includinginternationalNGOs, bilateral and multilateral donors), civil society(including research institutes, universities). Candidateswork in the area of development interventions and povertyreduction initiatives, and are macro level policy oriented.Professionally,theybelongtomiddlemanagementwithpolicyresponsibilities and/or in charge of managing the interfacebetween different policy levels (national to international,national to local) or between different arenas (government-donors,INGO-nationalNGO,etc.).

MASTER OFDEVELOPMENTEVALUATION ANDMANAGEMENTTRACk 1: EvALUATING DEvELOPMENTEffECTIvENESS

23

CourSES*

MODULE I(12 weeks – 18 credits)• TheoriesofDevelopment:providesanoverviewofrecent evolutionsintheliteratureonthepoliticsandeconomics ofdevelopment,andonpovertyandinequality• ResearchMethodsIandII:updateofcontemporary quantitativeandqualitativeresearchmethods, possibilitiesforcombiningthesemethodsandapplying themwithinongoingdevelopmentprocesses.

MODULE II: Managing Aid(9 weeks – 12 credits)This module is organised by the Thematic Group on “AidPolicies”. Students are familiarised with the ongoing debateontheroleofaidindevelopment,andareexpectedtoengageinamoreadvancedanalysisofthetopic.

MODULE III: Evaluating Development Effectiveness(9 weeks – 12 credits)This module is organised jointly by the Thematic Groups on“AidPolicies”and“TheImpactofGlobalisation”.Itintroducesstudentstodifferentkindsofevaluation,relyingonadvancedquantitative and qualitative techniques or a combination ofthetwo.



“The‘EvaluatingDevelopmentEffectiveness’trackcombinestheories

ofdevelopmentandresearchmethodsingeneralandevaluation

techniquesinparticular.Itoffersinsightsintotheroleofevaluation

indevelopmentprogrammesanditsapplicationtodeveloping

countries.Themultidisciplinary,practicalandinteractivefeaturesof

theprogrammemakeitappropriatetoyoungprofessionalsoperating

inthefieldofdevelopment,beitintheprivateorthepublicsector”

Eddy Carlos Kankeu Fonkouo from Cameroon(2007-2008 academic year)

2�

The‘ConceptualisingDevelopmentInterventions’trackaimsatanalysingtheinteractionbetweenexternalandlocalactors,aidanddevelopmentprocessesinordertoidentifythechangingopportunities and constraints for more effective, reform-driven institutional development. It conceptualises politicaland economic development as the outcome of interactionsbetween a conditioning institutional environment and theagency of international, national and local actors. Specialattentionispaidtotheimportanceofmicro-levelinstitutionsand processes, and how these condition the effectivenessof development efforts. The programme analyses how theinteractions of actor strategies and institutional structuresproduceinequalityandpovertyaswellaswell-being.

This track is intended for participants with work experiencein civil society in the South (e.g. at research institutesor universities, or with local NGOs or entrepreneurialassociations), donor agencies (including internationalNGOs, bilateral and multilateral donors) and governmentinstitutions.Thecandidateshouldbeinvolvedindevelopmentinterventions or poverty-reduction initiatives, in micro ormeso-level projects and programmes, and/or should havean interest in macro-level policymaking. Professionally, thecandidateshouldholdmiddle-managementpositionsinvolvingpolicy responsibilities and/or managerial responsibilities attheinterfacebetweendifferentpolicylevels(localtonational,nationaltointernational)orbetweendifferentarenas(e.g.civilsociety- government, government-donors, INGO-nationalNGO,etc).

MASTER OFDEVELOPMENTEVALUATION ANDMANAGEMENTTRACk 2: CONCEPTUALISINGDEvELOPMENT INTERvENTIONS


2�

CourSES*

MODULE I(12 weeks – 18 credits)• TheoriesofDevelopment:providesanoverviewofrecentevolutionsintheliteratureonthepoliticsandeconomicsofdevelopment,andonpovertyandinequality• ResearchMethodsIandII:updateofcontemporaryquantitativeandqualitativeresearchmethods,possibilitiesforcombiningthesemethodsandapplyingthemwithinongoingdevelopmentprocesses.

