Blu
e D
oor
Plus
Net
wor
k P
ract
ice
Gui
de
Fedhealth Blue Door Plus optionFedhealth Blue Door Plus offers a value for money option for lower income, previously uncovered employees who have never previously enjoyed any medical scheme cover due to it being unaffordable. This option is not suitable for people already on a medical aid or those with higher benefit requirements.
This manual lists the services and benefits that are covered for the Blue Door Plus option for 2015.
Contents
1. ImportantContactDetails 1
2. GeneralPractitionerBenefitsandFeeStructure 2
3. Specialist 3
4. AcuteMedication 6
5. ChronicMedication 6
6. BlueDoorPluspathologybenefitschedule 7
7. BlueDoorPlusradiologybenefitschedule 10
8. Dentalcodes 12
9. NetworkHospitals 13
Important contact details
Provider Call CentreTel: 0861 112 666
Healthcare Professional Managed Care LineTel: 0861 100 220Monday to Friday 08h30 – 16h00
Hospital Authorisation CentreMonday to Thursday 08h30 – 17h00Friday 09h00 – 17h00Tel: 0861 100 220email: [email protected] as a provider on: www.medscheme.co.za
Aid for AIDSMonday to Friday 08h00 – 17h00Tel: 0860 100 646Fax: 0800 600 773email: [email protected]: www.aidforaids.co.zaSMS (call me): 083 410 9078
Chronic Medicine ManagementMonday to Friday 08h30 to 17h00Tel: 0861 100 220Fax: 0800 223 670/80email: [email protected] as a provider on: www.medscheme.co.zaPostal address: P O Box 38632, Pinelands, 7430
Medi-Rite PharmaciesTel: 0800 222 617
1
2
General Practitioner (GP) benefits FedhealthsupportstheGP’sroleasthecoordinatorofcareandwillbeimplementingGPNominationforBlueDoorPlusbeneficiariesin2015.ThismeansthatBlueDoorPlusbeneficiarieswillneedtonominateaprimarytreatingdoctorandvisitthisdoctorforalltheirconsultationsgoingforward.InordertoassistexistingBlueDoorPlusbeneficiarieswithGPnomination,FedhealthwillallocateanetworkGPtothemontheirbehalf.ThiswillbebasedontheGPwhotheymostrecentlyandfrequentlyvisited.BlueDoorPlusbeneficiarieswillbeinformedofthisandgiventheopportunitytochangetheirGPbeforeApril2015bycallingthecustomercontactcentreon0860002153.Thereafter,thenominatedGPmayonlybechangedonceeverysixmonths.Twovisitsperfamilyperannumwillbeavailablefromthe‘outofnomination’benefitifabeneficiaryneedstoseeaGPotherthantheirnominatedGP.Aleniencyperiodwillapplyuntil01April2015.Inaddition,pleasetakenoteofthefollowingfor2015:
• FedhealthBlueDoorPlusbeneficiariesarealloweduptosix(6)GPconsultationsatanominatedBlueDoorPlusnetworkGPwithoutpre-authorisation.
• Afterthesixthconsultation,thenominatedGPisrequiredtoobtainpre-authorisationviatheHealthcareProfessionalCallCentreon0861112666
•The‘outofnominated’GPbenefitconsistsof2visitsperfamilyperyearandisreimbursedattheBlueDoorPlusrate
Fee structure and GP in-room procedures
Schemerate Description FixedFee2015
0190-0192 GPvisit(dispensing) 302.60
0190-0192 GPvisit(non-dispensing) 220.30
0300 Stitchingofwound(additionalcodeforsettingsteriletray) 123.40
0307/0308 Excisionandrepair 237.60
0255 Drainageofabscessandavulsionofnail 176.50
0259 Removalofforeignbody 176.50
0887 Limbcast 116.70
0202 Settingofsteriletray 88.90
0210 Collectionofbloodspecimen 36.10
0206-0207 Intravenoustreatment 54.40
0222-0223 Intralesionalinjectionintoareasofpathology 71.70
0233-0237 Biopsy 54.40
0241-0243 Treatmentofbenignskinlesionbychemo-cryotherapy 54.40
0244 Repairofnailbed 264.00
0245-0246 Removalofbenignlesionbycurretting 94.20
1037 Diathermytonoseorpharynx 71.70
1228-1234 ECG/Multi-stagetreadmilltest 116.70
2129-2131 Electrodesiccation 183.10
2271-2272 Removaloftagorpolyporbenignlesions 54.40
2316-2318 Destructionofcondylomata 94.20
2399-2404 Biopsy/Wedgebiopsy 116.70
3171 ExcisionofMeibomiancyst 180.40
3287 Spinaljointandligamentinjection 176.50
List of procedures included in standard fixed fee consultation rate
Code Description
0201 Costofmaterialintreatment
0316-0317 Fineneedleaspiration/Aspirationofcystortumour
1136 Nebulisation(inrooms)
1186-1192 Flowvolumetest
3304 Allotherphysicaltreatments
3*ICON - Independent Clinical Onocology Network FR - Fedhealth Rate*MPL - Medicine Price List Rate
SpecialistsPleasenotethatFedhealthhaspartneredwithspecialistsacrossalldisciplinestoensurethatourmembershavenoco-paymentswhenvisitingspecialists.ItisimportantthatourBlueDoorPlusmembersareonlyreferredtospecialistswhoarepartoftheFedhealthSpecialistPartnership.TolocateaspecialistontheFedhealthSpecialistpartnershippleasecalltheFedhealthProviderCallCentreon0861112666.
