+ All Categories
Home > Documents > Holoproesencephaly

Holoproesencephaly

Date post: 25-Feb-2016
Category:
Upload: peers
View: 40 times
Download: 3 times
Share this document with a friend
Description:
Holoproesencephaly. Holoprosencephaly. First described in 1963 Failure of proper formation of the midline structures of the forebrain is the common feature of the many variant forms. Occurs in about 1/10,000 liveborn infants but is much more frequent in prenatal studies. Etiology of HPE. - PowerPoint PPT Presentation
Popular Tags:
32
Holoproesencephaly
Transcript
Page 1: Holoproesencephaly

Holoproesencephaly

Page 2: Holoproesencephaly

HoloprosencephalyHoloprosencephaly

• First described in 1963First described in 1963• Failure of proper formation of the midline Failure of proper formation of the midline

structures of the forebrain is the common structures of the forebrain is the common feature of the many variant forms.feature of the many variant forms.

• Occurs in about 1/10,000 liveborn infants Occurs in about 1/10,000 liveborn infants but is much more frequent in prenatal but is much more frequent in prenatal studies.studies.

Page 3: Holoproesencephaly

Etiology of HPEEtiology of HPE

• Chromosomal Chromosomal • Teratogens Teratogens • SyndromesSyndromes• Single gene disordersSingle gene disorders

Page 4: Holoproesencephaly

Famous Teratogens

• Alcohol• Cyclopamine

Page 5: Holoproesencephaly

HPE GenesHPE Genes

• Sonic Hedgehog (SHH); chromosome 7Sonic Hedgehog (SHH); chromosome 7• ZIC2 (chromosome 13q32)ZIC2 (chromosome 13q32)• SIX3; chromosome 2SIX3; chromosome 2• TGIF, chromosome 18TGIF, chromosome 18• OthersOthers

Page 6: Holoproesencephaly
Page 7: Holoproesencephaly
Page 8: Holoproesencephaly
Page 9: Holoproesencephaly

QuickTime™ and aTIFF (LZW) decompressor

are needed to see this picture.

Page 10: Holoproesencephaly
Page 11: Holoproesencephaly
Page 12: Holoproesencephaly
Page 13: Holoproesencephaly

Alobar HPE. (A) lack of separation of the two hemispheres. Large dorsal cyst (dc) posteriorly. (B) reveals a midline ventricle, a monoventricle (mv), that communicates posteriorly with the dorsal cyst (dc).

Page 14: Holoproesencephaly

Semilobar HPE. (C) separation of the hemispheres posteriorly but not anteriorly. There is incomplete separation of the basal ganglia. (D) reveals a lack of interhemispheric fissureand a monoventricle (mv)

Page 15: Holoproesencephaly

Lobar HPE. (E) reveals that two hemispheres are separated by an interhemispheric fissure both anteriorly and posteriorly. (F) documents incomplete separation of the inferior frontal lobes near the midline.

Page 16: Holoproesencephaly
Page 17: Holoproesencephaly
Page 18: Holoproesencephaly

Face Predicts the Brain

• ~85% of HPE cases are associated with facial malformation of various types.

• Thus, brain imaging in the context of facial malformation is a good idea.

• Nonetheless, brain malformation can be severe even with a relatively normal face.

Page 19: Holoproesencephaly
Page 20: Holoproesencephaly

13q32 deletion in a fetus in which HPE was the only malformation.

Page 21: Holoproesencephaly
Page 22: Holoproesencephaly

Alobar HPE and alanine Alobar HPE and alanine tract expansion in 2 sibs. tract expansion in 2 sibs. Father is a mosaic carrier Father is a mosaic carrier

of the mutation.of the mutation.

Page 23: Holoproesencephaly
Page 24: Holoproesencephaly

De-novo 7 BP deletion in zinc finger De-novo 7 BP deletion in zinc finger region. Alobar HPE.region. Alobar HPE.

Page 25: Holoproesencephaly
Page 26: Holoproesencephaly

12 AA in frame deletion near carboxy terminus. 12 AA in frame deletion near carboxy terminus. Interhemispheric fusion defect. Interhemispheric fusion defect.

Page 27: Holoproesencephaly

De-novo alanine De-novo alanine tract expansion.tract expansion.Semi-lobar HPESemi-lobar HPE

Page 28: Holoproesencephaly

BirthBirth 21 Months21 Months

De-novo 2 base deletion at AA 365. Stop at De-novo 2 base deletion at AA 365. Stop at 366. Semi-lobar HPE.366. Semi-lobar HPE.

Page 29: Holoproesencephaly

Aspartic acid to Aspartic acid to Phenylalanine Phenylalanine change caused change caused by 2 base change. by 2 base change. Lobar HPE. Lobar HPE. Inherited from Inherited from mother who is mother who is normal except for normal except for hypotelorism.hypotelorism.

Page 30: Holoproesencephaly

De-novo single base deletion at De-novo single base deletion at AA 312. Stop at 413. Semi-AA 312. Stop at 413. Semi-lobar HPE.lobar HPE.

Page 31: Holoproesencephaly

#10. “AG” deletion

1 MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF 60

61 KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL 120

121 FRSARLPGTSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQM 180

181 RLGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHH 240

241 PGAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSN 300

301 HVCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTG 360

361 EKPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSP 420

421 QGSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGG 480

481 SGSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV* 534

#9. “G” deletion #1. 56 bp insertion

#8. 7 bp deletion

#2. “C” insertion #3,4,5,6,7,13 and 14.Alanine tract expansion

Amino acid sequence of ZIC2 with summary of HPE associated mutations. Numbersrefer to the table of mutation patients. Bold type indicates the zinc fingerregion of the protein.

#11. “G” deletion

12. 12 aa deletion

#15. D to F change

#16. 2 bp deletion

Page 32: Holoproesencephaly

Day 15 coronal sections Day 15 coronal sections showing HPE like showing HPE like malformation in Zic2 mutant malformation in Zic2 mutant mice.mice.

From Nagai et al., PNAS, March 2000From Nagai et al., PNAS, March 2000