+ All Categories
Home > Documents > DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES...

DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES...

Date post: 04-Oct-2020
Category:
Upload: others
View: 3 times
Download: 0 times
Share this document with a friend
57
DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES (Trichechus manatus latirostris) By KENDAL ELIZABETH HARR A THESIS PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF SCIENCE UNIVERSITY OF FLORIDA 2004
Transcript
Page 1: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES

(Trichechus manatus latirostris)

By

KENDAL ELIZABETH HARR

A THESIS PRESENTED TO THE GRADUATE SCHOOL OF THE UNIVERSITY OF FLORIDA IN PARTIAL FULFILLMENT

OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF SCIENCE

UNIVERSITY OF FLORIDA

2004

Page 2: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

Copyright 2004

by

Kendal Elizabeth Harr

Page 3: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

This thesis is dedicated to my daughters, Lillian and Maeve, whose laughter and commentary always remind me what is important and give me perspective on life.

Page 4: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

ACKNOWLEDGMENTS

This work was supported by a grant from the Florida Fish and Wildlife

Conservation Commission (s018) and could not have been completed without the

exceptional mentoring provided by my committee, Dr. Nancy Denslow, Dr. William

Winter, Dr. Ruthie Francis-Floyd, and especially my primary mentor, Dr. John Harvey. I

would like to acknowledge the technical support of Marjorie Chow, Scott McClung,

Melanie Pate, Tina Conrad, Kati Allison, Lavonne Williams, Patricia Kindland, and

Maxine Sacher at the University of Florida College of Veterinary Medicine and Angie

Jones at Lowry Park Zoo. I would like to thank Dr. Dave Murphy, Bob Bonde, Dr. Mark

Sweat, Dr. Lucy Keith, and Dr. Cathy Walsh for help in the field and all of the biologists

working with the state and federal government whose tracking and capture expertise

enabled the sampling required for this study. I am also indebted to Dr. Hollis Erb for

assistance with biostatistical analysis and Dr. Iske Larkin for advice and moral support.

Finally, I would like to acknowledge my husband, Dr. Darryl Heard, for editing,

continual commentary, and the loving support that I know that he tries to give both me

and our children.

iv

Page 5: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

TABLE OF CONTENTS page ACKNOWLEDGMENTS ................................................................................................. iv

LIST OF TABLES............................................................................................................ vii

LIST OF FIGURES ......................................................................................................... viii

ABSTRACT....................................................................................................................... ix

CHAPTER

1 INTRODUCTION ........................................................................................................1

Acute Phase Proteins ....................................................................................................3 Serum Amyloid-A ........................................................................................................3 Haptoglobin ..................................................................................................................4 Fibrinogen.....................................................................................................................4 C-Reactive Protein........................................................................................................5 Alpha1 Acid Glycoprotein ............................................................................................6 Summary.......................................................................................................................6

2 COMPARISON OF METHODS USED TO DIAGNOSE GENERALIZED

INFLAMMATORY DISEASE IN MANATEES (Trichechus manatus latirostris) ...7

Introduction...................................................................................................................7 Materials and Methods .................................................................................................8

Animals and Sample Collection ............................................................................8 Laboratory Analysis ..............................................................................................9 Statistical Analysis ..............................................................................................12

Results.........................................................................................................................13 Discussion...................................................................................................................16

SAA .....................................................................................................................16 A:G Ratio.............................................................................................................18 Haptoglobin .........................................................................................................18 Fibrinogen............................................................................................................20 Wild-Caught Versus Captive Animals ................................................................20 Prognostic Value .................................................................................................22

Conclusion ..................................................................................................................22

v

Page 6: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

3 VALIDATION OF A COMMERCIALLY AVAILABLE SERUM AMYLOID A (SAA) ELISA FOR MEASUREMENT OF SAA CONCENTRATION IN MANATEES (Trichechus manatus latirostris)..........................................................23

Introduction.................................................................................................................23 Materials and Methods ...............................................................................................24

Blood Samples.....................................................................................................24 SAA Analysis ......................................................................................................24 Assay Characteristics of SAA ELISA.................................................................25 Protein Purification and Sequence.......................................................................25 Western Blot and Edmann Sequencing ...............................................................26 Statistical Analysis ..............................................................................................27

Results.........................................................................................................................27 Assay Characteristics of SAA ELISA.................................................................27 Analytical Sensitivity and Specificity .................................................................28 Western Blot and Edmann Sequencing ...............................................................31

Discussion...................................................................................................................32 4 FURTHER INVESTIGATION: TWO DIMENSIONAL GEL

ELECTROPHORESIS ...............................................................................................36

5 SUMMARY................................................................................................................39

LIST OF REFERENCES...................................................................................................42

BIOGRAPHICAL SKETCH .............................................................................................47

vi

Page 7: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

LIST OF TABLES

Table page 2-1 A comparison of three methods used to quantitate albumin (g/dl) in captive and

free-living manatees. ................................................................................................11

2-2 Diagnostic sensitivity and specificity for seven tests of inflammation in captive and free-living manatees ..........................................................................................14

3-1 Effects of the addition of HDL on the measured concentration of SAA in three manatee serum samples. ...........................................................................................30

vii

Page 8: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

LIST OF FIGURES

Figure page 2-1 Horizontal whiska box plots of five values in healthy and diseased populations. ...15

3-1 Linear range of the standard curve using a bovine SAA calibrator.. .......................29

3-2 Linear regression analysis of sample dilutions as an assessment of accuracy. ........30

3-3 Three samples showing significant decrease in SAA concentration with proportional increase of HDL concentration............................................................31

3-4 Multiple sequence alignment for serum amyloid A from the NCBI bioinformatics database for multiple species showing a highly conserved protein across species. .35

4-1 Two dimensional gel electrophoresis of apparently healthy versus diseased manatee.....................................................................................................................37

4-2 Two dimensional gel electrophoresis of apparently healthy versus diseased manatee.....................................................................................................................38

viii

Page 9: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

Abstract of Thesis Presented to the Graduate School

of the University of Florida in Partial Fulfillment of the Requirements for the Degree of Master of Science

DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES (Trichechus manatus latirostris)

By

Kendal Elizabeth Harr

May 2004

Chair: John W. Harvey Major Department: Veterinary Medicine

Manatees (Trichechus manatus latirostris) are commonly afflicted with

inflammatory and infectious disease secondary to human interaction, such as boat strike

and entanglement, as well as “cold stress syndrome.” White blood cell count and fever,

primary indicators of systemic inflammation in most species, are insensitive in

diagnosing inflammatory disease in manatees. Acute phase response (APR) proteins,

such as haptoglobin and serum amyloid A (SAA), have proven to be sensitive measures

of internal inflammation/infection in domestic large animal species. This study assessed

diagnosis of generalized inflammatory disease by different methods including complete

blood count (CBC), albumin:globulin (A:G) ratio, gel electrophoresis analysis, C reactive

protein (CRP), alpha1 acid glycoprotein, haptoglobin, fibrinogen, and SAA. Samples

were collected from 71 normal and 27 abnormal animals during diagnostic medical

examination. Serum amyloid A, measured by enzyme linked immunosorbent assay

(ELISA), followed by A:G ratio, measured by plasma gel electrophoresis, were most

ix

Page 10: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

sensitive in diagnosing inflammatory disease with diagnostic sensitivity and specificity of

approximately 90%. The reference interval for SAA is <10-50 µg/ml with an equivocal

interval of 50-70 µg/ml. The reference interval for A:G ratio by plasma gel

electrophoresis is 0.7-1.1. Albumin:Globulin ratio, calculated using biochemical

techniques, was not accurate due to overestimation of albumin by bromcresol green dye-

binding methodology. A:G ratio, measured by serum gel electrophoresis, has a low

sensitivity of 15% due to the lack of fibrinogen in the sample. Haptoglobin, measured by

hemoglobin titration, had a reference interval of 0.4-2.4 mg/ml, a diagnostic sensitivity of

60%, and a diagnostic specificity of 93%. Fibrinogen, measured by heat precipitation,

has a reference interval of 100-400 mg/dl, a diagnostic sensitivity of 40%, and a

diagnostic specificity of 95%.

Measurement of SAA has not been done previously in manatees and the antibody-

based ELISA used was validated in this novel species. Validation of this serum amyloid

A ELISA was performed according to the Clinical Laboratory Improvement

Amendments. Accuracy, precision, analytical specificity, analytical sensitivity, linear

range of the assay, and reference interval were determined and evaluated as adequate.

This assay was assessed as a good diagnostic after it satisfied these validation criteria.

Further investigation of other potential diagnostically useful proteins that currently

can not be assessed with commercially available assays was performed. Two

dimensional gel electrophoresis was performed on two healthy manatees and one

manatee with subacute injury. The gels were overlayed and four different proteins

unique to the sick animal were identified for idenitification by Edmann sequencing.

x

Page 11: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

CHAPTER 1 INTRODUCTION

Leukocyte count and fever are sensitive indicators of internal inflammation and

infection in many mammalian species. In a few species, e.g., cattle, leukocytosis and left

shifting do not occur unless disease is severe and then may rapidly progress to leukopenia

as leukocyte utilization exceeds bone marrow production. For this reason, leukocyte

count, though occasionally useful in bovine species, is not a sensitive indicator of

inflammation. Clinical reports from veterinarians indicate manatee leukocyte responses

are similar to cattle. Additionally, adequately assessing the core temperature of a 500 kg

aquatic animal is inaccurate at best. Acute phase response (APR) proteins, such as

haptoglobin, are used as a primary indicator in horses and cattle because APR proteins

have proven to be sensitive measures of internal inflammation/infection.1,2 In Europe,

appropriate APR proteins are used as screening tests for inflammatory disease in

livestock.3 There is a distinct possibility that APR proteins could be a valuable screening

diagnostic for inflammation in manatees. Currently, there is no published literature on

acute phase proteins and their use for identifying inflammation in manatee species.

Several practical factors must be considered when identifying and validating an

APR protein for diagnosis of inflammation in manatees. These include physiologic

activity of the protein within manatees, stability of the protein over time during transport

with potential temperature change, accuracy of the methodology employed in identifying

the protein in this species, and clinical use in different disease states specific to manatees.

All of these factors must be evaluated prior to clinical use as a diagnostic test.