majormedicalbenefitAll costs for hospitalisation are covered from this benefit from the first day of hospitalisation in a public or network
private hospital and must be pre-authorised
BENEFIT COVER LIMIT PER FAMILY PER YEAROverall annual limit (OAL) Unlimited at network hospitals only. 40% co-payment on voluntary use of a non-
network hospital
Healthcare Professional tariff (HPT) Specialists tariff
- Fedhealth Network GPs and Specialists
- Non-Fedhealth Network GPs and Specialists
- Other Healthcare Professionals
Covered at cost
Up to 100% of FR
Up to 100% of FR
Unlimited
Unlimited
Unlimited
Prescribed Minimum Benefits (PMBs) Unlimited in state hospitals
Hospitalisation costs
Accommodation, use of operating theatres and hospital equipment, medicine, pharmaceuticals and surgical items
Negotiated tariff Unlimited at network hospitals only. 40% co-payment on voluntary use of a non-network hospital
Alternatives to hospitalisation
Acute facilities and rehabilitation facilities (Does not include Hospice)
Negotiated tariff Unlimited at PMB level of care
Ambulance services Negotiated tariff Unlimited with Europ Assistance
Appliances, external accessories, orthotics, blood, blood equivalents and blood products
100% of cost Unlimited
Physical TherapyPhysiotherapy and biokinetics
Up to 100% of FR Unlimited
Immune deficiency related to HIV infection
- Hospitalisation
- Anti-retroviral and related medication
- Related pathology
Up to 100% of FR Unlimited at PMB level of care
Maternity Up to 100% of FRR31 200 per maternity event with a limit of R46 200 per family, per year. Elective Caesarean Sections subject to a 40% co-payment
Oncology Up to 100% of FR PMBs only at ICON
Organ, tissue and haemopoietic stem cell transplant including immunosuppression medication
PMBs only in state facilities
Pathology and medical technology Up to 100% of FR Unlimited
Prostheses
- Internal
- External
PMBs only in state facilities
PMBs only in state facilities
Psychiatric services See Healthcare Profes-sional tariff
R7 600
Radiology
- General
- Specialised
Up to 100% of FR
Up to 100% of FR
Unlimited
R11 500 per beneficiary, subject to an overall limit of R23 200 per family per year
Renal dialysis (chronic)
Haemodialysis and peritoneal dialysisPMBs only in state facilities
Take out medicines 7 days medication per hospital event at MPL
Day-to-Day Benefit
day-to-daybenefitDay-to-day benefits provided through the nominated Blue Door Plus GP Network
BENEFIT COVER LIMIT PER FAMILY PER YEARGeneral Practitioners (GP)
- Contracted
- Not contracted
Agreed tariff
Limited to tariff for con-tracted GPs
Limited to six (6) consultations to a nominated GP without pre-authorisation. After the sixth consultation, pre-authorisation is required via the Healthcare Profes-sional Call centre on 0861 112 666. Limited to 2 psychiatric consultations per family per annum
The ‘out of nominated’ GP benefit consists of 2 visits per family per year and is reimbursed at the Blue Door Plus rate
Specialists
- Fedhealth Network Specialists
- Non-Fedhealth Network Specialists
At cost
No benefit
2 x specialist consultations per family per year. Must be referred by the nominated GP
Dentistry (Basic)
Removal of teeth and roots and suturing of trau-matic wounds.Oral medical procedures:diagnosis and treatment of oral and associated conditions, plastic dentures and dental techni-cians fees for all such dentistry
Agreed tariff