MODULE II: Managing Aid(9 weeks – 12 credits)This module is organised by the Thematic Group on “AidPolicies”. Students are familiarised with the ongoing debateontheroleofaidindevelopment,andexpectedtoengageinamoreadvancedanalysisofthetopic.

“Ifoundthe‘ConceptualisingDevelopmentInterventions’track

veryinteresting,asitcombinesthemacroandmicroaspectsof

developmentandpovertyreduction.WhiletheAidManagement

moduleprovidestheinstrumentstoassessthecomplexityofaid

indevelopment,itspoliticsandactors,theLocalInstitutionsand

PovertyReductionmoduleoffersabetterunderstandingofthemultiple

causesofpovertyandtheimportanceoftakingintoaccountthe

socialandculturalcontextinanyinitiativethataimstoreduceit”.

Gemma Piñol Puig from Spain(2007-2008 academic year)

MODULE III: Local Institutions and Poverty Reduction(9 weeks – 12 credits)ThismoduleisorganisedbytheThematicGroupon“PovertyandWell-beingasaLocalInstitutionalProcess”.Themoduleanalyses how the interactions of actor strategies andinstitutional structures generate inequality and poverty aswell as well-being. It applies this analysis to specific topics,such as public services provisioning, local governance anddecentralisation.


2�“Le Savoir” - Knowledge, 2002, statue by Jean-Michel Foulon, in front of the University’s main administrative building at Middelheim campus

ACADEMICSTAFF

ManagEMEnT CoMMITTEEChairman:Robrecht RENARDVice-chairman:Tom DE HERDTAcademicSecretary:Danny CASSIMON

EDuCaTIon CoMMITTEEChair:TomDEHERDTInnovationandQualityAssurance:GermanCALFATandMarleenBAETENSPromotionandstudentselection:NathalieHOLVOETProgrammecoordinator:NeleDUTRY

ConVEnorS of ThEMaTIC grouPSImpactofGlobalisation(IG):DannyCASSIMONPoliticalEconomyoftheAfricanGreatLakesRegion(PEGL):FilipREYNTJENSAidPolicy(AP):NadiaMOLENAERSPovertyandWell-BeingasaLocalInstitutionalProcess(PIP):JohanBASTIAENSEN

LIbraryLibrarian:Mattias MAINIL(until December 2008)

SECrETarIaTSStudents:Greet ANNAERT, Nicole DIERCKXManagementCommitteeandCommunication:Hugo DE CRAENThematicGroups:Joëlle DHONDT, Patricia FRANCKAssetsandFinance:An VERMEESCHSocialServices:Greet ANNAERT

MANAGEMENT

The list below gives an overview of IOB academic staff with teaching responsibilities and/or research duties during the academic year 2008-2009. Apart from the persons listed below, a considerable number of outside lecturers and guest-speakers also contribute to the M.A. programmes.

ANSOMS, AnM.Sc. in Applied Economics, Masterof Governance and Development(University of Antwerp), Research Assistant

BASTIAENSEN, JohanM.Sc.inAppliedEconomics,BachelorinPhilosophy,Ph.D.inAppliedEconomics(UniversityofAntwerp),Senior Lecturer

BENEDICTIS, GeovannaM.Sc. in Economics (UniversidadPolitécnica del Litoral, Ecuador),Masterof GlobalisationandEconomicDevelopment (University of Antwerp),Research Assistant

CALFAT, GermánM.Sc. in Economics (UniversidadNacional de Buenos Aires, Argentina),Master of Economics (University ofLeuven),Ph.D.inEconomics(UniversityofAntwerp),Lecturer

CASSIMON, DannyM.Sc.inAppliedEconomics(UniversityofAntwerp),MBA(UniversityofLeuven),Ph.D. in Applied Economics (UniversityofAntwerp),Senior Lecturer

