+ All Categories
Home > Documents > NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX...

NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX...

Date post: 05-Feb-2018
Category:
Upload: doanthuy
View: 382 times
Download: 22 times
Share this document with a friend
1015
Transcript
Page 1: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 2: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 3: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NX10Tutorial

OnlineInstructor

Page 4: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 5: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

©Copyright2015OnlineInstructor

Page 6: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Thisbookmaynotbeduplicatedinanywaywithouttheexpresswrittenconsentofthepublisher,exceptintheformofbriefexcerptsorquotationsforthepurposeofreview.Theinformationcontainedhereinisforthepersonaluseofthereaderandmaynotbeincorporatedinanycommercialprograms,otherbooks,database,oranykindofsoftwarewithoutwritten

Page 7: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

consentofthepublisher.Makingcopiesofthisbookoranyportionforpurposeotherthanyourownisaviolationofcopyrightlaws.Limit ofLiability/Disclaimer ofWarranty:The author and publishermake no representations orwarrantieswithrespecttotheaccuracy or completeness ofthecontentsof thisworkand

Page 8: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

specifically disclaim allwarranties, including withoutlimitation warranties offitness for a particularpurpose. The advice andstrategies contained hereinmaynotbesuitableforeverysituation. Neither thepublishernortheauthorshallbe liable for damages arisingherefrom.Trademarks:Allbrandnamesandproduct

Page 9: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

names used in this book aretrademarks, registeredtrademarks,ortradenamesoftheir respective holders. Theauthor and publisher are notassociated with any productor vendor mentioned in thisbook.

Page 10: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 11: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 12: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ContentsIntroductionScopeofthisBookChapter1:GettingStartedStartingNXUserInterfaceQuickAccessToolbarFileMenuRibbonRibbonGroupsandMore

Page 13: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

GalleriesTopBorderBarMenuStatusbarResourceBarPartNavigatorRolesNavigatorTouchPanelTouchTabletDialogsMouseFunctionsLeftMousebutton(MB1)MiddleMousebutton(MB2)

Page 14: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

RightMousebutton(MB3)ColorSettingsShortcutKeysChapter2:ModelingBasicsTUTORIAL1StartingaNewPartFileStartingaSketchAddingDimensionsConstructingtheBaseFeatureAddinganExtrudedFeatureAddingConstraintsand

Page 15: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DimensionstotheSketchAddingDimensionsTrimmingSketchEntitiesExtrudingtheSketchAddinganotherExtrudedFeatureSavingthePartTUTORIAL2OpenaNewPartFileSketchingaRevolveProfileConstructingtheRevolvedFeatureConstructingtheCutfeatureAddinganotherCutout

Page 16: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingEdgeblendSavingthePartTUTORIAL3OpeningaNewPartFileConstructingtheRevolvedFeatureCreatingCutfeatureSavingthePartTUTORIAL4ConstructingExtrudedfeatureApplyingDraftSavingthePart

Page 17: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter3:ConstructingAssemblyTUTORIAL1CopyingthePartfilesintoanewfolderOpeningaNewAssemblyFileInsertingtheBaseComponentAddingthesecondcomponentCheckingtheDegreesofthe

Page 18: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

FreedomFixingtheFlangeHidingtheFlangeAddingtheThirdComponentShowingtheHiddenFlangeHidingtheReferencePlanes,sketches,andConstraintsymbolsSavingtheAssemblyStartingtheMainassemblyAddingDisctotheAssemblyFixingtheDisctotheOrigin

Page 19: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PlacingtheSub-assemblyPlacingsecondinstanceoftheSub-assemblySavingtheAssemblyTUTORIAL2ProducingtheExplodedviewCreatingTracelinesChapter4:GeneratingDrawingsTUTORIAL1OpeningaNewDrawingFile

Page 20: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

EditingtheDrawingSheetGeneratingtheBaseViewGeneratingtheSectionViewGeneratingtheDetailedViewSettingtheAnnotationPreferencesDimensioningtheDrawingViewsTUTORIAL2CreatingacustomtemplateAddingBordersandTitleBlock

Page 21: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OpeninganewdrawingfileusingthecustomtemplateGeneratingDrawingViewsAddingDimensionsTUTORIAL3CreatingtheassemblydrawingGeneratingtheExplodedViewGeneratingthePartlistGeneratingBalloonsChapter5:SketchingTUTORIAL1(Creating

Page 22: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Rectangles)Multi-SelectionGestureDrop-downTUTORIAL2(CreatingPolygons)TUTORIAL3(StudioSplines)TUTORIAL4(GeometricConstraints)AddingConstraintsAddingDimensionsTUTORIAL5(ResolvingOver-ConstrainedSketch)TUTORIAL6(Ellipses)

