Using the complete genome sequence of Mycobacterium ulcerans
to address research priorities for the control of Buruli ulcer
“Knowledge is power.”Sir Francis Bacon
Genome sequence = knowledge
(length of 1 bp) x(number of bp per cell) x
(number of cells in a colony)
(0.34 x 10-9 m) x (6 x 106) x (107) =
20 km
A, G, C, T……..
AGCTCTGGGCGTTTCGCAATGGCTAGCGATAGCTCTGGGCGTTTCGCAATGGCTAGCGAGT………
genes (DNA)
proteins(amino acids)
muweb.millersville.edu
Information
Knowledge
Wisdom
Genome sequence
Annotated genome
Hypothesis testing
Treatment
MU Genome Treatment
• New drugs
• New diagnostic tools
• Vaccines
• Improved molecular epidemiology
MU Genome Treatment
• New drugs
• New diagnostic tools
• Vaccines
• Improved molecular epidemiology
MU MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK
MU Genome Treatment
• New drugs
• New diagnostic tools
• Vaccines
• Improved molecular epidemiology
Genome overview
5,631,606 bp
174,155 bp
5,805,761 bp
pMUM001, mycolactones and virulence
mlsA1mlsA2
mlsB
5,631,606 bp
174,155 bp
5,805,761 bp
• 4288 CDS
• 304 copies ISE
Genome overview
5,631,606 bp
174,155 bp
5,805,761 bp
• 4288 CDS
• 304 copies ISE
• 735 pseudo
Genome overview
5,631,606 bp
174,155 bp
5,805,761 bp
• 4300 CDS
• 288 copies ISE
• 690 pseudo
• MU unique- 2 prophage
- 97 PE/PPE
- 22 other
• G + C 65.47%
Genome overview
M. M. ulceransulcerans--specificspecific antigen identificationantigen identification
• 41 potential antigens identified
• Rapid immunodiagnostics
• Vaccine development
MU Genome Treatment
• New drugs
• New diagnostic tools
• Vaccines
• Improved molecular epidemiology
http://genolist.pasteur.fr/BuruList/
Monash Microbiology• Jessica Porter• Sacha Pidot• Janine Ryan• Grant Jenkin• John DaviesVictorian Bioinformatics Consortium• Torsten SeemannOthers• Paul Johnson (Austin Hospital)
Funding• Association Française Raoul Follereau• The Génopole Programme• World Health Organisation (Nippon Foundation)
• NH&MRC, Australia
• Wafa Frigui• Roland Brosch• Thierry Garnier• Melinda Pryor• Gilles Reysett• Stewart Cole
Dept. Biochemistry University of Cambridge
• Hui Hong• Peter Leadlay
The Génopole PF1
University of Tennessee
• Pamela Small
“Where is the Life we have lost in living? Where is the
wisdom we have lost in knowledge? Where is the
knowledge we have lost in information?”
T.S. Eliot