Date post: | 07-Jul-2018 |
Category: |
Documents |
Upload: | thomas-jones |
View: | 219 times |
Download: | 0 times |
of 34
8/18/2019 Lecture 10 - The Structure of Proteins
1/34
The Structure of Proteins
Head of Medusa Caravaggio, 1599
8/18/2019 Lecture 10 - The Structure of Proteins
2/34
Proteins are polymers of Amino acids
Last day we considered the structure and chemical characteristics of amino acids.
Today we will examine how they polymerize together and form higher order structure.
H3N – C – C
O
O-
H
R
–
–+ The
zwitterionic form of
an amino acid
C = the alpha (α) Carbon
8/18/2019 Lecture 10 - The Structure of Proteins
3/34
H3N – C – C
O
O
-
H
R1
–
–+
N – C – C
O
O
-
H
R2
–
–+
H3N – C – C
O
H
H
R1
= –
–+
+ – H
H
N – C – CO
O-
H
R2
–
–H –
– + H2O
Amino acid polymerization
• the peptide bond forms via a condensation or dehydration reaction.
the peptide bond
8/18/2019 Lecture 10 - The Structure of Proteins
4/34
A more accurate depiction from your textbook:
• it depicts the COO- charge as de-localized over the entire group
• both the H atom and R groups are opposite of the carbonyl O atom to avoid stericclash
8/18/2019 Lecture 10 - The Structure of Proteins
5/34
The Primary (1o) Structure of Proteins
• primary structure of protein refers to the sequence of amino acids in the protein, as
specified by the gene sequence encoding the protein
• most proteins consist of between 50 to 2000 amino acids
• the largest known protein is titin, a muscle protein consisting of 27,000 amino acids
• amino acid polymers of less than 50 amino acids are often called peptides though
there is no strict cut off between the terms peptide and protein
• the α Carbon of each amino acid can always be recognized since the R group
is attached
• the peptide bond occurs between the carbonyl group of the first amino acid and the
amine group of the next amino acid
8/18/2019 Lecture 10 - The Structure of Proteins
6/34
Identify the α Carbon and the Side chain (R group) of each amino acid in this
five amino acid peptide.
Locate each peptide bond in the peptide.
Note that every peptide or protein begins with the amino group of the first
amino acid and ends with the carboxyl group of the last amino acid.
Thus we refer to the start of a protein as the Amino terminus or N-terminus
and the end of a protein as the Carboxyl terminus or C-terminus
8/18/2019 Lecture 10 - The Structure of Proteins
7/34
The Nature of the Peptide Bond
the structure of the amino acid chain about the peptide bond is planar and rigid
free to
rotate
free to
rotate
Planar
Rigid
8/18/2019 Lecture 10 - The Structure of Proteins
8/34
Why the peptide bond is rigid
• the peptide bond has a resonance structure shared with the carbonyl group
• as with all resonance bonds, they are neither single or double bonds, but ahybrid between the two. Since the peptide bond is not a pure single bond,
free rotation is not possible.
8/18/2019 Lecture 10 - The Structure of Proteins
9/34
free to
rotate
free to
rotate
Planar
Rigid
But, proteins have a very complex and convoluted structure and this is due to
the bonds that can rotate somewhat freely
8/18/2019 Lecture 10 - The Structure of Proteins
10/34
peptide bonds
φ (phi) bond rotation after peptide bond
ψ (psi) bond rotation before peptide bond
peptide bonds
The bonds before and after the peptide bond can rotate
these are the bonds that flank the alpha Carbon of each amino acid
8/18/2019 Lecture 10 - The Structure of Proteins
11/34
Nelson p144
φ=-180o, ψ=+180o
φ=-0o, ψ=+180o φ=-180o, ψ=+0o
Permissible
Not Permissible
The phi and psi bonds have rotational freedom, but not unlimited freedom
8/18/2019 Lecture 10 - The Structure of Proteins
12/34
A Ramachandran Plot shows the permissible phi (ψ) and
psi (φ) bond angles allowed in polypeptide backbone
beta strand
alpha helix
the range of permissible bond
angle combinations reflect
the secondary structures wesee in proteins
i.e. alpha helices and beta strands
8/18/2019 Lecture 10 - The Structure of Proteins
13/34
Nelson p103
The phi and psi bond angles
define the overall secondary andtertiary structure of a protein
If we know the angle of every bond
in a protein, we know its exact structure
The Secondary (2o) Structure of Proteins
8/18/2019 Lecture 10 - The Structure of Proteins
14/34
The Secondary (2o) Structure of Proteins
• the polypeptide chain can adopt several higher order structures
• because of the permissible phi and psi bond angles within amino acids,
the polypeptide or protein backbone can form a (not unlimited) range ofconformations.
