+ All Categories
Home > Documents > Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI...

Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI...

Date post: 14-Jul-2020
Category:
Upload: others
View: 0 times
Download: 0 times
Share this document with a friend
48
Introduction of renewable energy cooperation in China and Guangzhou Huangpu pilot project CCS GIEC GEI Announcement of Low Carbon Development Cooperation in Southeast Asia Through the Belt Road Initiative (BRI) and China’s South-SouthClimate Cooperation (CSSC) Global Climate Action Summit San Francisco, CA September 12-14,2018
Transcript
Page 1: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

IntroductionofrenewableenergycooperationinChinaandGuangzhouHuangpupilotproject

CCSGIECGEI

AnnouncementofLowCarbonDevelopmentCooperationinSoutheastAsiaThroughtheBeltRoadInitiative (BRI)andChina’sSouth-SouthClimateCooperation(CSSC) GlobalClimateActionSummit

SanFrancisco,CASeptember12-14,2018

Page 2: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

OUTLINE

vBrief Introduction of GIECvCCS-GIEC-GEI CooperationvPilot Project - Huangpu Economic Development ZonevNext Steps

Page 3: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Brief Introduction of GIEC

GIEC

• KeyLaboratoryofRenewableEnergy,CAS• KeyLaboratoryofGasHydrate,CAS• GuangzhouCenterforGasHydrateResearch,CAS• InternationalR&DCenterofRenewableEnergy,MoST• NationalEnergyResearchCenterforBio-fuels,NEA• GuangdongKeyLaboratoryofNewandRenewableEnergy• Guangdong Engineering and Technical Center of Biomass Energy• Guangdong CDM Research and Service Center

vGuangzhouInstituteofEnergyConversion(GIEC),Chinese AcademyofSciences

Page 4: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

4 中国科学院广州能源研究所

Energy Strategy and low-carbon development Research Center

Planning Projects Policy Technical Projects ü National low carbon pilot city program in Guangzhouü Provincial- level Low-carbon development planning methodologyü The 12th five-year plan of low-carbon development in Guangdongü The 12th five-year plan of energy conservation and carbon reduction

potential research in Guangdongü The 12th five-year plan of energy development planning in

Guangzhouü Guangzhou Low-carbon development planning of Sino-Singapore

Knowledge Cityü The 13th five-year plan of low-carbon development in Jiangmenü The 13th five-year plan of energy development in Hainanü The 13th five-year plan of renewable energy development in Hainanü GHG accounting approach and ability construction for Chinese

cities

ü Low carbon development roadmap in Guangdongü Carbon emissions trading pilot in Guangdong (system

research and design)ü Guangdong carbon trading implementation effects evaluation

and recommendations for policy adjustmentsü Energy technology roadmap to 2050 in Chinaü China low carbon development macro strategy - global

renewable energy development prospectü China and the US renewable energy generation progressü Smart grid development in China and the USü Guangdong ecological civilization development evaluating

indicator system studyü Guangdong CCUS development roadmap

1. Energy Economy and Policy Analysis and Energy Development Strategy

2. Sustainable Energy Technical Assessment3. Path to Cope with Climate Change and Mitigation Strategies4. Carbon Trading System Design

Research Fields

Undertook more than 100 national ministries, localgovernments, enterprises entrusted and internationalcooperation projects. about 100 research reports.Editor or participated in more than 10 monographs,published more than 50 papers.

Guangzhou Institute of Energy Conversion,GIEC, CAS

Page 5: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

CCS-GIEC-GEI Cooperation

2018/9/27 5

CCS,anditspartnersinChina(GIECandGEI)havedevelopedaseriesoftools,includingworkbooks,documenttemplates,andguidancedocuments,toassistjurisdictions(cities,provinces/states,andcountries)intheimplementationofcomprehensiverenewableenergy(RE)systems.TheREIToolkitwasdevelopedtobridgeknowngapsbetweenenergy/emissions/economicplanningandtheactualimplementationofREprojectsandprogramsatthelocalandregionalscales.