2�

ACADEMICSTAFF

DE HERDT, TomM.Sc. in Applied Economics, Ph.D.in Applied Economics (University ofAntwerp),Lecturer

DEWACHTER, SaraMaster of Political Science (UniversityofLeuven),Research Assistant

D’EXELLE, BenM.Sc. in Commercial Engineering(University of Antwerp), Ph.D. inEconomics (University of Maastricht),Post-docotoral Research Assistant

FLORES, RenatoM.Sc.inSystemsEngineering(InstitutodeMatemáticaPuraeAplicada),Masterof Business Administration (PontifíciaUniversidadedoRiodeJaneiro),Ph.D.inEconomics(UniversidadeFederaldoRiodeJaneiro),Professor

GEENEN, SaraM.Sc. in History (University of Ghent),Master of Conflict and Development(UniversityofGhent),Research Assistant

GILDEMYN, MarieM.Sc. Psychology (McGill University,Canada), Master of InternationalDevelopment: Social Policy and SocialDevelopment (IDPM, University ofManchester,Uk),Research Assistant

HOLVOET, NathalieM.Sc. in Applied Economics, Master ofDevelopment Co-operation (Universityof Ghent), Ph.D. in Applied Economics(UniversityofAntwerp),Lecturer

INGELAERE, BertMaster of Philosophy, Master of Socialand Cultural Anthropology (UniversityofLeuven),Research Assistant

MARIVOET, WimM.Sc. in Commercial Engineering,Master of Globalisation and EconomicDevelopment (University of Antwerp),Research Assistant

MARYSSE, StefaanM.Sc. in Commerce and Finance(University of Antwerp), Ph.D. inEconomics(UniversityofParis,France),Professor

MOLENAERS, NadiaM.Sc. in Political Science, Ph.D. inPoliticalScience(UniversityofBrussels–VUB),Lecturer

RENARD, RobrechtBachelorofLaws(UniversityofAntwerp),M.Sc. in Economics (University ofLeuven),Ph.D.inEconomics(UniversityofBrussels-VUB),Professor

REYNTJENS, FilipMasterofLaws(UniversityofAntwerp),LL.M. (University of London), Ph.D. inLaw(UniversityofAntwerp),Professor

SMETS, LodewijkM.Sc.inCommercialEngineering,M.Sc.in Economics (University of Leuven),Research Assistant

STEEL, GrietM.Sc. in Cultural Anthropology andSociology of Non-Western Societies(University of Leiden, Netherlands),Ph.D.inCulturalAnthropology(CEDLA,UniversityofAmsterdam,Netherlands),Post-doctoral Research Assistant

VAESSEN, JosM.Sc. in Agrarian DevelopmentEconomics (University of Wageningen),Research Assistant

VAN CAMPENHOUT, BjörnM.Sc.inEconomics(UniversityLeuven),Research Assistant

VANDEGINSTE, StefMasterofLaws(UniversityofLeuven),Diploma in Development Policy(University of Antwerp), Research Assistant

VERBEKE, KarelM.Sc.inEconomics,MasterofAdvancedStudies in Economics (University ofLeuven),Research Assistant

WAGEMAKERS IngeM.Sc. in Political and Social Sciences(University of Antwerp), Master ofConflict and Development (UniversityofGhent),Research Assistant

PRACTICAL INFORMATION

GraduationDay

2�

ApplicAtion procedure And deAdlines The application form (downloadable from www.ua.ac.be/iob), together with all the required documents, should be sent directly to the ad-mission office of IOB, University of Antwerp, at:

Admission officeIOB-University of AntwerpPrinsstraat 13B-2000 AntwerpBelgium

Applications that are incomplete or illegible, or that reach the Admissions Office after the dead-line, shall be automatically rejected. Electronic applications are not accepted. Applications sent to VLIR-UOS shall not be considered.

Applicants applying for both admission and scholarship must meet both the academic admission requirements and the scholarship criteria.