1

Page 12: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

2

The purpose of this study was to identify and validate APR protein

methodologies that can be applied to manatees. Several specific aims were identified

within this objective and appropriate hypothesis driven experimentation was carried out

according to the following outline.

Specific Aim #1: Identified methodologies that detected APR protein in manatee serum

and/or plasma.

Hypothesis: Commercially available antibodies crossreact with manatee APR protein.

Specific Aim #2: Determined intra-assay variation and assessed precision

Hypothesis: Intra-assay variation of commercially available assays were within 15%

Specific Aim #3: Determined degradation and loss of the protein over time at room

temperature, 4 degrees C, -20 degrees C, and –70 degrees C.

Hypothesis: The APR protein was stable at the above temperatures over time.

Specific Aim #4: Established protein reference intervals for healthy manatees and

assessed sensitivity and specificity of the protein assay in predicting underlying disease.

Hypothesis: At least one of the proteins assayed was highly sensitive in detecting

nonspecific inflammatory and traumatic disease.

Specific Aim #5: Identified the acute phase protein, detected by ELISA or turbidometric

method, at the molecular level to assess analytical specificity.

Hypothesis: The assay was specific in detecting the protein in question.

Specific Aim #6: Identify plasma proteins produced by ill or injured manatees that may

be investigated for diagnostic potential.

Hypothesis: Additional proteins to those detected by the commercially available

methodologies are made during inflammation.

Page 13: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

3

The following APR proteins were identified as likely diagnostic candidates based

on their usage in domestic animals. Rejection of one or more hypotheses would result in

rejection of the APR protein assay. It was expected that some of the antibodies tested

would not crossreact with manatee protein. Therefore, at least some of the

methodologies would be eliminated early in the project. Tests that are not antibody based

exist for both fibrinogen and haptoglobin. Therefore, it was assumed that we would

obtain results for at least these two proteins.

Acute Phase Proteins

The APR is a nonspecific response to inflammation (infection, autoimmune

disease, etc.) or tissue damage (trauma, surgery, or tumors). Positive APR proteins

(haptoglobin, C-reactive protein, fibrinogen, serum amyloid A, alpha1 acid glycoprotein,

and others) are produced by the liver during APR in response to cytokines released at the

site of injury to either protect the body or to combat a potential pathogen. In humans,

APR proteins are nonspecific indicators of disease similar to fever or leukocyte counts.4

Plasma concentrations of the individual proteins change at different rates after the initial

insult thus providing useful information not only about the inflammation, but also about

duration of disease. Sequential measurement can also aid in assessment of treatment

response.

Serum Amyloid-A

Serum amyloid-A (SAA) is produced by the liver in inflammatory states and

circulates complexed to a lipoprotein. It is also elevated in many autoimmune diseases,

polyarthritis, granulomatous disease, and neoplasia. Deposits of amyloid-A (AA) protein

are most often found in the kidneys, liver, and spleen in chronic disease states but may be

found in any organ. In horses, SAA has been reported to be a very sensitive indicator of

Page 14: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

4

inflammation.2,5 In equine species, SAA is found in trace amounts in healthy animals and

increases dramatically in nonspecific inflammatory states, especially bacterial and viral

infections.

Haptoglobin

Haptoglobin (Hp) is an alpha2-glycoprotein that irreversibly binds hemoglobin

(Hb). Hp-Hb complexes are large enough to prevent or greatly reduce renal filtration of

free Hb in plasma and its iron. The complexes are removed rapidly by hepatocytes and

Kuppfer cells which degrade the proteins, and iron and amino acids are reutilized. The

Hp-Hb complex is also a peroxidase, that hydrolyzes peroxides released by neutrophils at

sites of inflammation. Hp also functions as a natural bacteriostatic agent for iron-

requiring bacteria by preventing the utilization of hemoglobin iron by these organisms.

Haptoglobin is quickly consumed in hemolytic syndromes. Severe hepatocellular

disease also results in decreased synthesis of haptoglobin. It is increased during the acute

phase response. In humans, it is also increased in response to exogenous glucocorticoid

and non-steroidal anti-inflammatory drug (NSAID) administration, during some protein

losing syndromes such as nephrotic syndrome, and during severe biliary obstruction.4

Haptoglobin is undetectable in the blood of healthy cattle. In cattle with inflammation or

infection, e.g., mastitis, metritis, pyometra, traumatic reticulitis, abomasal displacement,

bacterial nephritis, and hepatic lipidosis, haptoglobin levels increase markedly.6-9 It has

proven to be a sensitive indicator of inflammatory disease in cattle.

Fibrinogen

Fibrinogen was the first APR protein recognized. Increased production by the liver

results in increased levels in inflammatory states, as well as pregnancy.4 It is integral in

platelet aggregation. In the coagulation cascade, it is cleaved by thrombin to form fibrin,

Page 15: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

5

the backbone of the thrombus. Though, only mildly increased concentrations are present

in many species during inflammatory disease, it has proven very useful in detecting

inflammation in ruminant species, specifically cattle. Clinical reports from Sea World

veterinarians indicate that hyperfibrinogenemia is also the diagnostic of choice in cetacea.

Hypofibrinogenemia can occur in disseminated intravascular coagulation, liver failure,

and cachexia.

A heat precipitation method is used as a quick estimate of fibrinogen concentration.

More accurate methods include modifications of the Ratnoff-Menzie assay, measurement

of clot weight, and quantification of immunoprecipitate formed with specific

antifibrinogen antisera.

C-Reactive Protein

C-reactive protein (CRP) has been useful as a marker for numerous inflammatory

disease states in humans. In humans, dogs, and rabbits, CRP is one of the first APR

proteins to increase in inflammatory disease and exhibits a dramatic increase in

concentration. It is clinically useful for screening for organic disease, assessment of the

activity of inflammatory diseases, detection of concurrent infections in systemic lupus

erythematosus, in leukemia or after surgery, and management of neonatal septicemia and

meningitis.4,10,11

In the presence of calcium, CRP binds not only polysaccharides present in many

bacteria, fungi, and protozoal parasites but also phosphorylcholine, phosphatidylcholine

and polyanions (such as nucleic acids). In the absence of calcium, CRP binds

polycations, such as histones.12 When bound, CRP activates the classic complement

pathway starting at C1q. Like antibodies, CRP initiates opsonization, phagocytosis, and

lysis of invading organisms including bacteria and viruses. CRP also binds toxic

Page 16: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

6

autogenous substances released from damaged tissue and aids in their clearance from

blood.

Alpha1 Acid Glycoprotein

Alpha1 acid glycoprotein (AAG), also known as orosomucoid, contains a high

percentage of carbohydrate with a large number of sialic acid residues, is highly water

soluble, and is the major constituent of the seromucoid fraction of plasma. AAG’s true

physiological role is still unknown; however it has been shown to bind and inactivate

basic and lipophilic hormones, including progesterone and several drugs, including the

benzodiazepines.13 AAG increases during the APR especially with gastrointestinal

inflammation and neoplasia in humans.4 Iatrogenic increases in AAG concentration are

caused by administration of steroids and non-steroidal anti-inflammatory drugs.4 Levels

are low in protein losing syndromes due to loss and in women with increased estrogen

concentrations through decreased production.

Summary

Commercially available diagnostic assays that measured the positive acute phase

proteins haptoglobin, C-reactive protein, fibrinogen, serum amyloid A, and alpha1 acid

glycoprotein were evaluated for utility in diagnosing inflammatory disease in manatees.

Additionally, identification of novel proteins was attempted using proteomic analysis.

Page 17: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

CHAPTER 2 COMPARISON OF METHODS USED TO DIAGNOSE GENERALIZED

INFLAMMATORY DISEASE IN MANATEES (Trichechus manatus latirostris)

Introduction

The West Indian or Florida manatee (Trichechus manatus latirostris) is a

federally endangered aquatic mammal living in Florida coastal waterways. Common

causes of morbidity and mortality include boat strike, entanglement, brevetoxicosis, and

“cold stress syndrome” which can lead to secondary bacterial or fungal infection.14

Response to therapy in resolving wounds can be difficult to assess in chronic infectious

conditions such as subdermal abscesses, osteomyelitis, and pyothorax.

In many mammalian species, leukocytosis and fever are moderately sensitive

indicators of internal inflammation and infection. However, in a few species, such as

cattle, leukocytosis and left shifting do not occur unless disease is severe and then may

decrease precipitously as leukocyte utilization exceeds production by the bone marrow.

For this reason, leukocyte count, though sometimes useful in bovine species, is not a

sensitive indicator of inflammation. Clinical reports from veterinarians indicate that

manatees’ leukocyte response is similar to that of cattle. Additionally, determining the

core temperature of a 500 kg aquatic mammal with internal anatomic countercurrent heat

exchange mechanisms is not accurate.

The APR is a nonspecific response to tissue damage (trauma, surgery, or tumors) or

inflammation (infection, autoimmune disease, etc.). The goals of the APR is to neutralize

pathogens, minimize tissue damage, promote repair, and return the body to

7

Page 18: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

8

homeostasis.15 Positive APR proteins (haptoglobin, CRP, fibrinogen, SAA, alpha1 acid

glycoprotein, and others) are produced by the liver during the APR in response to

cytokines released at the site of injury to either protect the body or to combat a potential

pathogen. In humans, APR proteins are nonspecific indicators of disease similar to fever

or leukocyte counts.16 Plasma concentrations of the individual proteins change at

different rates after the initial insult, thus providing useful information not only about the

presence of inflammation but also about the duration of disease. Sequential

measurements can also aid in assessment of response to treatment.17

APR proteins, such as CRP, haptoglobin, and SAA, are sensitive measures of

internal inflammation and infection in domestic species. In Europe, appropriate APRs

are used as screening tests for inflammatory disease in livestock.18-22 It is likely that

APRs would be a valuable tool in the diagnosis of inflammation in manatees as they are

in cattle and other domestic animals. Currently, there is no published literature on APR

proteines in sirenian species for identification of inflammatory diesases.

This study compared the effectiveness of complete blood count (CBC),

albumin:globulin ratio (A:G) ratio, and concentrations of CRP , alpha1 acid glycoprotein,

haptoglobin, fibrinogen, and SAA. Methods were compared for diagnostic utility using

diagnostic specificity and sensitivity as well as likelihood ratios.