Page 23: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL7(Conics)TUTORIAL8(QuickExtend,QuickTrim,MakeCorner,andOffsetCurve)MakeCornerQuickTrimOffsetCurveTUTORIAL9FilletChamferMirrorCurveAddingDimensionsChapter6:

Page 24: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AdditionalModelingToolsTUTORIAL1ConstructingtheHelixAddingtheDatumPlaneConstructingtheSweepfeatureTUTORIAL2ConstructingtheGroovefeatureTUTORIAL3CreatingSectionsandGuidecurves

Page 25: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CreatinganothersectionConstructingthesweptfeatureConstructingtheExtrudedfeatureAddingtheEmbossfeatureAddingEdgeBlendShellingtheModelAddingThreadsTUTORIAL4ConstructingacylindricalshellAddingslotsConstructingtheLinear

Page 26: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

patternConstructingtheCircularpatternTUTORIAL5ConstructingtheTubefeaturePatterningtheTubegeometryBooleanOperationsTUTORIAL6ConstructingthefirstfeatureConstructingtheSecondFeatureConstructingthethird

Page 27: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

featureDrillingHolesAddingChamfersEditParametersShowDimensionsEditingFeaturesbyDouble-clickingSupressFeaturesTUTORIAL7ConstructingthefirstfeatureConstructingtheExtrudedcutConstructingtheExtrudedcut

Page 28: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MakingtheAlongPatternMeasuringtheMassPropertiesTUTORIAL8CreatingtheFirstFeatureCreatingtheExtrudedsurfaceTrimBodyVariableRadiusBlendCornerSetbacksCreatingaBossSplitBodyShellwithanAlternateThickness

Page 29: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OffsetFaceDeleteBodyScaleBodyExtractGeometryTUTORIAL9ReplaceFeaturesTUTORIAL10ApplyingDraftusingtheToPartingEdgesoptionTUTORIAL11TUTORIAL12TUTORIAL13Chapter7:

Page 30: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ExpressionsTUTORIAL1TUTORIAL2CreatingFamilyofPartsTUTORIAL3TUTORIAL4Chapter8:SheetMetalModelingTUTORIAL1OpeningaNewSheetmetalFileSettingtheParametersoftheSheetMetalpart

Page 31: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheTabFeatureAddingaflangeConstructingtheContourFlangeAddingtheClosedCornerAddingtheLouverMakingthePatternAlongcurveAddingtheBeadAddingtheDrawnCutoutAddingGussetsConstructingtheMirrorFeature

Page 32: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter9:Top-DownAssemblyTUTORIAL1CreatingaNewAssemblyFileCreatingacomponentintheAssemblyCreatingtheSecondComponentoftheAssemblyCreatingthethirdComponentoftheAssemblyEditingtheLinkedPartsCreatingHoleSeries

Page 33: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingFastenerstotheassemblyTUTORIAL2TUTORIAL3CreatingtheDeformablePartAddingtheDeformableparttoanAssemblyChapter10:DimensionsandAnnotationsTUTORIAL1CreatingaViewwithCenter

Page 34: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MarksCreatingCenterlinesandCenterMarksEditingtheHatchPatternApplyingDimensionsAttachTexttoDimensionsPlacingtheDatumFeatureSymbolPlacingtheFeatureControlFramePlacingtheSurfaceTextureSymbolsChapter11:

Page 35: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SimulationHandsonTutorialTUTORIAL1PreparingtheIdealizedPartMeshingtheFEMfileApplyingLoadsandConstraintstotheSimulationfileSimulatingtheModel

Page 36: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 37: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Introduction

NX as a topic of learning isvast, and having a wide

Page 38: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

scope.Itisoneoftheworld’smost advanced and highlyintegrated CAD/CAM/CAEproduct. NX delivers a greatvalue to enterprises of allsizes by covering the entirerange of productdevelopment.Itspeedsupthedesignprocessbysimplifyingcomplexproductdesigns.

This tutorial book provides asystematicapproachforusersto learn NX 10. It is aimed

Page 39: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

for those with no previousexperience with NX.However, users of previousversionsofNXmayalsofindthis book useful for them tolearn the new enhancements.Theuserwillbeguidedfromstarting a NX 10 session toconstructing parts,assemblies, and drawings.Eachchapterhascomponentsexplained with the help ofvarious dialogs and screenimages.

Page 40: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ScopeofthisBook

ThisbookiswrittenforstudentsandengineerswhoareinterestedtolearnNX10fordesigningmechanicalcomponentsandassemblies,andthengeneratedrawings.