Subject to a contracted list of dentists and limited to a list of approved procedures, dental tariff codes and protocols.Plastic dentures limited to one set per beneficiary every two years for beneficiaries 21 years and older
Mental health No benefit See GP benefit
Optometry Agreed tariff
Subject to ISO Leso* network optometrists. Frame to the value of R173 or R173 off any other frame every 2 years1 pair of single vision clear CR39 lenses or 1 pair of bifocal clear CR39 lenses1 comprehensive consultation. This benefit is avail-able in a 2 year benefit cycle
Over-the-counter medication No benefit
Maternity Up to 100% of FR 2 x 2D scans per beneficiary per maternity event
Pathology Up to 100% of FRUnlimited subject to basic protocols and limited list of tests & procedures. Must be referred by contracted Medical Practitioner
Prescribed Medication
- Dispensing GP - Non-Dispensing Medical Practitioner
Unlimited
Up to 100% of MPL
Unlimited at nominated GP
Unlimited subject to acute medicine formulary for all Medical Practitioners
Physiotherapy No benefit
Radiology
- General
- Specialised
Up to 100% of FR
No benefit
Unlimited subject to basic protocols and a limited list of tests and procedures. Must be referred by contract-ed Medical Practitioner
4
Agreed Tariff - the service fee as agreed to by the Scheme with the healthcare professional
Chronic Disease Benefi t
Medication for approved chronic diseases is covered from this benefi t
Limit Unlimted
Conditions covered 26ChronicConditionsbelow
Formulary Basicformulary(AlsoknownastheLowOptionChronicFormulary)
Designated Service Provider (DSP) Medi-Ritepharmacy
HIV/ AIDS MEDICINE BENEFIT INCLUDING TREATMENT FOR MOTHER-TO-CHILD TRANSMISSION, RAPE & POST-EXPOSURE PROPHYLAXIS
Limit Unlimited
Non-compliancewithDSPand/orformularyrequirementswillattractaco-paymentof40%.AllmedicineclaimsaresubjecttotheMedicinePriceList(MPL),agenericreferenceprice,andthemaximumnegotiateddispensingfee.Wherethedispensingfeehasnotbeennegotiated,amaximumdispensingfeeof26%/R26willapply.
26 CHRONIC CONDITIONS
Addison’sDisease,Asthma,BipolarMoodDisorder,Bronchiectasis,CardiacFailure,Cardiomyopathy,COPD/Emphysema/ChronicBronchitis,ChronicRenalDisease,CoronaryArteryDisease,Crohn’sDisease,DiabetesInsipidus,DiabetesMellitustype1,DiabetesMellitustype2,Dysrhythmias,Epilepsy,Glaucoma,Haemophilia,Hyper-lipidaemia,Hypertension,Hypothyroidism,MultipleSclerosis,Parkinson’sDisease,RheumatoidArthritis,Schizophrenia,SystemicLupusErythematosus,UlcerativeColitis
5
Major Medical Benefit Please note the following important points:• Costsforhospitalisationarecoveredunlimitedfromthisbenefit-fromthefirstdayofhospitalisationinpublicornetworkprivate
hospitals• Voluntaryuseofnon-networkorpublichospitalswillresultinthememberhavingtomakeaco-paymentof40%ontheirhospitalbill• OrgantransplantsandrenaldialysisarecoveredasPrescribedMinimumBenefitsatstatefacilitiesonly• OncologyiscoveredunlimitedasaPrescribedMinimumBenefitattheIndependentClinicalOncologyNetwork(ICON),theScheme’s
DesignatedServiceProvider• HospitaladmissionsrequireareferralfromanominatedGPandmustbepre-authorisedbytheHealthcareProfessionalManagedCare
Lineon0861100220• PsychiatricadmissionsarelimitedtoR7600perfamilyperyearandwillrequireareferralfromanominatedGPandissubjecttopre-
authorisation• MaternityhasalimitofR31200perpregnancy,withalimitofR46200perfamilyperyear.ElectiveCaesariansectionsaresubjecttoa
40%co-payment.