v GIEC§ pilot application of tools for industrial rooftop solar photovoltaic (PV)

program in the Huangpu Economic Development Zone (EDZ) in Guangzhou, Guangdong Province, China

§ pilot application of tools for solar photovoltaic (PV) program and biomass energy in Guangdong Province, China

§ Technology Implementation Document

v CCS § Provide RE planning methodology and toolkit to GIEC§ Guangdong Solar Resource Assessment§ Technology Implementation Document

v GEI§ Marketing the methodology and toolkit to other developing countries§ Coordination work in the project § Technology Implementation Document

the cohesive cooperation of CCS, GEI and GIEC

theRenewable EnergyImplementation(REI)Toolkit

Page 6: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

CCS-GIEC-GEICooperation

u Nov 2017: COP23, Bonn Germany

§ China Pavilion and South Africa Pavilion

• Promoting our LCD development methods

• Presenting our Guangzhou Huangpu Pilot Project results

2018/9/27 6

u June 2017: Guangzhou workshop

• RE Planning Toolkit and methodology Training

• Pilot project target region and renewable energy sector identification: rooftop PV in Huangpu District

• The workplan and tasks allocation

R&DOFtheRenewable Energy Implementation (REI)ToolkitandMethodology

Page 7: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

CCS-GIEC-GEICooperation

§ Introduce the Huangpu pilot project§ Hear from the suggestions and opinions

from the experts§ Adjust and improve the toolkit so that it

can be implemented better in Southern China.

2018/9/27 7

u January 2018: Renewable Energy Planning and Implementation toolkit application and methodology Workshop

v June 2018: Guangzhou workshop

§ Discussion of the long-term strategies of REI project§ Completion review and expansion potential of the TID in 2017§ Determine the 2018 workplan and tasks§ Start the biomass resources assessment of Guangdong province and the

main approaches.

Page 8: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

CCS-GIEC-GEICooperation

v June 2018:RENEWABLE ENERGY WORKSHOP IN MYANMAR § Identify the energy and climate change challenges

facing Myanmar’s INDCs § Deepen Myanmar government officials’ and

research institutions’ understanding and knowledge of low-carbon and renewable energy implementation toolkits

§ Discuss the process for adapting renewable energy implementation toolkit into Myanmar, including technical exchange and pilot project selection

§ Promote the renewable energy implementation toolkit into other developing countries, so that these countries can achieve their NDCs

2018/9/27 8

Page 9: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

PilotProject- HuangpuEconomicDevelopmentZone

vProject Overview

vStep 1: Local Resource Assessment

vStep 2: Selection of RE technology application and sector

vStep 3: Selection of Target Area

vStep 4: Implementation and Business Model For Industrial Rooftop

vStep 5: Results

Page 10: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

PilotProject- HuangpuEconomicDevelopmentZone

KeycomponentsoftheREIToolkitare:

• SpatialAnalysisTool:anopen-source geographic informationsystem(GIS).• RETechnologyMulti-Criteria Assessment (MCA)ScopingTool:assessandpresent resultsofbothquantitative

(empirical benchmarks)andqualitative (expert ratings)criteria toinformselection ofhigh-priorityREtechnologyapplications.

• REMCAScreening SurveyTool:gatherandsummarizeexpert inputonselection ofREtechnologyapplications.• LCDToolkitBaselineModules:assesslocal toprovincial scaleenergysupplyanddemand.• Business ImplementationModel template toidentifynecessary mechanisms, procedures,andrequirements of

participants attheupstream,intermediary, anddownstreamlevels• Financial RiskandReturnAssessmentandSocial ImpactAnalysisTool:assesskeyfinancialandsocial impact

metrics (e.g.discountedcashflows,returnoninvestment,energyandenvironmental impacts).• RETechnology Implementation Template:acomprehensive document thatincludes thetechnology

implementation description, design,business implementation model,participant requirements, andtheexpected financial riskandreturnandsocial impactsoftheproject/program(energy,emissions,economic),aswellastheapproach toanalysisandkeyelements suchasdatasources,methods,andkeyassumptions.