Documents to be enclosed:- A copy of the applicant’s secondary school diploma.- A certified* copy of the applicant’s university degree.- A certified* copy of the applicant’s transcript of academic records for each academic year.* Note: ‘Certified’ means that the copy must be authenticated by the Belgian diplomatic office in the applicant’s country of origin or by the educational institution that issued the degree or by the Ministry of Education.- A document explaining the grading system of the applicant’s home country or university.- A document proving the applicant’s knowledge of English (see above-mentioned language requirements).- Two letters of recommendation, preferably from (former) academic supervisors or from the applicant’s superiors in their place of work. Referee forms are available on the website. It is not compulsory to use these standard referee forms. Other reference letters should be typed on official stationary with the heading of the referee’s institution. Recommendations should be included in a closed envelope. If applicable, an employer’s certificate, stating the applicant’s present position within the organisation along with a precise description of the applicant’s professional responsibilities, should be enclosed. The employer should declare the significance of the Master’s programme for the applicant’s future position and for the organisation as a whole. The employer should preferably demonstrate the possibility to transfer the acquired knowledge upon return of the applicant to the home countryIn case of a scholarship applicant from a university

engaged in a VLIR-IUC partnership, but not linked to an IUC funded department: a signed declaration by the Flemish IUC coordinator.- Applicants from the P.R. China have to obtain a certificate of academic screening issued by the Academic Evaluation Center (APS) of the German Embassy in Beijing before being allowed to register at any higher education institution. The certificate is also required to obtain a student visa to Belgium. More information on APS can be found at www.aps.org.cn. An APS-attestation is a mandatory document in the application package.- A complete curriculum vitae.- Two recent passport photographs.

Documents in English, French and Dutch are accepted. Documents in other languages must be translated into English or French by a sworn translator.

Deadlines- Applicants applying for the VLIR-UOS scholarship should send in their application before February 1, 2009.- Applicants who are not applying for the above scholarship and who are required also to apply for a student visa for Belgium may apply until April 1, 2009.- Applicants who are not applying for the above scholarship and who are exempted from applying for a student visa for Belgium may apply until September 1, 2009.

selection procedure

Academic selectionOn the basis of Part I of the application form, all applicants for the Master’s programmes offered by IOB shall be assessed academically by a selection commission composed of academic staff. At this stage, the financial situation of the applicant is not taken into account. The academic selection is based on five selection criteria, namely: - Appropriateness of the applicant’s field of study- Quality of the education and results/grades obtained- Relevance of the applicant’s professional experience- Motivation of the applicant- Matching (does the content of the programme match the expectations of the applicant?)

Scholarship selectionApplications which successfully pass the academic selection are subsequently assessed by a joint selection commission of IOB and VLIR-UOS in order to select suitable scholarship candidates. This selection is based on part II of the application form. For each Master’s, 10 effective scholars and 10 substitute scholars shall be selected. The scholarship selection is based on the following VLIR-UOS scholarship selection criteria (see also http://www.scholarships.vliruos.be):

1 Qualification criteria- Nationality: Only applicants originating from a country of the VLIR-UOS’ list of developing

countries eligible for university development cooperation. Download the complete list from www.scholarships.vliruos.be.- Maximum number of VLIR-UOS scholarship applications in one year: one. If more than one application is submitted, none of the applications will be considered for admission.- Maximum age: 40.- Previous scholarship: the application of a candidate who has already been granted a masters VLIR-UOS scholarship previously, is not admissible.

2 Selection criteria- Motivation: The candidate’s motivation must demonstrate the possibility to transfer knowledge or to create extension activities, and/or must have a specific developmental dimen- sion.- Professional experience: The candidate should preferably be employed in a research institute, a higher education institution, the (national, regional or local) government, the sector of social economy or an NGO. The candidate should be able to generate an impact through the transfer of knowledge, extension activities or otherwise.- Gender: The selection commission will aim for equal participation of men and women. In case of two equivalent candidates of different sexes, preference will be given to the female candidate.- Regional balance: The selection commission will aim at granting 50% of the available scholarships to candidates originating from Sub-Sahara Africa.- Social background: Preference will be given to candidates from a disadvantaged region within their country or a minority ethnic or social group, especially if these candidates can play an exemplary role or provide proof of leadership potential.