Thisbookprovidesasystematicapproachfor

Page 41: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

learningNX10.ThetopicsincludeGettingStartedwithNX10,BasicPartModeling,ConstructingAssemblies,ConstructingDrawings,AdditionalModelingTools,andSheetMetalModeling.

Chapter1introducesNX10.Theuserinterface,terminology,mousefunctions,andshortcutkeysarediscussedinthischapter.

Page 42: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter2takesyouthroughthecreationofyourfirstNXmodel.Youconstructsimpleparts.

Chapter3teachesyoutoconstructassemblies.ItexplainstheTop-downandBottom-upapproachesfordesigninganassembly.YouconstructanassemblyusingtheBottom-upapproach.

Chapter4teachesyouto

Page 43: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

generatedrawingsofthemodelsconstructedintheearlierchapters.Youwillalsolearntogenerateexplodedviews,andpartlistofanassembly.Chapter5:Inthischapter,youwilllearnthetoolsneededtocreate2Dsketches.

Chapter6:Inthischapter,youwilllearnadditionalmodelingtoolstoconstruct

Page 44: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

complexmodels.Chapter7:Thischapterhelpsyoutocreate,edit,anduseexpressionsinyourdesigns.

Chapter8:introducesyoutoNXSheetMetaldesign.YouwillconstructasheetmetalpartusingthetoolsavailableintheNXSheetMetalenvironment.

Page 45: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter9:teachesyoutocreateanassemblyusingTop-downdesignapproach.Chapter10:teachesyoutoadddimensionsandannotationstoyourdrawings.Chapter11:introducesyoutoFiniteElementAnalysis.

Page 46: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter1:GettingStarted

Inthischapter,youwilllearnsomeofthemostcommonlyusedfeaturesofNX.Also,youwilllearnabouttheuserinterface.

Page 47: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

InNX,youconstruct3Dpartsandusethemtogenerate2Ddrawingsand3Dassemblies.

NXisFeatureBased.Featuresareshapesthatarecombinedtobuildapart.Youcanmodifytheseshapesindividually.

Page 48: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 49: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Mostofthefeaturesaresketch-based.Asketchisa2Dprofileandcanbeextruded,revolved,orsweptalongapathtoconstructfeatures.

Page 50: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NXisparametricinnature.Youcanspecifystandardparametersbetweenthe

Page 51: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

elementsofapart.Changingtheseparameterschangesthesizeandshapeofthepart.Forexample,seethedesignofthebodyofaflangebeforeandaftermodifyingtheparametersofitsfeatures

Page 52: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

StartingNX1. ClicktheStartbutton

ontheWindows

Page 53: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

taskbar.2. Clickthearrow

pointingdownward.3. ClickSiemensNX

10.0>NX10.0.4. ClicktheNewbutton.5. OntheNewdialog,

clickTemplates>Model.

6. ClicktheOKbutton

Page 54: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 55: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NoticetheseimportantfeaturesoftheNXwindow.

UserInterfaceVariouscomponentsoftheuserinterfacearediscussednext.QuickAccessToolbar

Page 56: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

This is locatedat the top leftcorner of the window. Itconsists of the commonlyusedcommandssuchasSave,Undo, Redo, Copy, and soon.FileMenu

Page 57: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TheFileMenuappearswhenyou click on the File iconlocated at the top left cornerof the window. The FileMenu consists of a list ofself-explanatory menus. Youcan see a list of recentlyopened documents under theRecently Opened Partssection. You can also switchto different applications ofNX.

Page 58: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

RibbonAribbonisasetoftools,whichareusedtoperformvariousoperations.Itisdividedintotabsandgroups.Varioustabsoftheribbonarediscussednext.HometabThis ribbon tab contains thetools such as New, Open,andHelp,andsoon.

Page 59: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

HometabintheModeltemplateThis ribbon tab contains thetoolstoconstruct3Dfeatures.

Page 60: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ViewtabThis ribbon tab contains thetoolstomodifythedisplayofthemodelanduserinterface.

AnalysistabThis ribbon tab has the toolstomeasuretheobjects.Italsohastoolstoanalyzethedraft,curvature,andsurface.

Page 61: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

HometabinSketchTaskenvironmentThis ribbon tab contains allthe sketch tools. It isavailable in a separateenvironment called SketchTask environment. TheSketch Task environment isactivatedwhenyouactivateaFeature modeling tool and

Page 62: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

click on a planar face orDatumplane.

ToolstabThis ribbon tab contains thetools to create expressions,part families, movies,fasteners.