Materials and Methods

Animals and Sample Collection

This project was preapproved by the University of Florida Institutional Animal

Care and Use Committee approval #A726 and under United States Fish and Wildlife

Service Permit #MA791721-3. Blood was collected during routine diagnostic health

assessment from the brachial vascular bundle (also known as the pectoral arteriovenous

Page 19: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

9

plexus) from 71 apparently healthy and 27 ill manatees during free-living animal captures

performed by government agencies (n=44) and from rehabilitating animals housed at

Lowry Park Zoo (n=25), Miami Seaquarium (n=17), and other institutions (n=12). Fresh

blood samples from 45 apparently healthy and 18 diseased manatees had concurrent

CBC, biochemical analysis, and gel electrophoresis performed at the University of

Florida College of Veterinary Medicine Clinical Pathology Laboratory. Haptoglobin and

SAA were measured in frozen serum samples from 26 healthy and nine diseased animals

with known disease course and response to therapy. These samples did not have

concurrent CBC and biochemical assays performed.

An attending veterinarian either at the rehabilitation facility or in the field

performed a physical examination, including behavioral and external assessment, heart

rate, and respiratory rate. History and reevaluation were available for every animal

housed in a facility and seven recaptured in the field. Animals were assessed as healthy

based on case history, physical examination, CBC, and biochemical data by clinicians

blinded to the data collected in this study.

Crossreactivity of antibody-based assays with the homologous serum or plasma

protein in manatees was assessed using samples from four to five obviously sick, acutely

injured animals. An assay was determined to lack crossreactivity if the results in these

acutely injured animals were comparable to the negative serum control.

Laboratory Analysis

Total white blood cell (WBC) count and red blood cell indices were determined

using a Cell Dyn 3500 (Abbott Laboratories, Abbott Park, IL, USA) previously calibrated

for manatee blood cells by Harr. Differential leukocyte counts were determined

manually by counting 200 cells on Wright Giemsa stained blood preparations. Manual

Page 20: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

10

packed cell volume (PCV) was determined using microhematocrit centrifugation for three

minutes at 13,500 g and compared to the automated hematocrit for quality control. White

blood cell count was estimated from each slide by multiplying the square of the objective

by the average cell number per magnified field. This number was compared to the

automated white cell count for quality control purposes. Nucleated red blood cells

(NRBC) were counted concurrently with 100 WBC and as a percentage of RBCs. They

were reported as per 100 WBC or the relative percentage was multiplied by the total RBC

number to generate an absolute NRBC count per microliter.

Biochemical analysis of heparinized plasma was performed on a Hitachi 911

(Boehringer Mannheim/Roche Applied Science, Indianapolis, IN, USA) using Sigma

reagents (Sigma-Aldrich Corp., St. Louis, MO, USA). Plasma albumin:globulin (A:G)

ratio was determined using two different methods. In the first method, total protein and

albumin concentrations were determined using the biuret method and bromcresol green

methodology respectively.4,23 Globulin values were calculated by subtracting albumin

from total plasma protein concentration. During assay development A:G ratio

determined using biochemical methods using the Hitachi 911 using sigma reagent was

found to be highly inaccurate. Albumin concentration in manatee plasma is

overestimated by bromcresol green methodology by approximately 30% when compared

to protein gel electrophoresis measurement causing marked error in the calculation of

both globulin and A:G ratio. For this reason, further determination of plasma protein

concentrations using the Hitachi was discontinued.

Page 21: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

11

Table 2-1. A comparison of three methods used to quantitate albumin (g/dl) in captive and free-living manatees.

n Total protein Albumin Globulin A:G ratio Mean

(+/-SD)

Range Mean (+/-SD)

Range Mean (+/-SD)

Range Mean (+/-SD)

Range

Serum Gel electrophoresis

56 7.4(+/-0.57)

5.8-8.7

3.5(+/-0.41)

2.2-4.2

3.9(+/-0.46)

3.2-5.3

0.9(+/-0.16

0.6-1.4

Plasma Gel electrophoresis

45 7.7(+/-0.63)

6.4-9.2

3.2(+/-0.46

2.3-4.3

4.4(+/-0.55)

3.6-6.2

0.75(+/-0.14)

0.5-1.0

Plasma Hitachi 911

60 7.9(+/-0.58)

6.3-9.2

4.9(+/-0.46)

3.0-6.0

2.9(+/- 0.49)

1.8-4.3 1.7(+/-

0.36)

0.9-2.6

Note that samples assayed by both serum and plasma gel electrophoresis have similar albumin concentrations. The Hitachi analyzer, using a nonspecific bromcresol green methodology, yields results that are approximately 30% higher. Since globulin and A:G ratio calculations are based on albumin concentrations, inaccurate albumin concentrations cause inaccurate globulin concentration and A:G ratio.

In the second method, albumin and globulin concentrations were determined by

densitometry after protein gel electrophoresis. (Beckman Appraise Densitometer,

Beckman Coulter, Inc., Fullerton, CA, USA)

Five different APR proteins were investigated using commercially available tests.

Manufacturer recommended methodologies were followed. An alpha1 acid glycoprotein

methodology was investigated: an anti-bovine radial immuno-diffusion assay (Tri-Delta

Development Limited, Maynooth, County Kildare, Ireland). Two methodologies were

investigated for CRP: an anti-porcine CRP ELISA (Tri-Delta Development Limited,

Maynooth, County Kildare, Ireland) performed manually and an anti-human CRP

turbidometric assay (Tina-quant CRP – high sensitivity, Roche Diagnostics Corporation,

IN, USA) performed on the Hitachi 911 (Boehringer Mannheim/Roche Applied Science,

Indianapolis, IN, USA). Two methodologies were investigated for haptoglobin: a

turbidometric test involving precipitation of hemoglobin-haptoglobin complexes (Tri-

Page 22: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

12

Delta Development Limited, Maynooth, County Kildare, Ireland) performed on the

Hitachi 911 (Boehringer Mannheim/Roche Applied Science, Indianapolis, IN, USA) and

an anti-human haptoglobin based ELISA (Tina-quant Haptoglobin, Roche Diagnostics

Corporation, 9115 Hague Road Indianapolis, IN, 46250, USA) performed manually.

Fibrinogen was assessed by the heat precipitation method. When performing the

heat precipitation method, plasma protein concentration was measured in an

anticoagulated sample using a refractometer. A second plasma protein concentration was

measured after the microhematocrit tube was heated to 57°C for three minutes. The

difference between the precipitated and unprecipitated proteins was assumed to represent

fibrinogen.24 One SAA assay was investigated: an anti-bovine SAA ELISA (Tri-Delta

Development Limited, Maynooth, County Kildare, Ireland) performed manually.

Statistical Analysis

Descriptive statistics, T tests, sensitivity, specificity, and likelihood ratios were

performed manually or using a commercial statistics software program (Minitab Inc.,

State College, PA, USA). Sensitivity was calculated by dividing true positives by the

sum of true positives and false negatives. Specificity was calculated by dividing true

negatives by the sum of true negatives and false positives. Positive likelihood ratios were

calculated by dividing sensitivity by 1 minus specificity.25 Graphs were created using a

commercially available graphing software program (Sigma Plot, SPSS, Inc, Chicago, IL,

USA) Reference intervals of normally distributed values were generated by mean +/-

1.96 standard deviations. Reference intervals for analytes that failed normality testing

were generated based on the use of percentiles.26 Outliers greater than three standard

Page 23: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

13

deviations from the mean were deleted from the sample set used to generate reference

intervals.

Results

Monoclonal antibodies against human CRP and human haptoglobin did not

crossreact with those proteins in manatees. Similarly, the monoclonal antibodies against

porcine CRP and bovine alpha1 acid glycoprotein (AAG) did not crossreact with those of

manatees.

Mean, median, 95% reference interval, diagnostic specificity, and diagnostic

sensitivity for all assays that exhibited antibody crossreactivity or are not antibody based

including CBC, serum and plasma A:G ratio, haptoglobin, fibrinogen, and SAA are

presented in Table 2-1 and depicted in Figure 2-1.

In this study, SAA is a very sensitive (85%) and specific (90%) diagnostic indicator

of disease using the reference interval of <10 to 50 µg/ml, with an equivocal range of 50-

70µg/ml.(See Table 1) The positive likelihood ratios calculated indicate that a result in

the equivocal range would be approximately eight times as likely to be seen in a manatee

with inflammatory disease as a manatee without inflammatory disease. A:G ratio

determined by plasma gel electrophoresis with an established reference interval of 0.7-1.1

had the highest diagnostic sensitivity of any assay. Diagnostic sensitivity and specificity

at this level was 88% and 94% respectively. A:G ratio determined using serum protein

electrophoresis had a much lower sensitivity of 15%.

Haptoglobin, measured by hemoglobin titration, was detectable in the blood of

manatees and had a reference interval of 0.4-2.4 mg/ml. This high reference interval

results in a lower diagnostic sensitivity of approximately 60% with a diagnostic

specificity of 93%. Fibrinogen, measured by heat precipitation, has a reference interval

Page 24: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

14

Table 2-2. Diagnostic sensitivity and specificity for seven tests of inflammation in captive and free-living manatees. Values are listed from highest to lowest diagnostic sensitivity. Plasma A:G ratio and SAA have higher diagnostic sensitivities than other tests. Haptoglobin and fibrinogen may also be useful if positive but may more frequently yield a false negative result. A:G ratios were determined by protein gel electrophoresis. Fibrinogen was determined by the heat precipitation method. A:G = albumin:globulin, SAA= Serum amyloid-A, NRBC=Nucleated red blood cell, WBC= White blood cell.