All applicants shall receive an acknowledgement of receipt of their application by email. Applicants who are accepted both academically and for the scholarship shall be contacted by email by VLIR-UOS and IOB by April 30, 2009. All other applicants shall be informed in May 2009.

registrAtion feeThe registration fee amounts to EUR 1000, but the following categories of students are eligible for a reduced fee of only EUR 80:

ThenewIOBpremisesintheLangeSintAnnastraat

2�

- students from developing countries (list of DAC-OECD) living in their country of origin at the moment of application- VLIR scholars

All other students, including students on a scholarship other than that granted by VLIR and students originating from developing countries but living outside their country of origin at the moment of application, are required to pay the full registration fee.

VisA ApplicAtionAccepted candidates who need to apply for a student visa for Belgium can obtain detailed information on the visa procedure and the required documents from the Belgian diplomatic office in their country or from www.diplomatie.be.Once a candidate has received notice of the acceptance of his/her application, he/she must start the visa application procedure without delay, as the processing of visa applications can easily take several months. Please note that IOB cannot intervene in visa procedures.

registrAtionAdmitted candidates should arrive in Belgium one week before the actual start of the programme (final week of September 2009) so that they could take care of practical matters such as enrolment, accommodation, insurance, etc. The final deadline for enrolment is 15 October 2009. Students will be refused enrolment after this date. Any delay in arrival due to late submission of the visa application will not be accepted and will result in a refusal of enrolment.

Upon arrival in Belgium and once the enrolment fee has been paid, the student will receive a student card which provides access to university facilities such as the library, computer rooms, student restaurant, etc. Payment of the enrolment fee will also enable the student to obtain a (compulsory) Belgian residence permit. Detailed information on how to obtain this Belgian ID will be provided upon the student’s arrival.

intensiVe lAnguAge courseStudents with insufficient knowledge of English are required to successfully complete an intensive language course. In addition to bringing the student’s English competency up to the required level, this course, which runs from the beginning of August to the end of September, also offers an introduction to international development literature and practice. While this course is offered free of charge by the Institute, students should note that only VLIR scholars will receive a scholarship during this period. Students should also note that, in order to ensure that they are able to participate in this programme, they should apply for their visa well in time.

exAms And eVAluAtionFirst session exams take place in the form of intermediate assessments, essays, exercises, papers and presentations in the course of each module. Second session exams and the presentations of dissertations take place in September 2009.

cost of liVing And scholArshipsAssuming that the student lives in Antwerp, the cost of living (accommodation, food, various study materials, etc) amounts to a minimum of approximately 10,000 Euros per year. The private sector offers accommodation in the vicinity of campus. A list of addresses with rooms for rent is available from the social services department. However, as accommodation is scarce, students are strongly advised to get into contact with the IOB secretary’s office prior to their arrival, so that we could assist them in their search.

Please note that a distinction is made between applications for academic enrolment on the programmes and applications for a scholarship (see the application procedure outlined above). 30 scholarships (10 per programme) are available from the VLIR. In addition, BTC (Belgian Technical Co-operation) manages scholarships awarded by the Belgian Directorate General for Development Cooperation (DGCD) (website: www.btcctb.org). Further information can be obtained from the Belgian Embassy. Several other organisations also offer scholarships: NGOs (website www.ngo.org), Rotary International, the Ford Foundation, the “Joint Japan/World Bank Graduate Scholarship Program”, the “International Education Financial Aid” (IEFA). Students from Latin America can contact the European ALBAN scholarship programme (website: www.programalban.org). Students should contact these organisations directly. An overview of study and training grants for students from developing countries is available on the website of the DGCD: www.dgos.be.