Acute medicine• Fordispensingdoctorsacutemedicineformspartofthefixedfeeforconsultationsandnoacutemedicinewillbepaidadditionalto
thisfee• Eventhoughafixedfeeispaid,themedicinebillingcodesmustberecordedontheaccount.Thisensuresproperinformationon
dispensingpatternsandisrequiredforqualitymanagementpurposes• Anacutemedicinesformularyisavailabletonon-dispensingdoctors.Thisformularyrepresentsleastcostlyandyeteffective
genericproductsandcanbeusedasaprescribingguide•Itisimportantfordoctorstoprescribemedicinesontheacuteformularysothatmembersdonothaveanyoutofpocketexpenses. Acutemedicinesthatarenotontheacuteformularywillnotbecovered.
Chronic medication•MedschemeappliesaDiseaseAuthorisationmodelwhichmeansthatonceapatientisapprovedforachronicconditiontheywill
haveaccesstoaselectionofpre-approvedmedicinesforthecondition,referredtoasabasket.ThemedicineinthebasketisstillsubjecttoMPLandoutofformularyco-paymentsandcanbeviewedonwww.medscheme.co.zabyloggingintotheproviderzone.Apatientcanupdateorchangetheirmedicinedirectlywiththepharmacywiththeirnewprescription.Notallconditionsaremanagedthisway;apatientwillneedtocontacttheschemeif:~themedicineisnotinthebasket;or~theyarediagnosedwithanewchroniccondition;or~theyneedaquantityordosageofamedicinethatismorethanthequantitylistedinthebasket.
From 01 January 2015, the Fedhealth Blue Door Plus Option will be applying the Basic Chronic Formulary (also known as the Low Option Chronic Formulary). The following must be kept in mind when prescribing chronic medication to Blue Door Plus members:
• ChronicmedicationmustbeprescribedbyaBlueDoorPluscontractedGP• ChronicmedicationisprovidedthroughaDesignatedServiceProvider,Medi-Ritepharmacies• Aco-paymentof40%willapplytomedicinesoutsideofformularyorprescribedbyanon-designatedserviceprovider• 26PMB(CDL)conditionsonly• MedschemeBasicFormularyapplies(alsoknownastheLowOptionChronicFormulary)• Memberstoregisterforchronicmedication• MedicinePriceList(MPL)ruleapplieswhichensuresthatthemosteffectiveandyetcosteffectivegenericswillbesuppliedtoBlue
DoorPlusmembers.
Telephonic chronic medicine application• CallourChronicMedicineManagementdepartmentbetween08h30and17h00on0861100220andselectoptionnumber3• Yourcallwillberoutedthroughtoaclinicalconsultant.Makesureyouhaveallrelevantdetailsofyourpatientathand• Onapprovalthemedicationwillbepaidfromthechronicmedicinebenefit• Normal0199paymentwillapplyforfirsttimetelephonicregistrations.
Online chronic medicine application• LogintotheMedschemewebsite(www.medscheme.co.za)andclickonChronicApplication• Loginwithyourusernameandpassword.Pleaseregisterifyouareafirsttimeuser• Makesurethatyouhavealltherelevantpatientdetailsathandtocompletetheonlineapplication• Remembertheonlineapplicationcanbeusedformembersapplyingforchronicmedicineforthefirsttimeorforupdatingcurrent authorisations•Normal0199paymentwillapplyforfirsttimeonlinechronicapplications.
Aid for Aids (AfA)• SubjecttoregistrationandmanagementbyAfA• MedicineprovidedbyMedi-Ritepharmacies• PathologytestsarepartofmanagementbyAfA• Benefitincludestreatmentformother-to-childtransmission,rape,andpost-exposure-prophylaxis.
6
Blue Door Plus pathology benefit schedule• ThemembermustbereferredbyaBlueDoorPlusnominatedGP• Pathologyiscoveredat100%oftheBlueDoorPlusschemerate• Unlimitedbutsubjecttothetestslistedbelow.