HEALTHY DISEASED

units n Mean (+/-SD) Median Reference

Interval n Mean (+/-SD) Median Range Diagnostic

SensitivityDiagnosticSpecificity

Plasma A:G ratio none 20 0.8

(+/-0.11) 0.8 0.7-1.1 11 0.6 (+/-0.1) 0.6 0.4-0.7 88% 94%

SAA µg/ml 71 22(+/-25) <10 <10-50 38 266(+/-398) 108 <10->1200 85% 90%Haptoglobin mg/ml 71 1.4(+/-0.7) 1.3 0.4-2.5 38 2.5(+/-1.0) 2.6 0.4-4.5 64% 90%

Fibrinogen mg/dl 27 200 (+/-115) 200 100-400 16 400(+/-240) 400 100-1000 39% 95%

NRBC /100 WBC 27 0.1(+/-0.4) 0 0-2 16 6.6 (+/-15.6) 1 0-62 25% 100%

WBC X103/µL 27 6.8 (+/-2.63) 6.4 3.7-10.6 16 6.7(+/-1.72) 6.6 4.3-17.7 17% 98%

Serum A:G ratio none 24 0.9

(+/-0.14) 0.9 0.7-1.2 11 0.7 (+/-0.13) 0.7 0.6-1.0 15% 100%

Page 25: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

15

10 30 50 70 90 110

Seru

m a

myl

oid

A

( µg/

ml)

Healthy

Diseased

0.6 0.8 1.0

Plas

ma

A:G

Rat

io

(no

units

)

Healthy

Diseased

0.0 0.5 1.0 1.5 2.0 2.5 3.0 3.5 4.0 4.5 5.0

Hap

togl

obin

(m

g/m

l)

Healthy

Diseased

100 300 500 700 900 1100

Fibr

inog

en(m

g/dl

)

Healthy

Diseased

1 4 7 10 13 16

WB

C c

ount

(x

103

cells

/ µl)

Healthy

Diseased

Figure 2-1. Horizontal whisker box plots of five values in healthy and diseased

populations. Outliers=black dots. 50% of the population is contained within gray rectangle. Median is represented by a solid line. Note that there is a marked population difference between healthy and diseased manatees in values with a high diagnostic sensitivity.

Page 26: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

16

of 100-400 mg/dl, a diagnostic specificity of 95%, and a diagnostic sensitivity of

approximately 40% in the manatee population studied.

The median SAA concentration of the normal population was below detectable

limits (<10 µg/ml). Greater than 80% of the healthy population had concentrations less

than or equal to 20µg/ml. Positive likelihood ratios calculated for SAA at 20, 40, 50, 60,

70, 80 µg/ml were 3.63, 6.0, 7.7, 8.2, 8.6, and 9.5 respectively.25

Discussion

SAA and A:G ratio, measured by plasma gel electrophoresis, were much more

reliable inflammatory disease diagnostic markers in manatees than either WBC or NRBC.

This study confirmed previous clinical impressions of poor diagnostic utility of WBC

count and NRBC numbers for the diagnosis of inflammatory disease. In boat struck

manatees, increased NRBC may be regenerative due to hemorrhage and decreased red

cell mass or in response to severe inflammation. Haptoglobin and fibrinogen may also be

diagnostically useful but have a lower diagnostic sensitivity.

SAA

SAA is highly evolutionarily conserved across vertebrate species from fish to

humans, indicating that its roles in wound healing and inflammation are likely integral to

returning the body to homeostasis during the APR.27 It is produced by hepatocytes in

response to cytokines, primarily IL-1, IL-6, and tumor necrosis factor that are secreted at

local sites of inflammation. SAA circulates complexed to lipoprotein, predominantly

high density lipoprotein (HDL) in humans.28 It plays a role in lipid metabolism although

its exact role is still speculative. SAA is reported to increase cholesterol transport

through HDL to tissues from the liver to facilitate tissue regeneration.29 Other studies

Page 27: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

17

indicate that SAA facilitates removal of large quantities of cholesterol liberated at sites of

tissue damage.30

SAA reportedly has an immunomodulatory function that promotes wound healing.

A-SAA (an induced form) in humans can induce extracellular matrix (ECM) degrading

enzymes, such as collagenase, stromelysin, and matrix metalloproteinases 2 and 3, which

are important for repair and reorganization after tissue damage.31,32 In vitro studies have

demonstrated that SAA can act as a chemoattractant for neutrophils, monocytes, mast

cells, and T lymphocytes.33-35

In horses, SAA has been reported to be a very sensitive indicator of inflammation.36

Manatees appear to be similar to horses, their evolutionary cousins, in that SAA is found

in only trace amounts in healthy animals and increases dramatically in nonspecific

inflammatory states, especially bacterial infection.

There are physiologic interactions with hormones in other species that may be

important when using SAA as a diagnostic test in manatees. Exogenous or endogenous

glucocorticoids may affect (most commonly cause a decrease in) the concentration of

SAA.37 Additionally, both estrogens and androgens can affect cytokine production and

therefore SAA concentration. Pregnancy, a state of decreased estrogen and increased

progesterone concentrations, generally causes mildly increased SAA concentrations in

humans.38 Though administration of glucocorticoids or pregnancy may, therefore, mildly

change the diagnostic specificity and sensitivity of SAA concentration in manatees, the

analysis of this healthy and diseased manatee population showed that SAA is a very

useful inflammatory indicator in manatees.

Page 28: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

18

SAA is the serum precursor of amyloid A (AA) protein, the principal component of

reactive amyloid deposits found in a heterogeneous group of chronic inflammatory

disorders including rheumatoid arthritis and tuberculosis in humans.39 Deposits of AA

protein are most often found in the kidneys, liver, and spleen in chronic disease states but

it may be found in any organ. The morbidity due to amyloidosis in manatees has yet to

be determined.

A:G Ratio

A:G ratio is often a sensitive indicator of inflammation as it incorporates both the

negative APR protein, albumin, in the numerator and positive APR proteins in the

globulin fraction, in the denominator. Three methodologies for measuring A:G ratio

were evaluated, two using heparinized plasma and one using serum. Of the three

methodologies evaluated, plasma gel electrophoresis was by far the most diagnostically

useful. Serum samples had significantly decreased diagnostic sensitivity. Fibrinogen, an

important positive APR protein, is removed in the clotting process and therefore accurate

positive detection of inflammation is markedly decreased in serum samples. A:G ratio

determined using bromcresol green methodology using the Hitachi 911 was inaccurate

and should not be used. Albumin concentration in manatee plasma is overestimated by

by approximately 30% with large variation by this biochemical method when compared

to protein gel electrophoresis measurement. This inaccurate measurement, likely due to

nonspecific binding of bromcresol green dye with other proteins such as fibrinogen,

results in a higher A:G ratio and increased numbers of false negative results.40

Haptoglobin

Haptoglobin (Hp) is a glycoprotein that migrates in the alpha-2 globulin fraction

and binds hemoglobin (Hb) irreversibly. The large Hp-Hb complexes greatly reduce

Page 29: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

19

renal loss of free Hb and its iron. The complexes are removed rapidly by hepatocytes and

Kuppfer cells in the liver where they are degraded and iron and amino acids are recycled.

The Hp-Hb complex is also a peroxidase, capable of hydrolyzing peroxides released by

neutrophils at sites of inflammation. Hp also functions as a natural bacteriostatic agent

for iron-requiring bacteria by preventing the utilization of hemoglobin iron by these

organisms.41

Haptoglobin is the characteristic APR protein in cattle and was therefore

investigated in this study of manatees.42 Haptoglobin is undetectable in the blood of

healthy cattle. Haptoglobin levels may increase 50 fold or more in cattle with

inflammation or infection, such as mastitis, metritis, pyometra, traumatic reticulitis,

abomasal displacement, and bacterial nephritis.43-46 It has therefore proven to be a

sensitive indicator of inflammatory disease in cattle.

Haptoglobin had a reference interval of 0.4-2.4 mg/ml which is more comparable to

the reference interval in dogs, which ranges up to approximately 2.6 mg/ml, than the

undectectable values (0.2 mg/ml) in cattle. This high reference interval results in a lower

diagnostic sensitivity of approximately 60% with a diagnostic specificity of 93%.

Haptoglobin concentration, measured by hemoglobin titration, is decreased by hemolysis

in the sample. Consequently, moderate hemolysis in samples may decrease the

sensitivity of this assay. Haptoglobin is quickly utilized during intravascular hemolysis,

and severe hepatocellular disease also results in decreased synthesis of haptoglobin. In

humans, it is also increased in response to exogenous progesterone, glucocorticoids, and

NSAID administration, during some protein losing syndromes (such as nephrotic

syndrome), and during severe biliary obstruction.41

Page 30: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

20

Fibrinogen

Fibrinogen was the first APR protein recognized. In the coagulation cascade, it is

cleaved by thrombin to form fibrin, the backbone of the thrombus. Fibrinogen is also

integral in the aggregation of platelets. Although, only mildy increased fibrinogen

concentrations are observed in many species, it has proven very useful in detecting

inflammation in ruminant species, specifically cattle and cetaceans.47 Increased

production by the liver, stimulated by locally produced cytokines, results in increased

fibrinogen concentrations in inflammatory states as well as pregnancy in humans.41 Low

concentrations of fibrinogen can occur in disseminated intravascular coagulation, liver

failure, and cachexia.

Fibrinogen measured by heat precipitation, though useful in assessing

inflammatory lesions, is not as sensitive as either SAA, haptoglobin, or plasma A:G ratio

determined by gel electrophoresis. Increased fibrinogen concentration, measured by heat

precipitation, only accurately diagnosed inflammatory disease in approximately half of

the diseased population. The heat precipitation method is a quick estimate of fibrinogen

concentration and should not be considered quantitative. More accurate methods include

modifications of the Ratnoff-Menzie assay, measurement of clot weight, and

quantification of immunoprecipitate formed with specific antifibrinogen antisera. These

quantitative methods should be assessed.

Wild-Caught Versus Captive Animals

Reference intervals generated included samples for both captive (n=54) and wild

caught (n=44) animals. All nine false positive animals were wild-caught animals. False

positive status was based on veterinary physical exam as the gold standard. Of the nine

false positive animals based on SAA analysis, three wild-caught animals were

Page 31: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

21

categorized as false positive on both haptoglobin and SAA assays. This indicates that

these animals likely had a subclinical bacterial or viral disease that was not detected

during the one to two hour assessment performed on the beach. Due to the constraints of

the original study design and our inability to prove disease in these free living animals,

their classification as false positive was maintained for statistical analysis. If data were

generated for captive animals only, i.e. animals at facilities with regular keeper and

veterinary observation, diagnostic specificity and positive predictive value of the SAA

ELISA and haptoglobin titration would approach 100%. Therefore, a positive test result

provides excellent evidence of inflammatory disease.