Page 11: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Step 1: Local Resource Assessment

Page 12: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

GuangdongProvinceSolarResourceAssessment

2018/9/27 12

Solar irradiation intensity

Page 13: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

GuangdongProvinceSolarResourceAssessment

9/27/1813

v Purple area are suitable to develop solar PV projects

v Land types that need to be excluded§ Forest§ Cropland§ Water area§ Protected areas§ Slope > 15%1

Using GIS to do the assessment and spatial analysis

Page 14: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

GuangdongProvinceSolarResourceAssessment

9/27/1814

Data Layer Description/Notes Source URLAdministrative Boundaries

Guangdong Province Level 3

GADM database of Global Administrative Areas

http://www.gadm.org/

Land Cover 300-meter, 2015 European Space Agency Climate Change Initiative

https://www.esa-landcover-cci.org/

Land Slope 30-meter digital elevation model, 2000, Space Shuttle Radar Topography Mission

USGS Earth Explorer https://earthexplorer.usgs.gov/

Protected and Sensitive Areas

Protected Area Profile for China from the World Database of Protected Areas, 2017

Protected Planet, UNEP-WCMC

https://protectedplanet.net/country/CHN

Solar Insolation

Global Tilted Irradiation (GTI): irradiation for optimally tilted surface (kWh/m2)

Global Solar Atlas, The World Bank Group

http://globalsolaratlas.info/

Photovoltaic Power Potential

Amount of energy, converted by a PV system into electricity (kWh/kWp), based on local conditions

Global Solar Atlas, The World Bank Group

http://globalsolaratlas.info/

Page 15: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

SelectionofTargetArea

9/27/1815

Technical potential of every districts in Guangdong

GuangdongProvinceSolarPVTechnicalPotentialandLocation ofEDZs

Page 16: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Step 2: Selection of RE technology application and sector

Page 17: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Renewable Energy Technology Multi Criteria Assessment Tool

v Quantitative Criteria:§ Levelized Cost of Electricity (LCOE) ($US/kW)§ Lifetime Production (MWh)§ Annual GHG Reduction (tCO2e)§ GHG Abatement Cost Effectiveness ($/tCO2e)

v Key inputs to the quantitative criteria analysis(solar PV as example):§ Capital and O&M Costs§ Maximum Surface Area§ Efficiency§ Utilization Factor

v Qualitative Analysis§ Alignment with NDC or Similar National Goal§ Air Pollution Benefits§ Government Financial Support§ Other Environmental Benefits§ GSP/Jobs§ Energy Security

2018/9/27 17

Page 18: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Renewable Energy Technology Multi Criteria Assessment Tool

2018/9/27 18

Page 19: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

TechnologyCode

CapitalCost($US/kW)

FixedO&M($US/kW/year)

Efficiency(%)

MaximumInstalledCapacityPotential(MW)

CapacityFactor(%)

Utilization

Factor(%)

Lifetime(yrs)

Tech.Maturity(yrs)

R PV R F $2,640 $35.20 16.0% 130 10.2% 60% 20 20

R PV OS F $3,135 $35.20 16.0% 0 10.2% 60% 20 20C PV R F $2,440 $32.80 16.0% 327 10.2% 60% 25 20

C PV OS F $2,897 $32.80 16.0% 69 10.2% 60% 25 20I PV R F $2,320 $31.20 16.0% 165 10.2% 60% 30 20I PV OS F $2,755 $31.20 16.0% 0 10.2% 100% 30 20

R: residential rooftopC: commercial/institutional rooftopI: industrial rooftopPV: the solar PV technologyOS: open spaceF: the fixed arrays

2018/9/27 19

Key inputs to the quantitative criteria analysis:Solar PV Application Performance and Cost Assumptions

Technology Quantitative Multi-Criteria Ranking:

平准化电力成本

每年温室气体减少量

寿命周期内总发电量

温室气体减少的成本效益

Renewable Energy Technology Multi Criteria Assessment Tool

2.9

1.0

3.7

2.0

4.2

7.1

2.3

1.0

5.2

1.9

3.6

1.0

2.7

1.0

5.2

1.9

3.1

1.0

1.0

1.0

1.9

1.9

2.6

1.0

0 2 4 6 8 10 12 14 16 18

RPVRF

RPVOSF

CPVRF

CPVOSF

IPVRF

IPVOSF

Levelized Cost ofElectricity Lifetime Production

Annual GHG Reduction GHG Abatement Cost Effectiveness

Page 20: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

v Initial Qualitative Ratings and Criterion Weights

2018/9/27 20

v Combined Quantitative and Qualitative Analysis Results

Thebubblechartindicatesthat,basedonbothquantitativecriteria(xandyaxes)andthetotalqualitativecriteriascore(bubblesize),flatpanelPVapplicationoncommercialrooftops(CPVRF)providesthebestresultsoverall.Ithasthegreatestoveralllifetimeproduction(technicalpotential),itismid-wayintermsofimplementationcosts(LCOE),andithasarelativelyhighqualitativescore(19).Thenextbestopportunity appearstobeflatpanelPVsystemsinstalledonindustrialrooftops(IPVRF).

Renewable Energy Technology Multi Criteria Assessment Tool

TechnologyCode

CriteriaWeights>

AlignmentwithNDCorSimilarNationalGoal

AirPollutio

nBenefits

Gov'tFinancialSupport

OtherEnv.

Benefits

GSP/Jobs

EnergySecurit

y

1 1 1 1 1 1

RPVRF 5 3 5 2 2 3RPVOSF 3 2 5 2 2 3CPVRF 4 3 5 2 2 3CPVOSF 2 2 5 2 2 3IPVRF 5 3 5 3 3 2IPVOSF 3 2 5 3 3 2

RPVRF,20

RPVOSF,17

CPVRF,19

CPVOSF,16

IPVRF,21

IPVOSF,18

$250

$350

$450

$550

$650

$750

$850

0 1,000 2,000 3,000 4,000 5,000

Levelized

Costo

fElectricity

($US/MWh)

LifetimeProduction (GWh)

SelectedSolarTechnologies- BubbleSizePresentOverallQualitativePerformanceRating

Page 21: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

MCA Screening SurveyvSolar PV technology for example

2018/9/27 21

v Screening Criteria§ RE supply potential§ Greenhouse gas reduction potential§ Economic Development (could be GDP

impacts, jobs, or sector-specific goals)§ Financing potential and feasibility§ Costs and savings § Energy diversity§ Co-benefits of interest.

v There are four levels of rating in each criterion for each technology – High, Medium, Low, Uncertain.

v Analyze the results:For every criterion, score 3points for High, 2 points for Medium ,1 point for Low and 0 for Uncertain. Sum the total score of each technology and application model. The technology or application model that get the highest score will be selected as the preferred one.

Page 22: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Selection of Solar PV technology and application model

vScreening the application model v Technological Choses:§ Choosing the chemical material of the solar

PV panel: Amorphous Silicon; Cadmium Telluride; Copper, Indium and Selenium; Monocrystalline Silicon; Polycrystalline Silicon; and Spherical silicon

§ Choosing the installation structure:fixed arrays, arrays with single-axis tracking, or arrays with dual-axis tracking

§ Whether we need storage(e.g. batteries) system or not(100 is strongly suggest that we need storage system,0 is the opposite,50 for no opinion)

2018/9/27 22

#Sector Technology Install Location

1Residential PV Rooftop

2Residential PV Open Space

3Commercial/Institutional PV Rooftop

4Commercial/Institutional PV Open Space

5Industrial PV Rooftop

6Industrial PV Open Space

Page 23: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Selection of Solar PV technology and application modelv Result: Industrial Solar rooftop PV is selected

2018/9/27 23

57

40

59

43

72

48

52

36

56

43

67

45

48

36

51

41

54

42

48

31

53

40

62

40

47

40

49

41

61

46

50

45

49

43

55

43

45

29

44

34

51

37

0 50 100 150 200 250 300 350 400 450

Res.- Rooftop

Res.- OpenSpace

C/I.- Rooftop

C/I.- OpenSpace

Ind.- Rooftop

Ind.- OpenSpace

ScoringResultsfromIndividualSurvey

SolarPotential GHGReduction EcoDev. Fin.Feasibility

Cost-effectiveness EnergyDiversity Co-Ben.