Page 63: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

RendertabThis ribbon tab contains thetools to generatephotorealisticimages.

Page 64: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ApplicationtabThis ribbon tab contains thetools to start differentapplications such asAssemblies, Sheet Metal,Drafting,andsoon.

Page 65: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AssembliestabThis tabcontains the tools toconstruct an assembly. It isavailable in the Assemblytemplate.

Page 66: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DraftingenvironmentribbonIn theDraftingEnvironment,you can generateorthographicviewsofthe3Dmodel.Theribbontabsinthisenvironment contain tools togenerate2Ddrawings.

Page 67: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SheetMetalribbonThe tools in this ribbon areused to construct sheetmetalcomponents.

Sometabsarenotvisiblebydefault.Todisplayaparticulartab,right-clickon

Page 68: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theribbonandselectitfromthelistdisplayed.

Page 69: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 70: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

YoucanalsoaddaribbontabbyopeningtheCustomizedialog.Clickthedownarrowlocatedatthebottomrightcorneroftheribbon,andselectCustomize.OntheCustomizedialog,clickondifferenttabandselect/deselecttheoptions.

Page 71: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 72: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

RibbonGroupsandMoreGalleriesThetoolsonaribbonarearrangedinvariousgroupsdependingupontheiruse.EachgrouphasaMoreGallery,whichcontainadditionaltools.

Page 73: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Youcanaddmoretoolstoa

Page 74: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ribbongroupbyclickingthearrowlocatedatthebottomrightcornerofagroup.

Page 75: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TopBorderBarThisisavailablebelowtheribbon.Itconsistsofalltheoptionstofiltertheobjectsthatcanbeselectedfromthegraphicswindow.

MenuMenu is located on the TopBorder Bar. It consists ofvariousoptions (menu titles).

Page 76: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

When you click on a menutitle, a drop-down appears.You can select the requiredoptionfromthisdrop-down.

Page 77: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

StatusbarThisisavailablebelowthegraphicswindow.Itdisplaysthepromptsandtheactiontakenwhileusingthetools.

ResourceBarThisislocatedattheleftsideofthewindow.Itcontainsall

Page 78: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thenavigatorwindowssuchasAssemblyNavigator,ConstraintNavigator,PartNavigator,andsoon.

PartNavigatorContainsthelistofoperationscarriedwhileconstructingapart.

Page 79: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

RolesNavigatorTheRolesNavigator(click

Page 80: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theRolestabontheResourceBar)containsalistofsystemdefaultandindustryspecificroles.Aroleisasetoftoolsandribbontabscustomizedforaspecificapplication.Forexample,theCAMExpressrolecanbeusedforperformingmanufacturingoperations.ThistextbookusestheDefaultrole.

Page 81: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TheTouchPanelandTouchTabletroleshelpyoutowork

Page 82: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

withaMulti-touchscreen.TouchPanel

Page 83: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TouchTablet

Dialogs

Page 84: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

When you execute anycommand in NX, the dialogrelated to it appears. Thedialog consists of variousoptions.Thefollowingfigureshowsvariouscomponentsofthedialog.

Page 85: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 86: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Thistextbookusesthedefaultoptionsinthedialog.Ifyouhavemadeanychangesonthedialog,clicktheResetbuttontodisplaythedefaultoptions.

MouseFunctionsVariousfunctionsofthemousebuttonsarediscussednext.

Page 87: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

LeftMousebutton(MB1)Whenyoudouble-clicktheleftmousebutton(MB1)onanobject,thedialogrelatedtotheobjectappears.Usingthisdialog,youcanedittheparametersoftheobjects.

MiddleMousebutton(MB2)Clickthisbuttontoexecute

Page 88: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theOKcommand.

RightMousebutton(MB3)Clickthisbuttontodisplaytheshortcutmenu.

Page 89: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Theotherfunctionswithcombinationofthethreemousebuttonsaregivennext.

Page 90: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 91: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ColorSettingsTochangethebackgroundcolorofthewindow,click

Page 92: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

View>Visualization>More>EditBackground;theEditBackgrounddialogappears.ClickthePlainoptiontochangethebackgroundtoplain.Clickonthecolorswatches;theColordialogappears.ChangethebackgroundcolorandclickOKtwice.