Inflammatory disease has not been assessed in the wild population due to lack of

available reliable diagnostics. It has been reported that manatees are naturally resistant to

infectious disease.48 The wild-caught animals that were assessed in this study were

caught in winter during months of cold stress. During this time period, large numbers of

hypothermic animals are clustering at natural and man-made warm water outflows. This

is the time period when manatees would be most likely to contract viral or bacterial

disease and so our assessment of subclinical inflammatory disease is not surprising.

Of the nine diseased animals assessed as false negatives at facilities, three were

diagnosed with uncomplicated brevetoxicosis. The paralysis and drowning associated

with this intoxication would not be expected to cause an inflammatory lesion. If these

animals were eliminated from our diseased population, sensitivity of the SAA and

haptoglobin assay would be approximately 90% and 70% respectively. Four of the other

false negative animals had pectoral wounds caused by crab trap entanglement. These

peripheral, infected wounds may have been walled off with a fibrotic reaction and

Page 32: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

22

therefore did not induce the systemic inflammatory response necessary to cause increased

concentrations of APR proteins.

Prognostic Value

Four rehabilitating animals in the study population, housed at two facilities, died

during the study period. Three of the four animals had SAA concentration exceeding

1200µg/ml, the maximum measurable concentration with 10 fold dilution. The deceased

animals maintained this >100 fold increase over normal SAA concentration over one to

two months. Two other live animals also had >1200µg/ml SAA on presentation. The

SAA concentration decreased dramatically in the first two weeks of treatment to

approximately 100µg/ml and these animals recovered from their injuries. The low

number of manatees with this markedly increased SAA concentration precludes statistical

analysis. However, these preliminary findings indicate that markedly increased SAA

concentration especially when assessed over time may be prognostically useful.

Conclusion

SAA, measured by ELISA, and A:G ratio, measured by plasma gel electrophoresis,

were most sensitive in diagnosing inflammatory diseasein manatees with diagnostic

sensitivity and specificity approaching 90%. A:G ratio measured using other techniques

was not diagnostically sensitive and, therefore, not useful in the diagnosis of

inflammatory disease. Haptoglobin, measured by hemoglobin titration, had a lower

diagnostic sensitivity of 60%, likely caused by the relatively high concentration of

haptoglobin in normal animals. This assay may give important information about

response to therapy. The fibrinogen concentration estimate assessed in this study was

more sensitive than white blood cell count but only diagnosed half of the true positive

inflammatory lesions that were diagnosed by SAA and A:G ratio.

Page 33: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

CHAPTER 3 VALIDATION OF A COMMERCIALLY AVAILABLE SERUM AMYLOID A (SAA)

ELISA FOR MEASUREMENT OF SAA CONCENTRATION IN MANATEES (Trichechus manatus latirostris)

Introduction

The West Indian or Florida manatee (Trichechus manatus latirostris) is a federally

endangered aquatic, herbivorous mammal living in Florida coastal waterways. Standard

markers of inflammatory disease are not useful diagnostic tools in manatees. For

example, the diagnostic sensitivity of increased leukocyte count in manatees was 17% in

a population studied.49 Additionally, the measurement of temperature in a 1,000 pound

aquatic mammal with numerous internal thermal countercurrent exchange mechanisms is

inaccurate. Serum amyloid A (SAA) has been found to be a useful, major acute phase

reaction (APR) protein in manatees.49 The concentration of SAA in healthy manatees is

low (<10-50µg/ml) but shows a rapid, several fold increase in concentration at the onset

of acute inflammatory disease.

The purpose of this investigation was to assess the reliability of a commercially

available ELISA for measuring sirenian SAA concentration in plasma and serum. The

Tridelta Phase range SAA kit (Tri-Delta Development Limited, Maynooth, County

Kildare, Ireland), a solid phase sandwich Enzyme Linked Immunosorbent Assay, is

designed for use in multiple domestic animals including bovine, equine, canine, feline,

porcine, and human species. The monoclonal antibody specific for SAA distributed in

this kit does crossreact with SAA in manatees. According to the Clinical Laboratory

Improvement Amendments (CLIA) guidelines (http://cms.hhs.gov/clia/) for assays

23

Page 34: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

24

developed in house, this study assessed precision, detection limit, analytical specificity

and sensitivity, and established a reference interval in healthy animals.

Materials and Methods

Blood Samples

Blood samples from a total of 98 manatees were included in the trial in accordance

with the University of Florida Institutional Animal Care and Use Committee approval

#A726 and under United States Fish and Wildlife Service Permit #MA791721-3. Extra

blood was taken during routine diagnostic health assessment from the brachial vascular

bundle (also known as the pectoral arteriovenous plexus) from 71 apparently healthy and

27 ill manatees during wild animal captures performed by the Florida Fish and Wildlife

Commission and from rehabilitating animals housed at Lowry Park Zoo, Homosassa

Springs State Wildlife Park, and Miami Seaquarium. Manatees were assessed as healthy

based on history, physical examination, CBC, and biochemical analysis by a veterinarian.

Serum and plasma samples from healthy and ill animals were used in statistical

assessment of accuracy and precision across the linear range of the assay.

SAA Analysis

The Tridelta Phase range ELISA (Tri-Delta Development Limited, Maynooth,

County Kildare, Ireland) was performed manually, with a standard curve generated using

a known quantity of bovine serum amyloid A calibrator, according to the manufacturer’s

instructions. Serum from a healthy horse and one with septic peritonitis were used as

negative and positive controls respectively during each analysis. All samples were

assayed in duplicate and the average of the two wells was reported. Samples were rerun

if concentrations in the duplicate assays differed by greater than 30%.

Page 35: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

25

Assay Characteristics of SAA ELISA

A 95% reference interval was constructed using percentiles from data from a

population of 66 healthy animals.26 Interassay precision was assessed using ten serum

samples with SAA concentrations evenly distributed between <10 to >120 µg/ml. Each

serum sample was analyzed on two plates with six replicates each to total 12 replicates.

A dilutional experiment was performed as a test of analytical sensitivity. Three samples

that contained 49, 106, and 120 µg/ml SAA were diluted 1:1, 1:2, 1:4, 1:8, and 1:16 with

1x dilution buffer. To assess analytical specificity and interaction with other compounds,

each of four samples, containing <10, 50, 95, and >120 µg/ml SAA, were spiked with

purified human high density lipoprotein (Fitzgerald Industries International, Inc.,

Concord, MA, USA) to sample concentration of 0, 50, 100, and 300 mg/dl. Additionally,

ten paired manatee serum and plasma samples were analyzed to determine if a heparin

interaction could be detected.

Protein Purification and Sequence

The monoclonal biotinylated anti-SAA antibody (Tri-Delta Development Limited,

Maynooth, County Kildare, Ireland) used in the serum amyloid A sandwich ELISA was

immobilized on a Seize X Protein G immunoprecipitation column (Pierce Biotechnology,

Rockford, IL, USA) according to manufacturer’s directions. The antibody was

crosslinked to the column using disuccinimidyl suberate (DSS). Manatee serum

containing >120 µg/ml SAA was passed over one column while diluent was passed over

a second column, serving as a negative control. Bound antigen was eluted from the

column using buffer of pH 2.5 provided with the Seize X Protein G immunoprecipitation

column. All eluted fluid was saved. Elutions were mechanically concentrated using a

Microcon YM-3 centrifugal filter unit (Millipore Corporation, Bedford, MA, USA) that

Page 36: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

26

retains proteins with mass over 3,000 daltons. The concentrated antigen was separated

on precast, stacked 16.5% tris-tricine, SDS-PAGE Criterion polyacrylamide gels (Bio-

Rad Laboratories, Hercules, CA, USA) with tris-tricine running and sample buffers

designed for peptide separation (Bio-Rad Laboratories, Hercules, CA, USA) using

Criterion gel electrophoresis apparatus. SeeBlue Plu2 Pre-Stained Protein Standard

(InVitrogen, Carlsbad, CA, USA) was used as a molecular weight marker. Gels were

stained with Biosafe-Coomassie Blue (Bio-Rad Laboratories, Hercules, CA, USA) and

destained with water.

Western Blot and Edmann Sequencing

Gels were transferred to a PVDF membrane for Western blotting analysis using a

Bio-Rad Criterion Blotter (Bio-Rad Laboratories, Hercules, CA, USA) according to

manufacturer’s directions. The membrane was blocked with 5% Blotto (5% Carnation

instant non-fat dry milk in 20mM tris pH 7.6, 0.15 NaCl, 0.05% Tween 20, 0.02%

sodium azide). Approximately 0.03 ml stock monoclonal biotinylated anti-SAA (Tri-

Delta Development Limited, Maynooth, County Kildare, Ireland) was diluted in SAA

ELISA dilution buffer (Tri-Delta Development Limited, Maynooth, County Kildare,

Ireland) and the membrane was incubated at room temperature for approximately three

hours. The membrane was rinsed three times with SAA ELISA dilution buffer (Tri-Delta

Development Limited, Maynooth, County Kildare, Ireland) and incubated with

streptavidin conjugated alkaline phosphatase (Pierce Biotechnology, Rockford, IL, USA)

at a 1:1000 ratio with TBSTZ (20 mM tris pH 7.6, 0.15 M NaCl, 0.05% Tween, 0.02%

sodium azide) for two hours. The substrate (0.3% NBT and 0.15% BCIP in 0.1 M tris pH

9.5, 0.1 M NaCl, 5 mM MgCl2) was added and the blot was allowed to develop for 2-4

minutes. Reaction was quenched using 20mM EDTA when bands were visible.

Page 37: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

27

PVDF membrane was digested using endoproteinase – Lys C (Roche Diagnostics,

Indianapolis, IN).50 Subsequent fractions were separated on an HPLC and N-terminally

sequenced on an Procise 494HT Protein Sequencer. (Applied Biosystems,Foster City,

CA, USA)

Statistical Analysis

Statistical analysis including descriptive statistics, coefficient of variation for

assessment of precision, a paired T test to determine if heparinized samples were

significantly different than serum samples, and simple linear regression to evaluate

accuracy of diluted sample measurment were performed using a commercial statistical

program. (Minitab Inc., State College, PA, USA) and Microsoft Excel 2000 (Microsoft

Corporation, Seattle, WA, USA). A p value of <0.05 was accepted as significant.