Fixed arrays

v RE Technology Application MCA Tool provides quantitative analysis for each technology applications for reference

GIECorganized25expertstoconduct

thesurvey

GIECREresearchteam

GuangdongR&DCenter forTechnologicalEconomy

SouthChinaUniversityofTechnology

GuangzhouEnergyTesting

Institute

GuangdongUniversityofTechnology

HanergyHoldingGroup

Limited

Page 24: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Selection of Solar PV technology and application model

2018/9/27 24

vNeed storage system

Page 25: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Step 3: Selection of Target Area

Page 26: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

PilotGuangzhouCaseOverview

Pilot Project on RE Implementation

Industrial Rooftop PV

Guangzhou Technological and Economic Zone in Huangpu District (Huangpu EDZ)

9/27/1826

v Guangzhou Technological and Economic Development Zone in Huangpu District

§ 420MW Solar Power target by 2020 in Huangpu District

§ Huangpu district needs a detailed solar PV technology implementation planning.

§ Huangpu district administrative government has policy and financial support on the RE planning and RE development.

§ GIEC carried out to produce the low-carbon development plan and the thirteen five-years energy plan for the Huangpu EDZ and understanding it very well.

Page 27: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

v In Huangpu pilot project, use QGIS to analyze the technical potential of solar resourcev Subsequentapplication oftheMCAScopingToolv andasurveyof25localexperts usingtheMCAScreening SurveyTool

9/27/1827

v thehighestpriority technologyapplication shouldbesolarPVsystemsapplied toindustrial rooftopsv The totalsizeoftheprogram is320MWofcapacityv Basedonanominal systemsizeof2.0MW,theprogramwill coverabout160systeminstallations.v thebusiness (orprogram implementation) model issummarized including thekeyphases,individual steps,

actions,parties,mechanisms,performance requirements, andprocedures required forprogram levelimplementation

PilotGuangzhouCaseOverview

Page 28: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

UrbanLandAnalysisandSectorZonesDisaggregation

9/27/1828

Panel 1: Land cover data, urban land shown in red. Panel 2: Urban land cover manually corrected based on satellite image. Panel 3: Grid squares created in urban area, yellow squares show random selection of grid squares.

ExampleDisaggregationofUrbanAreaintoSectorZones.SouthernportionofHuangpuEDZshowingaseparationofindustrial(lightpurple)andresidential/commercial/institutionalzones(darkerpurple).

Page 29: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Digitizing RooftopstoEstimatePotential Installation AreasbySectors

v For other REs:§ Biomass: Areas of agricultural land by crop type or production of specific agricultural product, or livestock

population, within a specified radius around a proposed location of a biomass generation unit;§ Micro-hydro: Potential generation based on elevation change and streamflow characteristics along streams and

rivers in a specific location;§ Wind: Amount of area of suitable land cover, elevation, and wind speed within a specified distance of transmission

infrastructure.

9/27/1829

Page 30: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

GIS Assessment and Spatial Analysis in Huangpu District

vDisaggregationofDevelopedArea§ Light color is industrial area,

Purple is commercial and residential area

§ Red=industrialbuildingsrooftop;Purple=Residentialbuildingsrooftop;Yellow=commercial/institutionalbuildingsrooftop

2018/9/27 30

Page 31: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

GIS Assessment and Spatial Analysis in Huangpu District

vDisaggregationofAreaunderdevelopment• BasedontheSino-Singapore

KnowledgeCityplanning,wedivideitinto3landusetypeandcalculatetheirsurface.