Page 93: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ShortcutKeys

Page 94: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CTRL+ZCTRL+YCTRL+SF5F1F6F7CTRL+M

CTRL+SHIFT+D

Page 95: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CTRL+SHIFT+M

CTRL+ALT+M

XCTRL+1CTRL+DCTRL+NCTRL+OCTRL+P

Page 96: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 97: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 98: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 99: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 100: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 101: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter2:ModelingBasics

ThischaptertakesyouthroughthecreationofyourfirstNXmodel.Youconstructsimpleparts:

Page 102: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Inthischapter,youwill:

ConstructSketchesConstructabasefeatureAddanotherfeaturetoitConstructrevolvedfeaturesApplydraft

Page 103: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL1ThistutorialtakesyouthroughthecreationofyourfirstNXmodel.YouconstructtheDiscofanOldhamcoupling:

Page 104: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

StartingaNewPartFile1. Tostartanewpart,

clicktheNew

Page 105: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

buttononribbon;theNewdialogappears.

2. TheModeltemplateisthedefaultselection,soclickOK;anewmodelwindowappears.

StartingaSketch1. Tostartanewsketch,

clicktheSketchbuttonontheDirectSketchgroup;theCreateSketchdialogappears.

Page 106: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. SelecttheXZplane.

3. ClicktheOKbutton

Page 107: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ontheCreateSketchdialog;thesketchstarts.

Thefirstfeatureisanextrudedfromasketchedcircularprofile.Youwillbeginbysketchingthecircle.

4. ClickCircle ontheDirectSketchgroup.

5. Movethepointertothesketchorigin,andthen

Page 108: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

click.6. Dragthepointerand

clicktodrawacircle.

7. PressESCtoquitthetool.

Page 109: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingDimensionsInthissection,youwillspecifythesizeofthesketchedcirclebyaddingdimensions.

Note:Youmaynoticethatdimensionsareappliedautomatically.However,theydonotconstraintthesketch.

Asyouadddimensions,thesketchcanattainanyoneof

Page 110: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thefollowingthreestates:

FullyConstrainedsketch:Inafullyconstrainedsketch,thepositionsofalltheentitiesarefullydescribedbydimensionsorconstraintsorboth.Inafullyconstrainedsketch,alltheentitiesaredarkgreencolor.

UnderConstrainedsketch:Additionaldimensionsorconstraintsorbothareneeded

Page 111: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

tocompletelydefinethegeometry.Inthisstate,youcandragthesketchelementstomodifythesketch.Anunderconstrainedsketchelementisinmarooncolor.

OverConstrainedsketch:Inthisstate,anobjecthasconflictingdimensionsorrelationsorboth.Anoverconstrainedsketchentityisgrey.Theoverconstrainingdimensionsareinredcolor.

Page 112: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Double-clickonthe

dimensiondisplayedonthesketch;theDimensioneditboxappears.

2. Tochangethedimensionto100mm,typeanewvalue,andthenpressEnter.

3. PressEsctoquittheDimensiontool.

Todisplaytheentirecircleat

Page 113: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

afullsizeandtocenteritinthegraphicsarea,useoneofthefollowingmethods:

ClickFit onTopBorderBar.Ontheribbon,clickView>Orientation>Fit.

4. Ontheribbon,click

Home>DirectSketch

>FinishSketch .

Page 114: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Tochangetheviewtoisometric,clickOrientViewDrop-down>IsometricontheTopBorderBar.

YoucanusethebuttonsontheOrientViewDrop-downontheTopBorderBartosetthevieworientationofthe

Page 115: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

sketch,part,orassembly.

ConstructingtheBaseFeatureThefirstfeatureinanypartiscalledthebasefeature.Youconstructthisfeaturebyextrudingthesketchedcircle.1. Ontheribbon,Home

>Feature>Extrude;theExtrude

Page 116: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialogappears.2. Clickonthesketch.3. Type-in10intheEnd

boxattachedtothepreview.

4. Toseehowthemodelwouldlookifyouhaveextrudedthesketchintheoppositedirection,clickReverseDirection buttonintheDirectionsection.Again,clickonittoextrudethesketchin

Page 117: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thefrontdirection.5. EnsurethatBodyType

inSettingsgroupissettoSolid.

Page 118: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickOKtoconstructtheextrusion.

Noticethenewfeature,Extrude,inthePartNavigator.

Page 119: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Tomagnifyamodelorchangeitsorientationinthegraphicsarea,youcanusetheOrientationtoolsontheViewtab.

Page 120: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ClickFittodisplaythepartfullsizeinthecurrentwindow.

ClickZoom ,andthendragthepointertodrawarectangle;theareainthe

Page 121: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

rectanglezoomstofillthewindow.

ClickZoomIn/Out ,andthendragthepointer.Draggingupzoomsout;draggingdownzoomsin.NotethatthiscommandisavailableontheMoregallery.

Clickavertex,anedge,orafeature,andthenclickFit

Page 122: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ViewtoSelection ;theselecteditemzoomstofillthewindow.