30

Pictures on this spread by courtesy of the Antwerp Tourist Board

thekingdomofBelgiumisborderedbyTheNetherlands,France,GermanyandLuxembourg,andithasasmallcoastlineontheNorthSea.Belgiumisasmallcountry

(30,528 square kilometres) with a population of around 10.5million, yet, being both multicultural and multilingual, it isoften referred to as the Essence of Europe. Founded in 1830,thecountryhasacomplexgovernmentalstructureandthreeofficial languages – Dutch, French and German – and manyBelgians speak English as well. Belgium, together with theotherBeneluxcountries,wasoneofthefoundingmembersoftheEuropeanUnionandtodayhostsitsheadquarters,aswellasthoseofNATO,majorinternationalNGOsandinternationaltradeandfinancecompanies.

Belgiumisoneoftheworld’stenlargesttradingnations,withaneconomybasedmainlyonservicesandheavy industries.Itranks9thoutof177countriesontheHumanDevelopmentIndex.

Belgium’s main tourist attractions include the romanticmedieval town of Bruges, the castles in the region aroundNamur,thefestivalofBinche,ArtNouveauhousesinBrussels,andthelivelycityofGhent.Thecountryisalsoaparadiseforculinaryconnoisseurs:itproducessomeofthebestchocolatein the world and boasts over 500 varieties of beer. Belgiumhasadensetrainnetwork,allowingyoutotravelfromoneendofthecountrytotheotherinnomorethan3hours.

BELGIUM AND...

31

...THE CITYOF ANTWERP

Antwerpisapleasantcity,fullofOldWorldcharmandmodernconvenience.Thecityboastsmanyexcellentmuseums and historical monuments, as well as a

fast-paced nightlife, fine shopping districts, and a boomingcommercial centre. Antwerp is the home of outstanding artmuseums,whichofferacomprehensivesurveyofmasterpieces,from the Old Flemish Masters to the contemporary avant-garde.Inadditiontotheseindoorgalleries,Antwerpitselfisamuseumofsculptureandarchitecture.Thecitywasthe1993CulturalCapitalofEuropeandinrecentyearshasdevelopedintoaninternationalfashioncentre.

As a working city, Antwerp ranks high, primarily because ofitsportanditspetrochemicalindustry.ThanksinparttothedevelopmentoftheEU,ithasbecomeahubofmajoreconomicactivity:thecity isexperiencingafinancialboom,attractingmultinationals and international know-how. Appropriatelyenough, this gem of a city’s second largest industry isdiamonds.Byvolume,Antwerp’sdiamondtradeisbyfarthelargestofanycityintheworld.

LikemanyotherlargeEuropeancities,however,Antwerphasits fair share of social problems. Although the cultural andsocialdiversityofitspopulationaddstothecity’srichnessoflife,itequallyprovesasourceoftension.

Studentswillappreciatethecity’scentrallocationinEurope.Brussels, capital of Belgium and of Europe, is only a thirty-minutetrainjourneyaway.FromAntwerp,onecanquicklyandeasilyreachAmsterdam(2hrs.),Luxembourg(3hrs.),Paris(2hrs.)andLondon(31/2hrs.bytrain,45min.byplane).

Institute of Development Policy and ManagementStudent secretariatUniversity of Antwerp

Postaladdress: Visitingaddress:Prinsstraat13 LangeSintAnnastraat7B-2000Antwerpen B-2000AntwerpenBelgium Belgium

tel:(+32)-(0)3-275.57.70fax(+32)-(0)3-275.57.71e-mail:[email protected]/iob

For further information on the University of Antwerp please visit the website: www.ua.ac.be

Antwerp on the internet: www.antwerpen.be

Prin

ted

in B

elgi

um, N

ovem

ber 2

008

Grap

hic d

esig

n: w

ww

.visu

al-d

esig

n.be

Date post:	13-Mar-2016
Category:	Documents
Upload:	joelle-dhondt
View:	218 times
Download:	3 times