+ All Categories
Home > Documents > Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr....

Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr....

Date post: 15-Jan-2016
Category:
Upload: bilal-hatfield
View: 217 times
Download: 0 times
Share this document with a friend
Popular Tags:
15
Investigation Team: Prof. C.O.N. Ikeobi Investigation Team: Prof. C.O.N. Ikeobi , , Prof. M.O. Ozoje, Dr. A.O. Talabi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED PRESENTED BY BY Prof. C.O.N IKEOBI Prof. C.O.N IKEOBI Department of Animal Breeding and Department of Animal Breeding and Genetics, Genetics, College of Animal Science and Livestock College of Animal Science and Livestock Production Production MOLECULAR SCREENING OF MHC RESISTANCE GENES IN WEST AFRICAN DWARF GOATS An IFSERAR- sponsored project Research Project Number: UNAAB/IFSERAR/IGR47
Transcript
Page 1: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

Investigation Team: Prof. C.O.N. IkeobiInvestigation Team: Prof. C.O.N. Ikeobi, , Prof. M.O. Ozoje, Dr. Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. ImumorinA.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin

PRESENTED PRESENTED BY BY

Prof. C.O.N IKEOBIProf. C.O.N IKEOBIDepartment of Animal Breeding and Department of Animal Breeding and

Genetics,Genetics,College of Animal Science and Livestock College of Animal Science and Livestock

ProductionProduction

MOLECULAR SCREENING OF MHC RESISTANCE GENES IN WEST AFRICAN

DWARF GOATSAn IFSERAR- sponsored project

Research Project Number: UNAAB/IFSERAR/IGR47

Page 2: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

INTRODUCTIONINTRODUCTIONNigeria’s population currently estimated at 140 million

is the most populous in Africa, commanding a ratio of one in five Africans and growing at 2-3% annually.

It is estimated that livestock farming and herding accounts for about 10% of Nigeria’s Gross Domestic Product.

Goats make substantial contributions to the subsistence sector of the economy in very many ways, most notable of which includes being easily adaptable to small-holder and subsistence management on account of small size, low-input management based on browsing rather than grazing in addition to being trypanotolerant in the Nigeria’s sub-humid and humid tropical climates characterized by high prevalence of tse-tse flies.

Page 3: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

Despite these advantages, little attention had been paid to the genetic characterization and possible improvement of goats in Nigeria.

Adu et al. (1979) studied reproductive performance and Buvanendran et al. (1981) and Moruppa (1985) reported on goat haemoglobin and transferrin alleles.

These were followed more recently with other reports by Ebozoje and Ngere (1995), Odubote and Akinokun (1992), Odubote (1994) and Imumorin et al. (1999).

The major histocompatibility complex (MHC) plays an important role in the adaptive immune response of vertebrates (Trowsdale, 1993).

The MHC is an organized cluster of tightly linked genes with immunological and non-immunological functions, and is present in all vertebrates, except in jawless fish (Tizard, 2004).

Page 4: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

The primary function of the MHC is to code for specialized antigen-presenting receptor glycoproteins.

These molecules bind processed peptide antigens and present them to T lymphocytes, thereby triggering immune responses.

The genes encoding these molecules are polymorphic, and in sheep, goats and cattle, high levels of polymorphism are observed in both the DRB and DQA genes (Ellis and Ballingall, 1999).

The major aim of this study is to carry out a molecular screening of MHC resistance genes in West African Dwarf Goats.

Page 5: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

OBJECTIVESOBJECTIVESBROAD OBJECTIVEMolecular Screening of MHC Resistance

gene in West African Dwarf Goats.SPECIFIC OBJECTIVESTo clone, characterize and sequence MHC genes in

West Africa Dwarf goatsTo identify genetic variants in MHC genes in West

African Dwarf goatsTo determine the association of MHC genotypes and

quantitative traits in West African Dwarf goats as potential tools for marker-assisted selection.

Page 6: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

MATERIALS AND METHODSMATERIALS AND METHODSStudy Area.Study Population: 200 WAD goats were sampled. Data Collection: Data on both qualitative and

quantitative traits as well as Heat stress data were collected on each animal.

Blood Collection

10ml= 5ml(EDTA)+ 5ml(Heparinised)

(DNA) ( Serum Analysis)

DNA extraction was carried out using Zymobead genomic DNA extraction kits.

Page 7: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

Primers: Primer3 was used to design the primer. This was then ordered from the Bioneer Primers.

The Primer’s sequence for DRB 1 is

A-T = Annealing temperature; bp = base pairs

Genes Primers A-T Product Ref.