Red=industriallanduse;Purple=Residentiallanduse;Yellow=commercial/institutionallanduse

2018/9/27 31

Page 32: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

GIS Assessment results of Huangpu District Rooftop Area

v Industrial Rooftop: 3.9 km2§ Estimated rooftop area in planning

region:1.47 km2

v Commercial/Institutional Rooftop:3.4 km2§ Estimated rooftop area in planning

region :0.63 km2

v Residential Rooftop:3.1 km2§ Estimated rooftop area in planning

region :0.55 km2

2018/9/27 32

v Calculation of rooftop area in developing region:

Sp = Slu * D Slu:Land use surfaceD:Building density

v Total surface that can install solar PV:St = (Sp + S) * 70% 1

Sp: Rooftop area in developing region

S: Existing buildings rooftop surface

Rooftop Area calculation Rooftop Area results

Page 33: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Technical Potential of Solar PV generation on Industrial Rooftop Area

v Industrial Rooftop Area:3.9km2

§ R: Solar Radiation of Guangzhou(kwh/m2)§ S:Solar PV surface(m2)§ 16%:Average efficiency of PV panels

v Technical Potential: 597MWv Electricity generated: 683.1GWhv 7.42% of the electricity demand in Huangpu district

2018/9/27 33

3hSR %16**

Page 34: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Compare the current status and planning target of Solar PV development in Huangpu District

§ Huangpu district has 597MW technical potential that can be developed

§ Solar PV installed or in construction capacity by 2020:180MW < 420MW

§ The solar PV development in Huangpu district can’t reach its planning target by 2020

2018/9/27 34

Project Goal

1. Help Huangpu district achieve its RE target by 2020 to 420MW

2. Install 320 MW by 2020§ Scale of the project : 130 solar PV

systems (Each project 2.5MW)

Page 35: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Step 4: Implementation and Business Model For Industrial Rooftop

Page 36: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

ImplementationModelforIndustrialRooftopPVv 7 Phasesv Parties include GIEC, Guangzhou Municipal Development and Reform Commission, Power supply

bureau of the Huangpu district(China South Power Grid), industrial facility owners, Solar PV companies as project developers and Banks as lending institutes

Page 37: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

ImplementationModelforIndustrialRooftopPVPhase 1 2 3 4PhaseName Complete Program Feasibility

AssessmentPartner Assembly ProgramMarketing DefineProjects

Parties Involved GIECPower UtilityPower supplybureauoftheHuangpu district

GIECIndustrial FacilityOwnersSolarPVCompany, BankGuangzhou DRC Powersupplybureau oftheHuangpu district

GIECSolarPVCompanyIndustrial FacilityOwners

SolarPVCompanyIndustrial FacilityOwnersGIEC

Steps:Legal,Policy,Administrative, andFinancial Mechanisms

1.GIECworkswiththePowersupplybureau ofthe Huangpudistrict toassesstechnicalfeasibility ofintegrating thenewdistributed generationachievedbytheprogram.2.GIECandPower supplybureau oftheHuangpu districtaddressanyidentifiedfeasibility issues.

1.GIECpresentsthe Programanditsexpected impacts toeachpartner andgainstheirsupport fortheprogramandagreementontheir role,timing, etc.2.SolarPVCompany prepareastandard financingpackage(s)tofacility owners.

1.SolarPVcompanyconducts themarketingprogramtofacilityowners.2.GIECandSolar PVcompanyprovidesupport tointerestedfacilityowners tounderstand thebenefits oftheprogram.

1.SolarPVCompanyprovide proposals toFacilityOwners.2.GIECprovidestechnical support toFacilityOwnerstoevaluateproposals.3.FacilityOwnersselect awinningbidder amongtheproposals submitted(contingent onreceiptoffunding)

AnalyticalRequirements

GIEC:Detailed local industrialelectricity demandandsolarPVsupplyassessmentPower supplybureauoftheHuangpu district: Integrationassessmentofnewsolarpower withthe localgrid

GIECandSolarPVCompany:Additional financial andotherriskanalysesforprojects ofdifferent typesofIndustrialOwners(state-ownedenterprise, listed companiesorprivatesenterprises)andproduct(explosive orcorruptive materials).

GIECandSolarPVcompanydevelopsalisting ofindustrialfacilitycontacts formarketingtheprogram

SolarPVCompanydeveloppreliminarydesignandcostestimatesforuseintheir proposals toFacilityOwners.