Todisplaythepartindifferentmodes,clickthebuttonsintheStylegroupontheViewtab.

Page 123: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 124: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 125: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 126: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 127: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ThedefaultdisplaymodeforpartsandassembliesisShadedwithEdges.You

Page 128: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

maychangethedisplaymodewheneveryouwant.

AddinganExtrudedFeatureToconstructadditionalfeaturesonthepart,youneedtosketchonthemodelfacesorplanes,andthenconvertthemintofeatures.1. ClickStatic

Wireframe onthe

Page 129: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Viewtab.2. ClickSketchonthe

DirectSketchgroup.3. Clickonthefrontface

oftheparttoselectit,andthenclickOK.

4. ClickDirectsketch>MoreCurve>Project

Curve ontheribbon;theProjectCurvedialogappears.

5. Clickonthecircularedge.

Page 130: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickOKontheProjectCurvedialog;thecircularedgeprojectsontothesketchplane.

7. ClickLine onthe

Page 131: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DirectSketchgroup.8. Clickonthecircleto

specifythefirstpointoftheline.

9. Movethepointer

Page 132: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

towardsright.10. Clickonthecircle;a

lineisdrawn.

11. Drawanotherlineabovethepreviousline.

Page 133: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingConstraintsandDimensionstotheSketchToestablishthelocationand

Page 134: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

sizeofthesketch,youhavetoaddthenecessaryconstraintsanddimensions.1. Selectthelower

horizontalline.2. OntheShortcuts

toolbar,clickHorizontal .

3. Ontheribbon,clickDirectSketch>Moregallery>SketchConstrains>Make

Page 135: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Symmetric .4. Selectthefirstand

secondlines.5. SelecttheX-axisasthe

centerline;thetwolinesbecomesymmetricabouttheX-axis.

Page 136: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickCloseontheMakeSymmetricdialog.

AddingDimensions

Page 137: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Double-clickonthedimensiondisplayedinthesketch.

8. Type-in12intheboxdisplayed.

9. ClickCloseonthedialog.

TrimmingSketchEntities1. ClickTrimRecipe

Curve ontheDirectSketchgroup.

Page 138: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Clickontheprojectedelement.

3. Clickonthetwohorizontallines.

4. OntheTrimRecipeCurvedialog,clickDiscardundertheRegionsection.

5. ClickOKtotrimtheprojectedelements.

Page 139: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickFinishSketchontheDirectSketchgroup.

7. Tochangetheviewtoisometric,clickView>Orientation>

Page 140: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Isometric.

ExtrudingtheSketch1. Clickonthesketch,

andthenclickExtrudeontheShortcutstoolbar;theExtrudedialogappears.

Page 141: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Type-in10intheEndboxattachedtothepreview.

Page 142: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. ClickOKtoconstructtheextrusion.

4. Tohidethesketch,clickView>Showand

Page 143: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Hide .5. OntheShowandHide

dialog,clickHideintheSketchesrow;thesketchesarehidden.

Page 144: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddinganotherExtrudedFeature

Page 145: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Drawasketchonthebackfaceofthebasefeature(UsetheProfilecommandtocreatethelines,andthenprojecttheoutercircularedge.UsetheTrimRecipeCurvecommandtotrimtheprojectedcurve).

Page 146: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

YoucanusetheRotatebuttonfromtheViewtabtorotatethemodel.

Page 147: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Extrudethesketchup

to10mmthickness.

Tomovethepartview,clickView>Orientation>Pan,thendragtheparttomoveitaroundinthegraphicsarea.3. ClickView>Style>

ShadedwithEdgesontheribbon.

Page 148: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SavingthePart1. ClickSave onthe

QuickAccessToolbar;theName

Page 149: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Partsdialogappears.2. Type-inDiscinthe

NameboxandclicktheFolderbutton.

3. BrowsetotheNX10/C2folderandthenclicktheOKbuttontwice.

Note:*.prtisthefileextensionforallthefilesconstructedintheModeling,Assembly,andDraftingenvironmentsof

Page 150: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NX.

TUTORIAL2Inthistutorial,youconstructaflangebyperformingthefollowing:

ConstructingarevolvedfeatureConstructingacutfeaturesAddingfillets

Page 151: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OpenaNewPartFile1. Toopenanewpart,

clickFile>Newontheribbon;theNewdialogappears.

2. TheModelisthedefaultselection,soclickOK;anewmodelwindowappears.

SketchingaRevolveProfileYouconstructthebase

Page 152: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

featureoftheflangebyrevolvingaprofilearoundacenterline.1. ClicktheSketch

buttonontheDirectSketchgroup.