Statistical Analysis. Sensitivity was calculated by dividing true positives by the sum of

true positives and false negatives. Specificity was calculated by dividing true negatives

by the sum of true negatives and false positives. Positive likelihood ratios were

calculated by dividing sensitivity by 1 minus specificity.25 Reference intervals of

normally distributed values were generated by mean +/- 1.96 standard deviations.

Reference intervals for analytes that failed normality testing were generated based on the

use of percentiles.26 Outliers greater than three standard deviations from the mean were

deleted from the sample set used to generate reference intervals.

Results

Assay Characteristics of SAA ELISA

The linear range of the standard curve generated using the manufacturer’s bovine

SAA calibrator was <10 µg/ml to >120 µg/ml (Fig. 3-1). The 95% reference interval for

apparently healthy manatees was <10 to 50 µg/ml. The interassay coefficient of variation

Page 38: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

28

ranged from 3 to 14%. Samples near the high end of the reference interval (50 µg/ml)

produced a coefficient of variation (CV) of 12%. This coefficient of variation was high

but acceptable according to CLIA. Therefore, an equivocal reference interval of 50 to 70

µg/ml was established by adding three standard deviations of replicates at 50 µg/ml to 50

µg/ml. Values >70 µg/ml indicate active inflammatory disease.

Investigation of inaccuracy by dilution of samples from three animals produced a

linear regression equation in which x represented the predicted concentration according

to sample dilution and y represented the measured level. (Fig 3-1) The slope was equal

to 0.9865 and the intercept was 4.17. The equation produced an R2 value of 96.1% and

p<0.001.

Analytical Sensitivity and Specificity

Three separate attempts at accuracy evaluation, by spiking manatee serum with

bovine SAA calibrator in the commercial ELISA (Tri-Delta Development Limited, Unit

7, Block F, Maynooth Business Campus, Maynooth, County Kildare, Ireland),were

performed. Stock solution, containing 3,000 ng/ml and 1,000 ng/ml bovine SAA

calibrator, was diluted with manatee serum containing undetectable concentrations of

SAA for a final sample concentration between 30 to 600 µg/ml. All experiments were

unsuccessful and, regardless of expected final concentration, all measured concentrations

were undetectable (<10 µg/ml). It is hypothesized that a compound present in manatee

serum binds SAA and covers the epitope of the monoclonal antibody used in the ELISA

kit. This results in unmeasurable quantities of bound SAA regardless of concentration

added. Once all of the binding sites of this unknown compound are filled by SAA, any

extra, free SAA is then measured by the assay. This may account for the differences

observed between the sick and apparently healthy populations. Approximately 80% of

Page 39: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

29

the healthy animals had SAA concentration <20 µg/ml while the median concentration of

diseased animals was 100 µg/ml, a 5 fold increase.

SAA standard curvey = 0.0131x + 0.0115

0

0.5

1

1.5

2

2.5

0 50 100 150 200

concentration (ng/ml)

corr

ecte

d ab

sorb

ance

SAA standard curve y = 0.0116x + 0.445

00.5

11.5

22.5

33.5

44.5

0 50 100 150 200 250 300 350

concentration (ng/ml)

corr

ecte

d ab

sorb

ance

Figure 3-1. Graph of the linear range of the standard curve for the Tridelta Phase range

SAA ELISA using a bovine SAA calibrator. Note that final concentration is multiplied by the dilution factor of 500. The top graph is representative of the standard curve used in an ELISA assay in this project. The bottom graph includes the final point recommended by the manufacturer but out of the linear region of the curve. This type of graph was not used in this project.

Page 40: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

30

100 50 0

150

100

50

0

Predicted Concentration (µg/ml)

Exp

erim

enta

l Con

cent

ratio

n (µ

g/m

l) R-Sq = 96.1 % p<0.001

concentration = 4.16974 + 0.986580 predicted concentration

95% PI

95% CI

Regression

Dilutional Experiment [SAA] Regression Plot

Figure 3-2. Linear regression analysis of manatee serum SAA dilutions as an assessment

of accuracy. Note the high R2 value and p<0.001indicating that manatee serum SAA concentration was linear and proportional upon dilution by the Tridelta Phase range SAA ELISA.

Since human SAA binds HDL, interaction between manatee SAA and HDL was

assessed. Testing with HDL spiked samples revealed a decrease of approximately 5% of

original concentration with each addition of 50 mg/dl HDL. Addition of 300 mg/dl HDL,

resulted in a decrease of approximately 25%. (Table 3-1 and Fig 3-3)

Table 3-1. Effects of the addition of HDL on the measured concentration of SAA in

three manatee serum samples. Note that high concentrations of HDL lowers measured SAA.

Added HDL (mg/dl) Sample A Sample B Sample C 0 41 89 122

50 38 84 119 100 35 89 104 300 30 75 87

Page 41: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

31

Decrease in [SAA] with Increasing [HDL]

0

20

40

60

80

100

120

140

0 50 100 150 200 250 300 350

HDL (mg/dl)

SAA

(ug/

m

Figure 3-3. Three manatee serum samples showed significant decrease in SAA

concentration with proportional increase of HDL concentration. This may result in false negative results in obese animals or animals with increased HDL concentration.

Heparinized plasma and serum samples were not significantly different and the raw

data revealed no clinically significant difference between plasma and serum samples.

Western Blot and Edmann Sequencing

Antibody contamination from the immunoprecipitation column was present in the

elutions from the negative control column as well as columns treated with manatee

serum. Western blot revealed a protein of approximately 12,000 daltons in size in elution

one and two from the column treated with serum. Lesser quantities of a protein

approximately 3,000 daltons in size was also identified. Edmann sequencing of the

12,000 dalton protein revealed that the protein is N terminally blocked. Digestion

produced a protein fragment with the sequence ASP, PRO, ASN, HIS, PHE, ARG, PRO,

GLU, GLY, LEU, PRO, ASP, LYS. When this fragment was blast searched in the

National Center for Biotechnology Information (NCBI) data base, serum amyloid A from

Page 42: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

32

the brown rat, Rattus norvegicus, the house mouse, Mus musculus, and the domestic cat,

Felis catus, yielded an E value of 3xe-4 and serum amyloid A from the domestic dog,

Canis familiaris, and European cattle, Bos Taurus, yielded an E value of 9xe-4.

Discussion

The Clinical Laboratory Improvement Amendments (CLIA) were finalized as

guidelines for human laboratory medicine in 2003. The guidelines provide an excellent,

well-reviewed basic standard for assay validation and quality control practices within

laboratory medicine. Although veterinary diagnostic laboratories are not legally required

to abide these guidelines for human laboratories, validation of this serum amyloid A

ELISA was performed according to CLIA Section 493.1253(b)(2), Non-Waived Test

Modified or Developed In-House.

This section requires assessment of accuracy in comparison to a gold standard,

precision analysis, analytical sensitivity and specificity, linear range of the assay, and

reference interval for healthy individuals. We were unable to assess accuracy of this

ELISA in comparison to a gold standard as there is no other way to measure serum

amyloid A in manatees at this time. Manatee serum SAA concentration was measured in

a linear and proportional manner upon dilution by the Tridelta Phase range SAA ELISA.

Interassay precision analysis across the linear range of the assay showed that the

coefficient of variation remained below 15% which, though higher than the 10% reported

by the manufacturer, is still acceptable according to good laboratory practice standards.

The relatively high coefficient of variation at the high normal reference interval (50

µg/ml) was concerning as the imprecision of the assay may have resulted in incorrect

diagnosis of inflammatory disease. The equivocal reference interval of 50-70 µg/ml

Page 43: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

33

prevents incorrect diagnosis which may result in costly treatment. However, the data is

not of Gaussian distribution. When the population used to generate the reference interval

is analyzed, the median SAA concentration is trace (<10 µg/ml). Additionally, greater

than 80% of the animals had <20 µg/ml SAA. Positive likelihood ratios revealed that a

test result in the equivocal range would be eight times as likely to be found in an animal

with inflammatory disease as a healthy animal.

SAA circulates in blood complexed to lipoprotein, predominantly HDL in

humans.28 HDL binds at the N terminal region of SAA which is also the most conserved

region of the protein and a likely epitope for the monoclonal antibody used in the

sandwich ELISA. Investigation of HDL interaction revealed that measurement of SAA

concentration is proportionally decreased with increasing concentrations of purified

human HDL. This indicates that increased HDL concentration in manatees will likely

result in inaccurate, decreased concentrations of SAA in animals with inflammatory

disease. This warrants concern for false negative results in obese animals and animals

with high HDL concentration.

The predominant protein isolated by Western blot had a mass of approximately 12

kD which is comparable to the mass of SAA of known sequence in other species (11.5 to

12.5 kD). Sequencing of the whole protein was impossible due to N-terminal blocking.

SAA in other species has also been shown to be blocked when sequence attempts by

Edmann degradation were performed.51 There was excellent homology for SAA in

numerous species when partial sequence of the immunopurified protein was

analyzed.(Fig. 3-4)

Page 44: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

34

Sequencing of the complete protein is currently underway. A second, smaller

protein, approximately 3 kD in size, was also isolated during immunopurification and

observed on the SDS PAGE gel. Partial sequence analysis of this protein by Edmann

degradation resulted in an E value greater than 300 and identification was therefore not

possible. We hypothesize that this protein is noncovalently bound to SAA and may have

allosteric interaction that alters binding of SAA to lipoproteins. Further study is

warranted.

In conclusion, the Tridelta Phase range SAA ELISA accurately and precisely

measures SAA concentration in manatee serum and plasma. However, HDL interacts

with SAA such that a clinically significant decrease in SAA concentration is possible in

obese animals.