• Hydrogen bonding between functional groups on the amino acids result
in the formation of regular structures (SECONDARY STRUCTURES) that help
determine the overall structure of the protein.
• due to the combination of possible bond angles coupled with Hydrogen bonding
effects, certain amino acid segments spontaneously form secondary structures
• secondary structures include the:
Alpha (α) HelixBeta (β) Sheet
Turns and Loops
• some proteins are made up of only α-helices or only β-sheets while others are
mixtures of both secondary structure types. Loops and turns often connect
helices or sheets together.
8/18/2019 Lecture 10 - The Structure of Proteins
15/34
The Alpha Helix
• alpha helices are segments of amino acids in proteins that form a helical structure
•
average length of 10 amino acids though may be shorter or longer
• there are about 3.6 amino acids per turn of the helix
• every fourth amino acid interacts via Hydrogen bonding
• not all amino acids participate in alpha helix formation, the geometry or the
size of the side-chains of some amino acids make them unsuitable for
alpha helix formation
Primary sequence and predicted secondary structure of a small 79 amino acid protein
VDGQFEQKKKQKDETYDIEHLIACFSPMIRKKLSNTSYQEREDLEQELKIKMFEKADMLLCQDVPGFWEFILYMVDENS
CN
8/18/2019 Lecture 10 - The Structure of Proteins
16/34
Nelson p149
Views of the Alpha Helix
Hydrogen bondingSide-chains on outside of helix
H-bonding every 4 residues
1 2 3 4 5
8/18/2019 Lecture 10 - The Structure of Proteins
17/34
A protein composed of all alpha helices
Th B Sh
8/18/2019 Lecture 10 - The Structure of Proteins
18/34
The Beta Sheet
• an important secondary structure in many proteins
•
composed of adjacent beta strands in anti-parallel or parallel arrangements
• beta strands are segments of amino acids in a fully extended sequence rather
then coiled as in an alpha helix.
each amino acid binds
to opposite residue
each amino acid binds
to two opposite residues
blue =amino nitrogen
green = side chain
red = oxygen
black = carbon
8/18/2019 Lecture 10 - The Structure of Proteins
19/34
Many Beta strands can associate in mixed orientations to form beta sheets
stabilized by intra-molecular H bonding
in all beta strands/sheets, note the orientation of the side chains
8/18/2019 Lecture 10 - The Structure of Proteins
20/34
Beta sheets are usually depicted as flat arrows
Anti-parallel arrangement
Parallel arrangement
http://www.google.ca/url?sa=i&rct=j&q=&esrc=s&frm=1&source=images&cd=&cad=rja&docid=KrOvFqa3LYYPlM&tbnid=lLJArvKxQWFmzM:&ved=0CAUQjRw&url=http://www.thestudentroom.co.uk/showthread.php?t=2178072&page=2&ei=ebE_Utf0OOqE2QWAzoBQ&bvm=bv.52434380,d.b2I&psig=AFQjCNF92kaxaFxvglLvG6fsJgFq5JmtBw&ust=1379992236678763
8/18/2019 Lecture 10 - The Structure of Proteins
21/34
The arrangement of beta strands in some proteins
8/18/2019 Lecture 10 - The Structure of Proteins
22/34
Turns and Loops
structured or unstructured segments of amino acids
often join other secondary structures together
Proline and Glycine often participate in forming turns (nearly 180o change in direction
of polypeptide backbone)
Proline at either one ofthese positions will mediate
a Turn
Ala Pro
proline forces a turn
in the backbone
8/18/2019 Lecture 10 - The Structure of Proteins
23/34
Nothing (almost nothing) is random about protein structure.