Pathology codes payable
Tariff Code DESCRIPTION
Chemistry
Cardia/ Muscle
4152 CK-MB:Massdetermination:Quantitative(Automated)
4161 Troponinisoforms:Each
Diabetes
4050 Glucosestriptest
4057 Glucose:Quantitative
4064 HbA1C
Inflammation/ Immune
3947 C-reactiveprotein
Lipids
4027 Cholesteroltotal
4026 LDLcholesterol
4028 HDLcholesterol
4147 Triglyceride
Liver/ Pancreas
3999 Albumin
4001 Alkalinephosphatase
4006 Amylase
4009 Bilirubin:Total
4010 Bilirubin:Conjugated
4117 Protein:Total
4130 Aspartateaminotransferase(AST)
4131 Alanineaminotransferase(ALT)
4133 Lactatedehidrogenase(LD)
4134 Gammaglutamyltransferase(GGT)
Renal/ Electrolytes/ Bone
4017 Calcium:Spectrophotometric
4032 Creatinine
4086 Lactate
4094 Magnesium:Spectrophotometric
4109 Phosphate
4113 Potassium
4114 Sodium
4155 Uricacid
4151 Urea
4171 Soduim+Posassium+Cloride+C02+Urea
Haematology
3709 Antiglobulintest(Coombs’ortrypsinziedredcells)
3716 Meancellvolume
3743 Erythrocytesedimentationrate
3755 Fullbloodcount(includingitems3739,3762,3783,3785,3791)
7
3762 Haemoglobinestimation
3764 Grouping:ABandOantigens
3765 Grouping:Rhantigen
3797 Plateletcount
3805 Prothrombinindex
3809 Reticulocytecount
3865 Parasitesinbloodsmear
4071 Iron
4144 Transferrin
4491 VitaminB12
4528 Ferritin
4533 Folicacid
Endocrine - Reproductive
4450 HCG:Monoclonalimmunological:Qualitative
4537 Prolactin
Endocrine - Thyroid
4482 Freethyroxine(FT4)
4507 Thyrotropin(TSH)
Other Endocrine
4519 Prostatespecificantigen
Serology
Auto immune
3934 Autoantibodiesbylabelledantibodies:FORANFONLY
3939 Agglutinationtestperantigen
4155 Uricacid
4182 Quantitativeproteinestimation:NephelometerorTurbidometericmethod:FORRHEUMATOIDFACTORONLY
Hepatitis tests
4531 Hepatitis:Perantigenorantibody
4531 AcutehepatitisA(IgM)
4531 ChronicHepatitisA(IgG)
4531 AcuteHepatitisB(BsAG)
4531 HepatitisB:carrier/immunity(BsAB)
HIV tests
3816 TandB-cellsEACmarkers(limitedtoONEmarkeronlyforCD4/8counts)
3932 Antibodiestohumanimmunodeficiencyvirus(HIV):ELISA
3974 QualitativePCR(onlyforchildren<age6months)
4429 QuantitativePCR(DNA/RNA)
Infectious Diseases and Others
3946 IgM:Specificantibodytiter:ELISA/EMIT:RUBELLA
3948 IgG:Specificantibodytiter:ELISA/EMIT:RUBELLA
3951 QuantitativeKahn,VDRLorotherflocculation
Cytology
4566 Vaginalorcervicalsmears,each
Histology
4567 Histologypersample
Microbiology
MCS
3909 Anaerobeculture:Limitedprocedure
8
3901 Fungalculture
3918 Mycoplasmaculture:Comprehensive
4401 Cellcount
4188 Urinedipstick,perstick(irrespectiveofthenumberoftestsonstick)
3928 Antimicrobicsubstances
3893 Bacteriologicalculture:Miscellaneous
3867 Miscellaneous(bodyfluids,urine,exudate,fungi,puss,scrapings,etc.)
3922 Viablecellcount
3879 Campylobacterinstool:Fastidiousculture
3895 Bacteriologicalculture:Fastidiousorganisms
3928 Antimicrobicsubstances
3887 Antibioticsusceptibilitytest:Perorganism
3924 Biochemicalidentificationofbacterium:Extended
3869 Faeces(includingparasites)
3868 Fungusidentification
3881 Mycobacteria
3901 Fungalculture
3868 Fungusidentification
AFB fluorochrome auramine (ZN) only
3885 Cytochemicalstain
3881 Antigendetectionwithmonoclonalantibodies
TB culture
3881 Antigendetectionwithmonoclonalantibodies
4433 BacteriologicalDNAidentification(LCR)
3916 Radiometrictuberculosisculture
3867 Miscellaneous(bodyfluids,urine,exudate,fungi,puss,scrapings,etc.)
3895 Bacteriologicalculture:Fastidiousorganisms
TB sensitivity
3887 Antibioticsusceptibilitytest:Perorganism
3974 Polymerasechainreaction
Parasites
3869 Faeces(includingparasites)
3883 Concentrationtechniquesforparasites
3865 Parasitesinbloodsmear
Bilharzia micro
3980 BilharziaAgSerum/Urine
3867 Miscellaneous(bodyfluids,urine,exudate,fungi,puss,scrapings,etc.)