Page 38: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

ImplementationModelforIndustrialRooftopPVPhase 5 6 7PhaseName ProgramFunding ProgramImplementation ProgramScale-UpParties Involved Bank

Industrial FacilityOwnersGuangzhou DRCSolarPVCompany

Industrial FacilityOwnersSolarPVCompanyGuangzhou DRCPower supplybureau oftheHuangpu district

GIECGuangdong DRCSouthChina PowerGridIndustrial FacilityOwnersSolarPVcompanies

Steps:Legal,Policy,Administrative, andFinancial Mechanisms

1.SolarPVCompany completesthefinancing package andsendsittoFacilityOwner.SolarPVCompanyprovides support toFacilityOwnerstounderstandthepackage.2.FacilityOwnerreviewsandconducts anyfollow-up withSolarPVCompany .3.FacilityOwnersignsdesigningandbusinesscontract(s).4.Lending Institution providesfundstoSolarPVCompanyconsistent withcontractrequirements.5.Guangzhou DRCcanapplythedistributed PVpowergenerationsubsidyfortheproject.

1.Industrial OwnersgetapprovaloftheChina SouthPower Grid tobuildtheir solarPVinstallation2.SolarPVCompany installPVsystemsforFacilityOwner.3.Connect thesolarsystemonthegrid.

1.Contact andassemblethefactoryowner thatlisted intheGuangzhou Distributed SolarPVGeneration Planning 2.Contactthepower supplybureau ofotherdistricts. 3.SolarPVcompanyandGIECdothe Phase1- 6inacityscaleandevenprovincialscaleinthefuture.

Analytical Requirements FacilityOwnerreviewsdesignandcostproposals fromFacilityOwnerorGIECcompletestandard financial analysis(e.g.usingtheFinancing Tool)forinclusion inthefinancingpackage.

Guangzhou DRCdothe projectrecording andinformationgatheringoftheproject.

Page 39: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

FundFlowandRoleofPartners

• Provide systemdesignandfinancialpackage

• InstallsolarPVsystem

• Provides operationandmaintenanceservice

SolarPVCompany

• Conductfieldresearchofthesite

• Designsolarsystem

DesigningInstitute

• WorkwithDRCofHuangputoidentifyamountofsubsidy

• Providesadequatesubsidiestoprojectdeveloper

BureauofFinance

• Provide 30-50%oftotaldynamicinvestmentfunds

• Submiton-gridapplication topowersupplybureau

• Hiredesigninginstitute

FactoryOwners

• Reviewandevaluatethesystemplanoftheproject

• Provideloansequalto50-70%oftotaldynamicinvestment

Banks

Subsidies

Loan

• Measure andrecordactualsolarpowergeneration

• Purchaseelectricityfromsolarpowersystem

PowerSupplyBureauofHuangpu

PurchaseService

ProvideDesign

Purchaseelectricity

DebtService

Red representSolarPVCompanyobtainsloans

fromBanks

Blue representsFactoryownersgettingloansdirectlyfromBanks

BusinessModelsforIndustrialRooftopPV

RevenueShare

DebtService

Page 40: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

SubsidiesPolicyandEconomicBenefit

NationalSubsidy

Distributed 0,32RMB/kwh(20years)

Citylevelsubsidy

Investmentsubsidy0,2RMB/W,maximum 2million RMBforasingleproject

Generation subsidy 0,1RMB/kwh(10years)

Powerconnectiontype

MeasuredPowerGenerationPrice(RMB/kwh)

PaybackPeriod(years)

Allon-grid 1 10.05

Forownuse,selltheremainingpowertothegrid

1.2 8.38

v CO2 Reduction:681,050 tonsv Emission reduction cost:682 RMB/tCO2

v Equivalent to 840,000 tons standard coalv National level subsidy:218 million

RMB/yrv Local investment subsidy:120 million

RMBv Local production subsidy:68,31 million

RMB/yrv The total preliminary investment is 8,7

billion RMB,Annual O&M cost is 117 million RMB

v Create 19701 jobs

Page 41: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Step 5: Pilot Results