Page 45: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

35

10 20 30 40 50 60 ....*....|....*....|....*....|....*....|....*....|....*....| consensus 1 GWLSFLKEAAQGAWDMWRAYSDMREANYKNSDKYFHARGNYDAAQRGPGGVWAAKVISDA 60 query 720 GLFSFFKEAIQGTWDLCRAYRDNLRANHQNSDQYFYARGNFEAQQRGSGGVWAAKIISTG 779 Ovis aries 1 QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNG 60 Macaca mulata 2 SWFSFLGEAYDGARDMWRAYSDMKEANYKNSDKYFHARGNYDAAQRGPGGVWAAEVISDA 61 Equus calabus 1 -LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDA 59 Mesocricetus 20 RWFQFMKEAGQGTRDMWRAYTDMREANWKNSDKYFHARGNYDAAQRGPGGAWAAKVISDA 79 auratus Homo sapiens 20 GWLTFLKAAGQGAKDMWRAYSDMKEANYKKSDKYFHARGNYDAVQRGPGGVWATEVISDA 79 Mus muscalus 20 GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDG 79 Mus muscalus 20 GWYSFFREAVQGTWDLWRAYRDNLEANYQNADQYFYARGNYEAQQRGSGGIWAAKIISTS 79 Homo sapiens 20 SWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRS 79 Trichechus manatus

70 80 90 100 110 ....*....|....*....|....*....|....*....|....*....|.. consensus 61 RENFQGLTD-RYLFGISGRGAEDSKADQKANEWGRSGKDPNHFRPPGLPDKY 111 query 780 RKYFQGLMN-RYYFGIRDHGLESLQSTQKAEEWGRSGKDPNHFRPEGLPEKY 830 Ovis aries 61 REALQGITDpLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY 112 Macaca mulata 62 RENIQK---------LLGHGAEDT---------------------------- 76 Equus calabus 60 RENFQRFTD-RFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY 110 Mesocricetus 80 REGFKR---------ITGRGIEDSRADQFANEWGRSGKDPNFFRPPGLPSKY 122 auratus Homo sapiens 80 RENVQR---------LTGDHAEDSLAGQATNKWGQSGKDPNHFRPAGLPEKY 122 Mus muscalus 80 REAFQE---------FFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY 122 Mus muscalus 80 RKYFQGLLN-RYYFGIRNHGLETLQATQKAEEWGRSGKNPNHFRPEGLPEKF 130 Homo sapiens 80 RVYLQGLID-YYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY 130 Trichechus DPNHFRPEGLPDKK manatus

Figure 3-4. Multiple sequence alignment for serum amyloid A from the NCBI bioinformatics database for multiple species showing a highly conserved protein across species. The SAA fragment isolated from manatee serum has high homology for the carboxyl terminal end of the protein.

Page 46: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

CHAPTER 4 FURTHER INVESTIGATION: TWO DIMENSIONAL GEL ELECTROPHORESIS

Manatee plasma proteins were separated, using two dimensional gel

electrophoresis, to identify potential inflammatory proteins for investigation for which no

commercial diagnostic assay is currently available. Manatee A was an adult female with

subacute open wounds due to recent trauma from a boat propeller. Manatees B and C

were healthy adult females. Fifty µg of each labeled protein, mixed with 500 µg of each

unlabeled manatee plasma protein, was focused in a pH 3 to 10 non linear IPG strip. The

proteins contained in this strip were then analyzed with 8 to 16% Tris Glycine SDS

PAGE. Two overlays of the two dimensional gel electrophoresis manatees B and C

plasma and manatee A plasma revealed the same four distinct red, Cy-5 labeled proteins.

One isoform separated at approximately 35 kD and three other proteins separated at

approximately 15, 16, and 18 kD. These proteins will be sequenced using Edmann

chemistry.

36

Page 47: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

37

a) Coomassie Brilliant Blue –Control Manatee B

160

105

75

50

35

3025

1510

250 + -

kDa

b) Control Manatee B+ -

160

105

75

50

35

30

25

250

1015

kDa

c) Diseased Manatee A

160

105

75

50

35

30

25

250+ -

1015

kDa

+ -160

105

75

50

35

30

25

250

1015

d) Overlay of Diseased and Healthy Manatees

kDa

Figure 4-1. Two dimensional gel electrophoresis of apparently healthy versus diseased

manatee. a) Coomassie brilliant blue stained blot after proteins were transblotted from scanned gel to PVDF membrane. b) Control manatee (B), labeled with Cy-3, is green in color. c) Experimental manatee (A) is labeled with Cy-5 and is red. d) Overlay of the healthy and diseased animal reveals proteins that are unique to the disease animals are red. Proteins that are present in both healthy and diseased animals are yellow.

Page 48: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

38

a) Coomassie Brilliant Blue –Control Manatee C

160

105

75

50

35

30

25

1510

+ -

kDa

b) Healthy Manatee C

160

105

75

50

35

30

25

1510

+ -

kDa

c) Diseased Manatee A

160

105

75

50

35

30

25

1510

+ -

kDa

d) Overlay of apparently healthy manatee Cand diseased manatee A

160

105

75

50

35

30

25

1510

250 + -

Figure 4-2. Two dimensional gel electrophoresis of apparently healthy versus diseased

manatee. a) Coomassie brilliant blue stained blot after proteins were transblotted from scanned gel to PVDF membrane. b) Control manatee (C), labeled with Cy-3, is green in color. c) Experimental manatee (A) is labeled with Cy-5 and is red. d) Overlay of the healthy and diseased animal reveals proteins that are unique to the disease animals are red. Proteins that are present in both healthy and diseased animals are yellow.

Page 49: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

CHAPTER 5 SUMMARY

This study examined the innate, inflammatory, acute phase response in manatees to

determine a practical approach for inflammatory disease diagnosis. An immunoassay to

measure SAA, as well as assays to measure haptoglobin, fibrinogen, and A:G ratio, were

found to be potentially useful in manatees. These assays were assessed in a large

population of healthy and diseased manatees for diagnostic sensitivity and specificity.

SAA and plasma A:G ratio were the most sensitive and specific indicators of

inflammatory disease. SAA appears to be a major acute phase protein in manatees that

increases acutely by 50 to 100 fold from trace concentrations and decreases quickly after

resolution of inflammation. Haptoglobin and fibrinogen appear to be moderate acute

phase proteins with a less dramatic and lingering increase in concentration over time.

SAA sandwich ELISA validation revealed a precise and accurate method within the

linear range of <10->120µg/ml. Analytical specificity assessment showed an interaction

with human HDL results in decreased SAA concentration. This indicates that the

physiology of SAA in manatees is likely similar to humans. SAA circulates in blood

complexed to lipoprotein, predominantly HDL in humans.28 HDL binds at the N terminal

region which is also the most conserved region of the protein and a likely epitope for the

monoclonal antibody used in the sandwich ELISA. Investigation of HDL interaction

revealed that measurement of SAA concentration is proportionally decreased with

increasing concentrations of purified human HDL. This indicates that increased HDL

concentration in manatees will likely result in inaccurate, decreased concentrations of

39

Page 50: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

40

SAA in animals with inflammatory disease. This may result in false negative results in

obese animals and animals with high HDL concentration. Comparison of paired serum to

plasma samples revealed no interaction. The ability to use plasma is practical in that the

same volume of manatee blood will yield approximately twice as much plasma as serum.

Stability over time at varying temperatures was not assessed in this study.

Manufacturer data shows this is a well conserved protein that is highly stable when

frozen for at least three years and is minimally affected by freeze thaw cycles.

Analysis of the protein isolated by the ELISA revealed the predominant protein,

isolated by Western blot, had a mass of approximately 12 kD. This is comparable to the

mass of SAA of known sequence in other species (11.5 to 12.5 kD). Sequence of the

whole protein was impossible by Edman degradation due to N-terminal blocking. SAA

in other species has also been shown to be blocked when sequence attempts by Edmann

degradation were performed.51 When partial sequence of the immunopurified protein

was analyzed, there was excellent homology for SAA in numerous species. Complete

sequence of the protein is planned.

Manatee plasma proteins were separated by two dimensional gel electrophoresis to

identify potential inflammatory proteins for which no commercial diagnostic assay is

currently available. Two overlays of the two dimensional gel electrophoresis of each

control animal's plasma and the boat struck manatee's plasma revealed the same four

distinct, red, Cy-5 labelled proteins. One isoform separated at approximately 35 kD and

three other proteins were separated at approximately 15, 16, and 18 kD. These proteins

will be sequenced using Edmann chemistry.

Page 51: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

41

In conclusion, this study successfully accomplished all specific aims set out in the

original master's proposal by identifying and validating an inflammatory disease marker

that can be analyzed by available commercial diagnostics as well as identifying other

potential proteins for inflammatory disease diagnosis.

Page 52: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

LIST OF REFERENCES

1. Hulten C, Demmers S. Serum amyloid A (SAA) as an aid in the management of infectious disease in the foal: comparison with total leucocyte count, neutrophil count and fibrinogen. Equine Vet J. 2002;34:693-698.

2. Hulten C, Sandgren B, Skioldebrand E, Klingeborn B, Marhaug G, Forsberg M. The acute phase protein serum amyloid A (SAA) as an inflammatory marker in equine influenza virus infection. Acta Vet Scand. 1999;40:323-333.

3. Toussaint MJM, Ederen AM, Gruys E. Implication of clinical pathology in assessment of animal health and in animal production and meat inspection. Comp Haematol Int. 1995;5:149-157.

4. Johnson AL, Rohlfs EM, Silverman LM. Proteins. In: Burtis CA, Ashwood E, eds. Tietz Fundamentals of Clinical Chemistry. Philadelphia: WB Saunders;2001:325-351.

5. Nunokawa Y, Fujinaga T, Taira T, Okumura M, Yamashita K, Tsunoda N, Hagio M. Evaluation of serum amyloid A protein as an acute-phase reactive protein in horses. J Vet Med Sci. 1993;55:1011-1016.

6. Eckersall PD, Young FJ, McComb C, Hogarth CJ, Safi S, Weber A, McDonald T, Nolan AM, Fitzpatrick JL. Acute phase proteins in serum and milk from dairy cows with clinical mastitis. Vet Rec. 2001;148:35-41.

7. Hirvonen J, Huszenicza G, Kulcsar M, Pyorala S. Acute-phase response in dairy cows with acute postpartum metritis. Theriogenology. 1999;51:1071-1083.

8. Uchida E, Katoh N, Takahashi K. Appearance of haptoglobin in serum from cows at parturition. J Vet Med Sci. 1993;55:893-894.

9. Yoshino K, Katoh N, Takahashi K, Yuasa A. Possible involvement of protein kinase C with induction of haptoglobin in cows by treatment with dexamethasone and by starvation. Am J Vet Res. 1993;54:689-694.

10. Burton SA, Honor DJ, Mackenzie AL, Eckersall PD, Markham RJ, Horney BS. C-reactive protein concentration in dogs with inflammatory leukograms. Am J Vet Res. 1994;55:613-618.