3946 IgM:Specificantibodytiter:ELISA/EMIT:PerAg
3883 Concentrationtechniquesforparasites
9
10
Blue Door Plus radiology benefit schedule• ThemembermustbereferredbyanominatedGP• X-raysarecoveredat100%oftheBlueDoorPlusschemerate• Pregnancyscansarelimitedto2scansperbeneficiaryperpregnancyandcanberequesteddirectlybyaspecialist• Generalradiologyisunlimitedbutsubjecttothelistbelow• Specialisedradiology(inhospital)islimitedtoR11500perbeneficiary,subjecttopre-authorisationandan
overallannuallimitofR23200perfamilyperyear
Radiology codes payable
Skull and Brain
10100 X-ray of the skull
Facial bones and nasal bones
11100 X-ray of the facial bones
11120 X-ray of the nasal bones
Orbits, lachrymal glands and tear ducts
12100 X-ray orbits
Paranasal sinuses
13100 X-ray of the paranasal sinuses, single view
13110 X-ray of the paranasal sinuses, two or more views
Mandible, teeth and maxilla
14100 X-ray of the mandible
14130 X-ray of the teeth single quadrant
14140 X-ray of the teeth more than one quadrant
14150 X-ray of the teeth full mouth
15100 X-ray tempero-mandibular joint, left
15110 X-ray tempero-mandibular joint, right
16100 X-ray of the mastoids, unilateral
16110 X-ray of the mastoids, bilateral
Thorax
30100 X-ray of the chest, single view
30110 X-ray of the chest two views, PA and lateral
30150 X-ray of the ribs
Abdomen and Pelvis
40100 X-ray of the abdomen
40105 X-ray of the abdomen supine and erect, or decubitus
40110 X-ray of the abdomen multiple views including chest Skeleton: Spinal column - Per region, e.g. cervi-cal, sacral, lumbar coccygeal, one region thoracic
50100 X-ray of the spine scoliosis view AP only
Cervical
51110 X-ray of the cervical spine, one or two views
Thoracic
52100 X-ray of the thoracic spine, one or two views
Lumbar
53110 X-ray of the lumbar spine, one or two views
54100 X-ray of the sacrum and coccyx
54110 X-ray of the sacro-iliac joints
Pelvis
55100 X-ray of the pelvis
56120 X-ray pelvis and hips
Hips
56100 X-ray of the left hip
56110 X-ray of the right hip
Shoulder
61100 X-ray of the left clavicle
61105 X-ray of the right clavicle
11
Shoulder
61110 X-ray of the left scapula
61115 X-ray of the right scapula
61120 X-ray of the left acromio-clavicular joint
61125 X-ray of the right acromio-clavicular joint
61130 X-ray of the left shoulder
61135 X-ray of the right shoulder
Humerus
62100 X-ray of the left humerus
62105 X-ray of the right humerus
Elbow
63100 X-ray of the left elbow
63105 X-ray of the right elbow
Forearm
64100 X-ray of the left forearm
64105 X-ray of the right forearm
Hand and Wrist
65100 X-ray of the left hand
65105 X-ray of the right hand
65120 X-ray of a finger
65130 X-ray of the left wrist
65135 X-ray of the right wrist
65140 X-ray of the left scaphoid
65145 X-ray of the right scaphoid
Lower Leg
73100 X-ray of the left lower leg
73105 X-ray of the right lower leg
Ankle and Foot
74100 X-ray of the left ankle
74105 X-ray of the right ankle
74120 X-ray of the left foot
74125 X-ray of the right foot
74130 X-ray of the left calcaneus
74135 X-ray of the right calcaneus
74140 X-ray of both feet – standing – single view
74145 X-ray of a toe
Femur
71100 X-ray of the left femur
71105 X-ray of the right femur
72100 X-ray of the left knee one or two views
72105 X-ray of the right knee one or two views
72120 X-ray of the left knee including patella
72125 X-ray of the right knee including patella
72140 X-ray of left patella
72145 X-ray of right patella
72150 X-ray both knees standing – single view
74150 X-ray of the sesamoid bones one or both sides
Ultrasound abdomen and Pelvis
41200 Ultrasound study of the upper abdomen
40210 Ultrasound study of the whole abdomen including the pelvis