2. SelecttheYZplane.3. ClicktheOKbutton;

thesketchstarts.

4. ClickProfile ontheDirectSketchgroup.

Page 153: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Drawasketchsimilartothatshowninfigure.PressEsc.

6. Ontheribbon,clickDirectSketch>Moregallery>SketchConstraints>

Page 154: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

GeometricConstraints .

7. ClickOKonthemessagebox.

8. OntheGeometricConstraintsdialog,clickCollinear .

9. UndertheGeometrytoConstrainsection,checkAutomaticSelectionProgression.

10. Clickontheline1andtheY-axistomake

Page 155: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

themcollinear.

11. ClickRapidDimension ontheDirectSketchgroup.

12. SelecttheX-axisand

Page 156: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Line6;adimensionappears.

13. Placethedimensionandtype-in15inthedimensionbox.

14. PressEnterkey.15. SelecttheX-axisand

Line4;adimensionappears.

16. Setthedimensionto30.

17. SelecttheX-axisandLine2;adimensionappears.

Page 157: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. Setthedimensionto50mm.

19. CreateadimensionbetweentheY-axisandLine3.

20. Setthedimensionto20mm.

21. Createadimensionof50mmbetweenY-axisandLine5.

22. ClosetheRapidDimensiondialog.

Page 158: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

23. ClickFinishSketchon

theDirectSketchgroup.

24. Tochangetheviewtoisometric,click

Page 159: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

IsometricontheViewtab.

ConstructingtheRevolvedFeature1. Ontheribbon,click

Home>Feature>Extrude>Revolve;theRevolvedialogappears.

Page 160: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Clickonthesketch.3. ClickonSpecify

VectorintheAxisgroup;avectortriadappears.

4. ClickontheY-axisofthetriad.

Page 161: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Clickontheoriginpoint;thepreviewoftherevolvedfeatureappears.

Page 162: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Type-in360intheEndboxattachedtothepreview.

7. ClickOKtoconstructtherevolvedfeature.

Page 163: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheCutfeature1. ClickExtrudeonthe

Page 164: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Featuregroup.2. Rotatethemodel

geometryandclickthebackfaceofthepart;thesketchstarts.

3. Constructasketch,asshowninfigure(UsetheProfilecommandtocreatethelines,andthenprojecttheoutercircularedge.UsetheTrimRecipeCurvecommandtotrimtheprojectedcurve).

Page 165: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickFinishontheSketchgroup.

5. Enter10intheEndboxattachedtothe

Page 166: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

preview.6. ClickReverse

Direction intheDirectionsection.

7. SelectSubtractintheBooleansection.

8. ClickOKtoconstructthecutfeature.

Page 167: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddinganotherCut-out1. Drawasketchonthe

frontfaceofthemodel

Page 168: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

geometry(UsetheProfilecommandtocreatethelines,andthenprojecttheinnercircularedge.UsetheTrimRecipeCurvecommandtotrimtheprojectedcurve.Also,adddimensions).

Page 169: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Finishthesketch.3. ClickExtrudeonthe

Featuregroup.4. Clickonthesketch.5. OntheExtrudedialog,

selectEnd>Through

Page 170: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AllundertheLimitssection.

6. ClickReverseDirectionintheDirectionsection.

7. SelectSubtractintheBooleangroup.

8. ClickOKtoconstructthecut-outfeature.

9. Tochangetheviewtoisometric,clickIsometricontheViewtab.

Page 171: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingEdgeblend1. ClickHome>Feature

>EdgeBlend ;theEdgeBlenddialogappears.

Page 172: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. ClickontheinnercircularedgeandsetRadius1to5.

3. ClickOKtoaddtheblend.

Page 173: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SavingthePart1. ClickFile>Save>

Save;theNameParts

Page 174: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialogappears.2. TypeFlangeandclick

theFolderbutton.3. BrowsetoNX10/C2

folderandthenclickOKbuttontwice.

4. ClickFile>Close>AllParts.

TUTORIAL3Inthistutorial,youconstructaShaftbyperformingthefollowing:

Page 175: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingarevolvedfeatureConstructingacutfeature

OpeningaNewPartFile1. Toopenanewpart,

clicktheNewbuttonontheStandardgroup.

Page 176: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. SelecttheModeltemplateandclickOK;anewmodelwindowappears.

ConstructingtheRevolvedFeature1. ClickExtrude>

RevolveontheFeaturegroup.

2. ClicktheSketchSelection iconundertheSectionsectionof

Page 177: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theRevolvedialog.3. ClickontheYZplane

toselectit,andthenclickOK;thesketchstarts.