42

Page 53: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

43

11. Yamamoto S, Shida T, Miyaji S, Santsuka H, Fujise H, Mukawa K, Furukawa E, Nagae T, Naiki M. Changes in serum C-reactive protein levels in dogs with various disorders and surgical traumas. Vet Res Commun. 1993;17:85-93.

12. Ablij H, Meinders A. C-reactive protein: history and revival. Eur J Intern Med. 2002;13:412.

13. Piafsky KM, Woolner EA. The binding of basic drugs to alpha-acid glycoprotein in cord serum. J Pediatr. 1982;100:820-822.

14. Bossart GD. Manatees. In: Dierauf LA, Gulland FMD, eds. CRC Handbook of Marine Mammal Medicine. New York: CRC Press;2001:939-958.

15. Gauldie J, Lamontagne L, Stadnyk A. Acute phase response in infectious disease. Surv Synth Pathol Res. 1985;4:126-151.

16. Pannen BH, Robotham JL. The acute-phase response. New Horiz. 1995;3:183-197.

17. Morlese JF, Forrester T, Jahoor F. Acute-phase protein response to infection in severe malnutrition. Am J Physiol. 1998;275:E112-E117.

18. Hirvonen J, Pyorala S, Jousimies-Somer H. Acute phase response in heifers with experimentally induced mastitis. J Dairy Res. 1996;63:351-360.

19. Heegaard PM, Godson DL, Toussaint MJ, Tjornehoj K, Larsen LE, Viuff B, Ronsholt L. The acute phase response of haptoglobin and serum amyloid A (SAA) in cattle undergoing experimental infection with bovine respiratory syncytial virus. Vet Immunol Immunopathol. 2000;77:151-159.

20. McNair J, Elliott CT, Mackie DP. Development of a sensitive and specific time resolved fluorimetric immunoassay for the bovine acute phase protein haptoglobin (Hp). J Immunol Methods. 1995;184:199-205.

21. Heegaard PM, Klausen J, Nielsen JP, Gonzalez-Ramon N, Pineiro M, Lampreave F, Alava MA. The porcine acute phase response to infection with Actinobacillus pleuropneumoniae. Haptoglobin, C-reactive protein, major acute phase protein and serum amyloid A protein are sensitive indicators of infection. Comp Biochem Physiol B Biochem Mol Biol. 1998;119:365-373.

22. Hulten C, Sandgren B, Skioldebrand E, Klingeborn B, Marhaug G, Forsberg M. The acute phase protein serum amyloid A (SAA) as an inflammatory marker in equine influenza virus infection. Acta Vet Scand. 1999;40:323-333.

23. Doumas B, Watson W, Biggs H. Albumin standards and the measurement of serum albumin with bromcresol green. Clin Chem Acta. 1971;31:87-96.

Page 54: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

44

24. Thomas JS. Overview of Plasma Proteins. In: Feldman BF, Zinkl JG, Jain NC, eds. Schalm's Veterinary Hematology. Philadelphia: Lippincott Williams and Wilkins;2000:891-898.

25. Smith RD. Veterinary Clinical Epidemiology. New York: CRC Press, 1995.

26. Farver T. Concepts of Normality in Clinical Biochemistry. In: Kaneko JJ, Harvey J.W., Bruss ML, eds. Clinical Biochemistry of Domestic Animals. New York: Academic Press;1998:1-19.

27. Jensen LE, Hiney MP, Shields DC, Uhlar CM, Lindsay AJ, Whitehead AS. Acute phase proteins in salmonids: evolutionary analyses and acute phase response. J Immunol. 1997;158:384-392.

28. Uhlar CM, Whitehead AS. Serum amyloid A, the major vertebrate acute-phase reactant. Eur J Biochem. 1999;265:501-523.

29. Liang JS, Sipe JD. Recombinant human serum amyloid A (apoSAAp) binds cholesterol and modulates cholesterol flux. J Lipid Res. 1995;36:37-46.

30. Lindhorst E, Young D, Bagshaw W, Hyland M, Kisilevsky R. Acute inflammation, acute phase serum amyloid A and cholesterol metabolism in the mouse. Biochim Biophys Acta. 1997;1339:143-154.

31. Migita K, Kawabe Y, Tominaga M, Origuchi T, Aoyagi T, Eguchi K. Serum amyloid A protein induces production of matrix metalloproteinases by human synovial fibroblasts. Lab Invest. 1998;78:535-539.

32. Strissel KJ, Girard MT, West-Mays JA, Rinehart WB, Cook JR, Brinckerhoff CE, Fini ME. Role of serum amyloid A as an intermediate in the IL-1 and PMA-stimulated signaling pathways regulating expression of rabbit fibroblast collagenase. Exp Cell Res. 1997;237:275-287.

33. Badolato R, Wang JM, Murphy WJ, Lloyd AR, Michiel DF, Bausserman LL, Kelvin DJ, Oppenheim JJ. Serum amyloid A is a chemoattractant: induction of migration, adhesion, and tissue infiltration of monocytes and polymorphonuclear leukocytes. J Exp Med. 1994;180:203-209.

34. Xu L, Badolato R, Murphy WJ, Longo DL, Anver M, Hale S, Oppenheim JJ, Wang JM. A novel biologic function of serum amyloid A. Induction of T lymphocyte migration and adhesion. J Immunol. 1995;155:1184-1190.

35. Badolato R, Wang JM, Stornello SL, Ponzi AN, Duse M, Musso T. Serum amyloid A is an activator of PMN antimicrobial functions: induction of degranulation, phagocytosis, and enhancement of anti-Candida activity. J Leukoc Biol. 2000;67:381-386.

Page 55: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

45

36. Nunokawa Y, Fujinaga T, Taira T, Okumura M, Yamashita K, Tsunoda N, Hagio M. Evaluation of serum amyloid A protein as an acute-phase reactive protein in horses. J Vet Med Sci. 1993;55:1011-1016.

37. Staruch MJ, Wood DD. Reduction of serum Interleukin-1-like activity after treatment with dexamethasone. J Leukoc Biol. 1985;37:193-207.

38. de Villiers WJ, Louw JP, Strachan AF, Etsebeth SM, Shephard EG, de Beer FC. C-reactive protein and serum amyloid A protein in pregnancy and labour. Br J Obstet Gynaecol. 1990;97:725-730.

39. Sipe JD. Serum amyloid A: from fibril to function. Current status. Amyloid. 2000;7:10-12.

40. Stokol T, Tarrant JM, Scarlett JM. Overestimation of canine albumin concentration with the bromcresol green method in heparinized plasma samples. Vet Clin Pathol. 2001;30:170-176.

41. Johnson AM, Rohlfs EM, Silverman LM. Proteins. In: Burtis CA, Ashwood ER, eds. Tietz Fundamentals of Clinical Chemistry. Philadelphia, PA: W.B. Saunders, Co.;2001:325-351.

42. Morimatsu M, Sarikaputi M, Syuto B, Saito M, Yamamoto S, Naiki M. Bovine haptoglobin: single radial immunodiffusion assay of its polymeric forms and dramatic rise in acute-phase sera. Vet Immunol Immunopathol. 1992;33:365-372.

43. Conner JG, Eckersall PD, Doherty M, Douglas TA. Acute phase response and mastitis in the cow. Res Vet Sci. 1986;41:126-128.

44. Eckersall PD, Young FJ, McComb C, Hogarth CJ, Safi S, Weber A, McDonald T, Nolan AM, Fitzpatrick JL. Acute phase proteins in serum and milk from dairy cows with clinical mastitis. Vet Rec. 2001;148:35-41.

45. Uchida E, Katoh N, Takahashi K. Appearance of haptoglobin in serum from cows at parturition. J Vet Med Sci. 1993;55:893-894.

46. Hirvonen J, Huszenicza G, Kulcsar M, Pyorala S. Acute-phase response in dairy cows with acute postpartum metritis. Theriogenology. 1999;51:1071-1083.

47. Bossart GD, Reynolds JE, Dierauf LA, Duffield DA. Clinical Pathology. In: Dierauf LA, Gulland FMD, eds. CRC Handbook of Marine Mammal Medicine. Boca Raton, FL: CRC Press;2001:383-436.

48. Bossart GD, Ewing RY, Lowe M, Sweat M, Decker SJ, Walsh CJ, Ghim SJ, Jenson AB. Viral papillomatosis in Florida manatees (Trichechus manatus latirostris). Exp Mol Pathol. 2002;72:37-48.

Page 56: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

46

49. Harr KE, Harvey J.W., Bonde RK, Murphy D, Lowe M, Menchaca M, Haubold E, Francis-Floyd R, . Comparison of Methdos Used to Diagnose Generalized Inflammatory Disease in Manatees (Trichechus manatus latirostris). J Zoo Wildl Med. 2004.

50. Jeno P, Mini T, Moes S, Hintermann E, Horst M. Internal sequences from proteins digested in polyacrylamide gels. Anal Biochem. 1995;224:75-82.

51. Mensua C, Carrasco L, Bautista MJ, Biescas E, Fernandez A, Murphy CL, Weiss DT, Solomon A, Lujan L. Pathology of AA amyloidosis in domestic sheep and goats. Vet Pathol. 2003;40:71-80.

Page 57: DIAGNOSIS OF SYSTEMIC INFLAMMATORY DISEASE IN MANATEES …ufdcimages.uflib.ufl.edu/UF/E0/00/31/20/00001/harr_k.pdf · 2010. 4. 30. · Manatees (Trichechus manatus latirostris) are

BIOGRAPHICAL SKETCH

Dr. Kendal Harr is the daughter of Alma and Kenneth Harr. She was born in 1969

and raised in Glen Cove, Long Island, New York. Dr. Harr obtained her B.S. from

Cornell University, Ithaca, New York, in 1990, majoring in animal science and minoring

in marine biology. She graduated from the College of Veterinary Medicine, Cornell

University, in 1995 with a D.V.M. Following three years in small animal practice, Dr.

Harr subsequently completed a residency training program in clinical pathology at the

University of Florida, Gainesville, Florida. She is a Diplomate of the American College

of Veterinary Pathology. She has two beautiful daughters, Maeve and Lillian, and a

wonderful husband, Darryl.

47


Recommended