+ All Categories
Home > Documents > IGF-1 | What is it?

IGF-1 | What is it?

Date post: 07-Aug-2018
Category:
Upload: rasa-research
View: 214 times
Download: 0 times
Share this document with a friend
7
 What is IGF-1?
Transcript

8/19/2019 IGF-1 | What is it?

http://slidepdf.com/reader/full/igf-1-what-is-it 1/7

 What is IGF-1?

8/19/2019 IGF-1 | What is it?

http://slidepdf.com/reader/full/igf-1-what-is-it 2/7

Overview of IGF-1

IGF-1  (Insulin-like growth factor 1), also called Somatomedin 1, IGFIGF-IA, and mechano growth factor, was named for its close re

proinsulin. IGF-1 is encoded by the IGF1 gene.

IGF-1 is comprised of 70 amino acids with a molecular weight of 7649acid sequence is GPETLCGAEL VDALQFVCGD RGFYFNKPTGYGSTGIVDECCFR SCDLRRLEMY CAPLKPAKSA. It is known as an importa

growth throughout the lifecycle of mammals.

8/19/2019 IGF-1 | What is it?

http://slidepdf.com/reader/full/igf-1-what-is-it 3/7

How it Works

IGF-1 is most commonly generated by the liver in response to produchormone by the pituitary gland, but it can be produced in the fetus anfor localized purposes.

It has been shown to play a critical role in cell growth, apoptosis (prdeath), cell division, and the transfer of glucose across cell membranesit is found to have the opposite effect on adipose (fat) tissue.

IGF-1 inhibits the growth of adipose tissue while restricting glucose trencourages the body to burn adipose tissue for energy.

8/19/2019 IGF-1 | What is it?

http://slidepdf.com/reader/full/igf-1-what-is-it 4/7

 About IGF-1 LR3

Long arginine 3-IGF-1, also called Long r3 IGF-1, LR3 IGF, IGF1 LR3, Lo1, is a synthetic version of IGF-1. It differs from IGF-1 by having an adamino acids at its N-terminus making it 83 amino acids.

There is also a substitution in the corresponding IGF-1 third position ofor an arginine. It has a molecular weight of 9105.4 Da. It’s amino acid MFPAMPLSSL FVNGPRTLCG AELVDALQFVCGDRGFYFNK PTGYGS

APQTGIV DEC CFRSCDLRRL EMYCAPLKPA KSA.

The difference in chemical composition makes the ability to bind to IG

efficient. The result is a 2.5 times increase in potency. Additionally, it hhalf-life of 20-30 hours.

8/19/2019 IGF-1 | What is it?

http://slidepdf.com/reader/full/igf-1-what-is-it 5/7

 About IGF-1 DES 

DES (1-3) IGF-1, also named IGF-1 Des (1-3), IGF-1 Des 1-3, is anotherthat occurs naturally and synthetically. It is missing the first three aminthe IGF-1 amino acid chain.

It is composed of 67 amino acids and has a molecular weight of 7360.5acid sequence is TLCGAELVDA LQFVCGDRGF YFNKPTGYGSSSRRAPQTGIVDECCFRSCD LRRLEMYCAP LKPAKSA.

The missing amino acids make it less effective at binding to IGF protbecause of the glutamate amino acid missing from position 3. The

difference makes it 10x more potent than IGF-1.

8/19/2019 IGF-1 | What is it?

http://slidepdf.com/reader/full/igf-1-what-is-it 6/7

Get Started on Researching 

IGF-1, and its variants, are essential for regular growth in mam

development of muscle mass later in life. They have wide clinical u

induce different physical and muscle developmental issues. Rasa

proud to be provide these peptides for purchase for research purpos

Our chemical pr

intended for labo

8/19/2019 IGF-1 | What is it?

http://slidepdf.com/reader/full/igf-1-what-is-it 7/7

Buying Peptides &Research Liquids

Our chemical products are only

intended for laboratory research

https://rasaresearch.com/what-is-igf-1/ 


Recommended