43200 Ultrasound study of the pelvis transabdominal
43250 Ultrasound study of the pregnant uterus, first trimester
43270 Ultrasound study of the pregnant uterus, third trimester, first visit
43273 Ultrasound study of the pregnant uterus, third trimester, follow-up visit
43277 Ultrasound study of the pregnant uterus, multiple gestation, second or third trimester, first visit
43260 Routine obstetric ultrasound at 20 to 24 weeks to include detailed anatomical assessment
12
CODE CODE DESCRIPTION LIMITATIONS
8101 Consultation Twice per beneficiary per 12 months; once per 6 month period
8104 Examination for a specific problem not requiring full mouth examination
8107/8112 Intra oral radiographs, per film Maximum of two per beneficiary per year
8159 Scaling and polishing Twice per beneficiary per 12 months; once per 6 month period
8161 Topical application of fluoride Between the ages of 3-12 years Twice per beneficiary per 12 months; once per 6 month period
8163 Fissure sealant, per tooth Patients younger than 14; maximum of 2 per quadrant
8341 Amalgam one surface Any four amalgam fillings per beneficiary per year*
8342 Amalgam two surfaces
8343 Amalgam three surfaces
8344 Amalgam four and more surfaces
8351 Resin restoration, one surface anterior Any four resin fillings per beneficiary per year (anterior)*
8352 Resin restoration, two surface anterior
8353 Resin restoration, three surface anterior
8354 Resin restoration, four and more surfaces
8367 Resin restoration, one surface posterior Any four resin fillings per beneficiary per year
8368 Resin restoration, two surface posterior
8369 Resin restoration, three surface posterior
8370 Resin restoration, four and more surfaces
8307 Amputation of pulp (pulpotomy) Only on primary teeth
8132 Root canal therapy - gross pulpal debridement
8201 Extraction, single tooth. Code 8201 is charged for the first extraction in a quadrant
Any four non-surgical extractions per beneficiary per year – ONLY if clinically indicated.
8202 Extraction, each add tooth. Code 8202 is charged for each additional extraction in the same quadrant
8937 Surgical removal of tooth Quantity limit of 4, restricted to posterior permanent teeth
8935 Treatment of septic socket
8109 Infection control / barrier techniques. Codes 8109 in-cludes the provision by the dentist of new rubber gloves, masks, etc for each patient
Two per visit. Limited to 4 per beneficiary per annum
8110 Sterilized instrumentation One per visit
8145 Local anaesthetic One per visit per annum
8231 Complete dentures – maxillary and mandibular 1 (one) set of dentures allowed per beneficiary per 24 months ONLY members and beneficiaries over the age of 21 years of age. No metal base to complete or partial dentures allowed. Pre- authorisation required.
8232 Complete dentures – maxillary or mandibular
8233 Partial Denture (resin base) - One tooth
8234 Partial Denture (resin base) - Two teeth
8235 Partial Denture (resin base) - Three teeth
8236 Partial Denture (resin base) - Four teeth
8237 Partial Denture (resin base) - Five teeth
8238 Partial Denture (resin base) - Six teeth
8239 Partial Denture (resin base) - Seven teeth
8240 Partial Denture (resin base) - Eight teeth
8241 Partial Denture (resin base) - Nine teeth and more
8259 Rebase complete or partial dentures (Lab)
8269 Repair Denture
8263 Reline complete or partial dentures (chair side)
8271 Add tooth to existing partial dentures
8273 Impression to repair / addition
8140 Fee for treatment at a venue
Dental codes payable (Dentists and Dental Therapists)
13
Inadditiontothelistbelow,theHospitalNetworkforBlueDoorPlusincludesallStatefacilities(56),47,49,55,76and77facilities.