Page 42: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

PilotResultsandnextsteps

v Show list of analysis results for all key variables§ Energy and Emissions Results§ RE Technology Market Assessment§ Program Financial Assessment

v Guangdong Solar Resource Assessment Whitepaper

v Technology Implementation Document

9/27/1842

v Finalizing the Huangpu pilot project TPID

v Extend the toolkit and methodology to develop Solar PV technology implementation to Guangdong Province

v Develop Biomass technology implementation approaches for Guangdong Province

Nextsteps:PilotResults:

Page 43: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Biomass resources assessment of Guangdong Provincev Different approach compare to solar resource:

§ Sources of biomass are varied§ Feedstocks’ characteristic are different§ Existing several kinds of biomass generation technologies

v 3 sectors of biomass resources: Agriculture, Forestry and Municipal Solid Waste

2018/9/27 43 Major Data sources: Guangdong Statistical Yearbook 2017 and Guangdong Statistical Yearbook on Agriculture 2017

v Identify conversion technologies§ Electricity:§ Biogas conversion§ Pellets/Briquettes:§ Other:

v Calculate conversion to energy product – e.g.§ GWh of power – for generate electricity§ TJ of solid fuel

Page 44: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Biomass resources assessment of Guangdong ProvincevAgriculture:

§ Feedstock: Rice Husk§ Major distributed in the

west part of Guangdong

§ 2.81 million tons§ 29595 Tj of equivalent

fuel§ Technical potential:

2961.5GWh

2018/9/27 44

Page 45: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Biomass resources assessment of Guangdong Province§ Feedstock: Rice Straw§ Major distributed in the

west part and north-east part of Guangdong

§ 9.39 million tons§ 107394 Tj of energy§ Technical potential:

10180GWh

2018/9/27 45

01 - 200200 - 10001000 - 20002000 - 4000

Terajoules

Page 46: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Biomass resources assessment of Guangdong Province

2018/9/27 46

vForestry§ Feedstock: Wood products

residues§ Major distributed in the

north-west part of Guangdong

§ 4.6 million tons§ 82839 Tj of energy§ Technical potential:

6024GWh

01 - 200200 - 10001000 - 20002000 - 4000

Terajoules

4000 - 6000

Page 47: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Biomass resources assessment of Guangdong Provincev Current Results:

2018/9/27 47

Feedstock 1. Resource (tons)

1. Biomass Primary Thermal

Energy (TJ)

1. Biogas Primary Thermal Energy

(TJ)2. Biomass Power

(GWh)All Feedstocks 46,582,951 530,996 105,881 13,506

All Feedstocks - BAU Consumption 46,123,971 522,505 105,881 13,021

Rice husk 2,818,905 29,595 3,221 2961Rice straw 9,396,351 107,394 39,883 10180

Sugarcane crop residue 764,071 29,326 12,706 712 Sugarcane bagasse 3,056,284 7,010 791 3021

Urban green space residue 2,197,680 15,406 N/A 1,460Forest harvest residue 1,907,672 34,338 N/A 2,160Wood products residue 4,602,191 82,839 N/A 6,024

Bamboo products residue 132,786 2,390 N/A 165Firewood (use by farmers) 458,980 8,491 N/A 484

Shrubland biomass accumulation 177,957 1,247 N/A 92

MSW Total Organics 15,875,974 116,823 - 1,868 MSW: paper/cardboard 12,576,450 89,939 - 1,442

MSW: wood waste 1,649,762 15,615 - 250 Municipal sewage sludge 7,569,735 112,789 49,279 1,658

Page 48: Announcement of Low Carbon Development Cooperation in … · 2018-09-27 · CCS-GIEC-GEI Cooperation § Introduce the Huangpu pilot project § Hear from the suggestions and opinions

Thank you for your attention!

Pharmaceutical factory 9400 t biomass/year

Aluminum melting54000 t biomass/year

Food processing10500 t biomass/year

v Liao Cuiping, [email protected] Zhang Yueqi, [email protected]

CHINESE ACADEMY OF SCIENCE GUANGZHOU INSTITUTE OF ENERGY CONVERSION


Recommended