Amino acid segments of the protein adopt specific secondary structures not by chance
but because of the characteristics of the amino acid participants
8/18/2019 Lecture 10 - The Structure of Proteins
24/34
Tertiary Structure of Proteins
• proteins may be very small or large (thousands of amino acids long)
• amino acids form segments of secondary structure (α helices and β sheets)
• tertiary structure arises when these secondary structure segments associate in
specific and precise ways to form a 3-D compact structure
•
there is little or no “open space” within the interior of a protein
• interior is usually hydrophobic and water is excluded from interior
• forces that stabilize the tertiary structure
-charge interactions (e.g. between the + and - charged amino acids)
-H-bonding between polar groups
-van der Waals interactions between hydrophobic amino acid side chains
-the hydrophobic effect
-disulfide bonds between cysteine side-chains
S I t ti th t t bili th t ti t t
8/18/2019 Lecture 10 - The Structure of Proteins
25/34
Some Interactions that stabilize the tertiary structure
of Proteins
Charge-charge (ionic) Interactions
3. Induced dipole-induced dipole. Randomfluctuations in electron distribution in one
molecule sets up temporary dipole. This induces
dipole in adjacent molecule, resulting in
interaction. Weak but very important to the
cohesiveness of everything.
Also known as London Dispersion Forces.
van der Waals Interactions
S I t ti th t t bili th t ti t t
8/18/2019 Lecture 10 - The Structure of Proteins
26/34
Disulfide bond formation
Some Interactions that stabilize the tertiary structure
of Proteins
Disulfide bonds can be intra- or inter molecular
Th T i S f i
8/18/2019 Lecture 10 - The Structure of Proteins
27/34
Nelson p175
The Tertiary Structure of some proteins
Proteins are not usually “open structures”
8/18/2019 Lecture 10 - The Structure of Proteins
28/34
Primary sequence and predicted secondary structure of a small 79 amino acid protein
VDGQFEQKKKQKDETYDIEHLIACFSPMIRKKLSNTSYQEREDLEQELKIKMFEKADMLLCQDVPGFWEFILYMVDENS
CN
Proteins are not usually open structures
8/18/2019 Lecture 10 - The Structure of Proteins
29/34
Some Proteins fold into multiple tertiary structures called DOMAINS
each domain may possess a unique enzymatic function
that may be quite functional even if separated from the
rest of the protein
8/18/2019 Lecture 10 - The Structure of Proteins
30/34
Discrete regions of a protein, or a domain in a protein, with special functional
significance are called MOTIFS.
The Helix-turn-Helix motif is
often found in proteins that
bind double-stranded DNA
The Quaternary Structure of Proteins
8/18/2019 Lecture 10 - The Structure of Proteins
31/34
The Quaternary Structure of Proteins
• proteins fold into tertiary structures that are often active and do work
• sometimes separate proteins interact with other proteins to form multi-subunit
proteins
• sometimes proteins associate with themselves to form
homodimers 2 subunits or with other proteins (heterodimers)
homotrimers 3 subunitshomotetramers 4 subunits
etc.
• sometimes very different proteins assemble into multi-subunit complexes
e.g. DNA polymerase required for DNA replication is made up of many
different proteins that interact with each other to form a
complex
-only together do they form an active enzyme
• all the usual molecular interaction types are involved in these formations
Hi h d bli f t i (di t i t )
8/18/2019 Lecture 10 - The Structure of Proteins
32/34
Nelson p183
Higher order assemblies of proteins (dimers, trimers, etc.)
8/18/2019 Lecture 10 - The Structure of Proteins
33/34
Quaternary structure of RNA polymerase
this is the enzyme that
synthesizes mRNA during
transcription - the first step
in gene expression.
it is made up of several different
proteins.
http://www.google.ca/url?sa=i&rct=j&q=&esrc=s&frm=1&source=images&cd=&cad=rja&docid=NTRypl2LkpKJiM&tbnid=pV1RsTicRDWJRM:&ved=0CAUQjRw&url=http://www.bbsrc.ac.uk/news/research-technologies/2011/110204-n-how-genes-are-read.aspx&ei=WAdAUpiaNsSH2gXlxYDQBA&bvm=bv.52434380,d.b2I&psig=AFQjCNEv05vbFGjD1t0IE3WPCLgQdQKUTw&ust=1380013972675039
8/18/2019 Lecture 10 - The Structure of Proteins
34/34
This Lecture
Stryer 8th Chapter 2 Protein Composition and Structure pg 27-57
Next Lecture
Stryer 8th Chapter 3 Exploring Proteins and Proteomes pg 66-79