Network hospitalsBLUE DOOR HOSPITAL NETWORK PROVINCE SUBURB
Life Beacon Bay Hospital Eastern Cape East London
Netcare Cuyler Hospital Eastern Cape Uitenhage
Life Mercantile Hospital Eastern Cape Port Elizabeth
Port Elizabeth Provincial Hospital Eastern Cape Port Elizabeth
Life St James Hospital Eastern Cape East London
Uitenhage Hospital Eastern Cape Uitenhage
Horizon Eye Care Centre Free State Bloemfontein
Life Pasteur Hospital Free State Bloemfontein
Life Rosepark Hospital Free State Bloemfontein
Universitas Academic Hospital Free State Bloemfontein
Netcare Vaalpark Hospital Free State Sasolburg
Welkom (Bongani) Provincial Hospital Free State Welkom
Netcare Kroon Free State Kroonstad
Mediclinic Welkom Free State Welkom
Clinix Botshelong-Empilweni Private Hospital Gauteng Vosloorus
Netcare Bougainville Hospital Gauteng Pretoria West
Life Brenthurst Clinic Gauteng Parktown
Life Carstenhof Clinic Gauteng Midrand
Charlotte Maxeke Hospital Gauteng Parktown
Chris Hani Baragwanath Hospital Gauteng Soweto
Netcare Clinton Hospital Gauteng Alberton
Cormed Clinic Gauteng Vanderbijlpark
Life Dalview Clinic Gauteng Brakpan
Daxina Private Hospital Gauteng Lenasia
Lenmed Private Hospital Gauteng Lenasia
Lesedi Private Hospital Gauteng Soweto
Leslie Williams Memorial Hospital Gauteng Carletonville
Netcare Linmed Hospital Gauteng Benoni
Louis Pasteur Hospital Gauteng Pretoria
Midvaal Private Hospital Gauteng Vereeniging
Clinix Naledi-Nkanyezi Private Hospital Gauteng Sebokeng
Life Robinson Private Hospital Gauteng Randfontein
Life Roseacres Clinic Gauteng Primrose
Clinix Selby Park Hospital Gauteng Selby
Steve Biko Academic Hospital (Pretoria Academic) Gauteng Pretoria
TK Maternity Services Hospital Gauteng Katlehong
Clinix Tshepo-Themba Private Hospital Gauteng Soweto
Zamokhule Private Hospital Gauteng Tembisa
Addington Hospital Kwa-Zulu Natal Durban
Life Chatsmed Garden Hospital Kwa-Zulu Natal Chatsworth
City Hospital Kwa-Zulu Natal Durban
Life Empangeni Garden Clinic Kwa-Zulu Natal Empangeni
Isipingo Hospital Kwa-Zulu Natal Isipingo
Netcare Kokstad Private Hospital Kwa-Zulu Natal Kokstad
La Verna Hospital Kwa-Zulu Natal Ladysmith
Life Mount Edgecombe Hospital Kwa-Zulu Natal Phoenix
14
BLUE DOOR HOSPITAL NETWORK PROVINCE SUBURB
Mediclinic Newcastle Hospital Kwa-Zulu Natal Newcastle
Newcastle Provincial Hospital Kwa-Zulu Natal Newcastle
Mediclinic Victoria Private Hospital Kwa-Zulu Natal Tongaat
Mediclinic Limpopo Limpopo Polokwane
Mediclinic Tzaneen Limpopo Tzaneen
Mediclinic Thabazimbi Limpopo Thabazimbi
Life Cosmos Hospital Mpumalanga Witbank
Life Midmed Hospital Mpumalanga Middleburg
Mediclinic Barberton Mpumalanga Barberton
Mediclinic Nelspruit Mpumalanga Nelspruit
Mediclinic Brits North West Brits
Mediclinic Legae North West Rosslyn
Life Anncron Clinic North West Klerksdorp
Mooimed Private Hospital North West Potchefstroom
Life Peglerae Hospital North West Rustenburg
Itokolle-Victoria Private Hospital North West Mafikeng
Mediclinic Kathu Northern Cape Kathu
Mediclinic Kimberley Northern Cape Kimberley
Mediclinic Upington Northern Cape Uitenhage
Life Bay View Private Hospital Western Cape Mossel Bay
Melomed Bellville Medical Centre Western Cape Bellville
Netcare Blaauwberg Hospital Western Cape Blaauwberg
Mediclinic Cape Gate Western Cape Brackenfell
Ceres Private Hospital Western Cape Ceres
Melomed Gatesville Medical Centre Western Cape Athlone
Groote Schuur Hospital Western Cape Cape Town
Mediclinic Hermanus Western Cape Hermanus
Karl Bremmer Hospital Western Cape Bellville
Netcare Kuils River Hospital Western Cape Kuils River
Melomed Mitchells Plain Medical Centre Western Cape Mitchells Plain
Paarl Hospital Western Cape Paarl
Mediclinic Paarl Western Cape Paarl
Red Cross War Memorial Children's Hospital Western Cape Rondebosch
Mediclinic Stellenbosch Western Cape Stellenbosch
Stellenbosch Provincial Hospital Western Cape Stellenbosch
Swartland Hospital Western Cape Malmesbury
Tygerberg Hospital Western Cape Bellville
Victoria Hospital Western Cape Wynberg
Vredenburg Hospital Western Cape Vredenburg
Vredendal Hospital Western Cape Vredendal
Life West Coast Private Hospital Western Cape Vredenburg
Worcester Hospital Western Cape Worcester
Mediclinic Worcester Western Cape Worcester
Netcare Christiaan Barnard Memorial Hospital Western Cape Cape Town