DRB 1 F: TATCCCGTCTCTGCAGCACATTTCR: TCGCCGCTGCACACTGAAACTCTC

60oC 570 bp Amills et al. (1995)

Page 8: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

PCR: PCR master mix from Bioneer was also used for the reaction.

These primers were used in a PCR consisting of 30 cycles of: 94 C for 1 min, 60 0C for 1min and 72 0C for 1 min. Reactions were performed in 20 ml total volume.

Agarose gel electrophoresis was performed using 1.5% agarose.

The bands were snapped with the aid of a gel documentation system.

The remaining PCR products were send to Cornell University core laboratory for sequencing.

Page 9: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

The results of the sequence was used to design the restriction enzyme that will make a cut in the sequence using NEBCUTTER

(an online tool).The resulting bands from the digested product was

then genotyped manually to know whether the animal was homozygous or heterozygous for the DRB gene.

HpyAV 5'... C C T T C (N)6 ... 3' 3'... G G A A G (N)5 ... 5'

Helicobacter pylori 26695

Page 10: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

RESULTSRESULTS In the sequence, it was discovered that the sequence

is in exon 2 of the DRB gene in Capra hircus.Contig or consensus sequence

GGGTGCGGTTCCTGGACAGATACTTCTATAATGGACAAGAGACGTGCGCTACGACAGCGACTGGGGCGAGTTCCGGGCGGTGGCCGAGCTGGGGCGGCCGGACGCCAAGTACTGGAACAGCCAGAAGGAGATCCTGGAGGACAGGCGGRCCGAGGTGGACACGTTCTGCAGACACAACTACGGGGTCATTGAGAGTTTCAGTGTGCAGCGGCGAA.

Protein translationAmino acid sequence

VRFLDRYFYNGQEYVRYDSDWGEFRAVAELGRPDAKYWNSQKEILEDRRXEVDTFCRHNYGVIESFSVQRR

Page 11: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

Amino acid sequence with nucleic acidsGTGCGGTTCCTGGACAGATACTTCTATAATGGACAAGAGTACGTGCGCTACGACAGCGA

C V  R  F  L  D  R  Y  F  Y  N  G  Q  E  Y  V  R  Y  D  S  D 

TGGGGCGAGTTCCGGGCGGTGGCCGAGCTGGGGCGGCCGGACGCCAAGTACTGGAACAGC W  G  E  F  R  A  V  A  E  L  G  R  P  D  A  K  Y  W  N  S 

CAGAAGGAGATCCTGGAGGACAGGCGGRCCGAGGTGGACACGTTCTGCAGACACAACTAC Q  K  E  I  L  E  D  R  R  X  E  V  D  T  F  C  R  H  N  Y GGGGTCATTGAGAGTTTCAGTGTGCAGCGGCGA G  V  I  E  S  F  S  V  Q  R  R 

Page 12: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

Protein BLAST (Basic Local Alignment Search Tool)

>dbj|BAA23121.1| - accession number in gene bank

 MHC class II DRB [Capra hircus]Length=89, Score = 124 bits (312), Expect = 1e-

34, Method: Compositional matrix adjust. Identities = 57/71 (81%), Positives = 64/71 (91%),

Gaps = 0/71 (0%)

Page 13: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

GEL PICTURE AND SAMPLES WITH RESTRICTION GEL PICTURE AND SAMPLES WITH RESTRICTION ENZYMESENZYMES

WADRS

SH

WAD

Page 14: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

ReferencesReferencesBuvanendran, V, Sooriyamoorthy, T, Ogunsusi, RA and

Adu IF. 1981. Haemoglobin polymorphism and resistance to helminths in red sokoto goats. Trop. Anim. Hlth. Prod. 13: 217 – 21.

Ebozoje, MO and Ngere, LO 1995. Genetic analysis of preweaning growth in West African Dwarf goats and their half-breds. Inter J. Anim Sci. 10: 247 – 251.

Ellis, S.A, and K.T.Ballingall. 1999. Cattle MHC: Evolution in action? Immunol. Rev. 167:159-168.

Tizard, I.R. 2004. Acquired Immunity: antigen-presenting receptors. In: Veterinary Immunology: an

introduction, Elsevier, Philadelphia, PA, USA, 67-77.Trowsdole J. 1993. Genomic structure and function in the

MHC. Trends genet 9:117- 122.

Page 15: Investigation Team: Prof. C.O.N. Ikeobi, Prof. M.O. Ozoje, Dr. A.O. Talabi, Dr. M. Okpeku and Dr. I.G. Imumorin PRESENTED BY Prof. C.O.N IKEOBI Department.

THANKS FOR

LISTENING


Recommended