+ All Categories
Home > Documents > Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x...

Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x...

Date post: 21-Sep-2020
Category:
Upload: others
View: 1 times
Download: 0 times
Share this document with a friend
21
Using the complete genome sequence of Mycobacterium ulcerans to address research priorities for the control of Buruli ulcer
Transcript
Page 1: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Using the complete genome sequence of Mycobacterium ulcerans

to address research priorities for the control of Buruli ulcer

Page 2: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

“Knowledge is power.”Sir Francis Bacon

Page 3: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Genome sequence = knowledge

Page 4: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

(length of 1 bp) x(number of bp per cell) x

(number of cells in a colony)

(0.34 x 10-9 m) x (6 x 106) x (107) =

20 km

A, G, C, T……..

AGCTCTGGGCGTTTCGCAATGGCTAGCGATAGCTCTGGGCGTTTCGCAATGGCTAGCGAGT………

genes (DNA)

proteins(amino acids)

Page 5: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

muweb.millersville.edu

Page 6: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Information

Knowledge

Wisdom

Genome sequence

Annotated genome

Hypothesis testing

Treatment

Page 7: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 8: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 9: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK

Page 10: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 11: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Genome overview

5,631,606 bp

174,155 bp

5,805,761 bp

Page 12: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

pMUM001, mycolactones and virulence

mlsA1mlsA2

mlsB

Page 13: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

5,631,606 bp

174,155 bp

5,805,761 bp

• 4288 CDS

• 304 copies ISE

Genome overview

Page 14: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

5,631,606 bp

174,155 bp

5,805,761 bp

• 4288 CDS

• 304 copies ISE

• 735 pseudo

Genome overview

Page 15: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

5,631,606 bp

174,155 bp

5,805,761 bp

• 4300 CDS

• 288 copies ISE

• 690 pseudo

• MU unique- 2 prophage

- 97 PE/PPE

- 22 other

• G + C 65.47%

Genome overview

Page 16: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

M. M. ulceransulcerans--specificspecific antigen identificationantigen identification

• 41 potential antigens identified

• Rapid immunodiagnostics

• Vaccine development

Page 17: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Page 18: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)
Page 19: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

http://genolist.pasteur.fr/BuruList/

Page 20: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

Monash Microbiology• Jessica Porter• Sacha Pidot• Janine Ryan• Grant Jenkin• John DaviesVictorian Bioinformatics Consortium• Torsten SeemannOthers• Paul Johnson (Austin Hospital)

Funding• Association Française Raoul Follereau• The Génopole Programme• World Health Organisation (Nippon Foundation)

• NH&MRC, Australia

• Wafa Frigui• Roland Brosch• Thierry Garnier• Melinda Pryor• Gilles Reysett• Stewart Cole

Dept. Biochemistry University of Cambridge

• Hui Hong• Peter Leadlay

The Génopole PF1

University of Tennessee

• Pamela Small

Page 21: Mycobacterium ulcerans - WHO · Sir Francis Bacon. Genome sequence = knowledge (length of 1 bp) x (number of bp per cell) x (number of cells in a colony) (0.34 x 10-9 m) x (6 x 106)

“Where is the Life we have lost in living? Where is the

wisdom we have lost in knowledge? Where is the

knowledge we have lost in information?”

T.S. Eliot


Recommended