4. Ontheribbon,clickHome>Curve>Rectangle .

5. Selecttheoriginpointofthesketch.

6. Movethepointertowardtopleftcornerandclick.

Page 178: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Adddimensionstothesketch,asshowninfigure.

8. ClickFinishontheSketchgroup.

9. ClickontheY-axisofthetriad.

10. Clickontheoriginpoint;thepreviewappears.

Page 179: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. ClickOKtoconstructtherevolvedfeature.

CreatingCutfeature1. Constructasketchon

thefrontfaceofthemodelgeometry(UsetheProfilecommandtocreatethelines,andthenprojectthecircularedge.UsetheTrimRecipeCurvecommandtotrimthe

Page 180: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

projectedcurve.Also,adddimensions).

2. Finishthesketch.3. ClickExtrudeonthe

Featuregroup.

Page 181: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Clickonthesketch.5. Type-in55intheEnd

box.6. ClickReverse

DirectionintheDirectionsection.

7. SelectSubtractintheBooleangroup.

Page 182: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickOKtoconstructthecutfeature.

Page 183: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SavingthePart1. ClickFile>Save>

Save;theNamePartsdialogappears.

2. TypeShaftinthe

Page 184: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NameboxandclickFolderbutton.

3. BrowsetoNX10/C2folderandthenclickOKbuttontwice.

4. ClickFile>Close>AllParts.

TUTORIAL4Inthistutorial,youconstructaKeybyperformingthefollowing:

Page 185: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingaBlockApplyingdraft

ConstructingExtrudedfeature1. Openanewpartfile.2. Ontheribbon,click

Home>Feature>More>DesignFeature>Block .

3. OntheBlockdialog,selectType>OriginandEdgeLengths.

Page 186: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Type-in6,50,and6intheLength(XC),Width(YC),andHeight(ZC)boxes,respectively.

5. Clickontheoriginpointofthedatumcoordinatesystem.

Page 187: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickOKtoconstructtheblock.

Page 188: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ApplyingDraft1. ClickDraft onthe

Featuregroup.2. OntheDraftdialog,

selectType>FromPlaneorSurface.

3. ClickonY-axistospecifyvector.

Page 189: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Selectfrontfaceasthestationaryface.

5. ClickSelectFaceintheFacestoDraftsection.

6. Selectthetopface.

Page 190: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Type-in1intheAngle1box.

8. ClickOKtoaddthedraft.

Page 191: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SavingthePart1. ClickFile>Save>

Save;theNamePartsdialogappears.

2. TypeKeyintheNameboxandclickFolderbutton.

Page 192: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. BrowsetoNX10/C2folderandthenclickOKbuttontwice.

4. ClickFile>Close>AllParts.

Page 193: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 194: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter3:ConstructingAssembly

Page 195: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Inthischapter,youwill:

AddComponentstoanassemblyApplyconstraintsbetweencomponentsProduceexplodedviewoftheassembly

Page 196: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL1Thistutorialtakesyouthroughthecreationofyourfirstassembly.YouconstructtheOldhamcouplingassembly:

Page 197: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CopyingthePartfilesintoanewfolder1. Createafoldernamed

Oldham_Couplingat

Page 198: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thelocationNX10/C3.2. Copyallthepartfiles

constructedinthepreviouschaptertothisfolder.

OpeningaNewAssemblyFile1. Toopenanew

assembly,clickFile>New;theNewdialogappears.

Page 199: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. ClickAssemblyintheTemplategroup.

3. ClickOK;anewassemblywindowappears.Inaddition,theAddComponentdialogappears.

InsertingtheBaseComponent1. Toinsertthebase

component,clickOpen buttoninthe

Page 200: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PartsectionoftheAddComponentdialog.

2. BrowsetothelocationNX10/C3/Oldham_Couplinganddouble-clickonFlange.prt.

3. OntheAddComponentdialog,selectPositioning>AbsoluteOrigininthePlacementsection.

4. UndertheSettings

Page 201: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

section,selectReferenceSet>EntirePart.

5. ClickOKtoplacetheFlangeattheorigin.

Therearetwowaysofconstructinganyassemblymodel.

Top-DownApproachBottom-UpApproach

Top-DownApproach

Page 202: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Youopentheassemblyfile,andthenconstructcomponentsfilesinit.Bottom-UpApproachYouconstructthecomponentsfirst,andthenaddthemtotheassemblyfile.Inthistutorial,youconstructtheassemblyusingthisapproach.Addingthesecond

Page 203: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

component1. Toinsertthesecond

component,clickAssemblies>Component>Addontheribbon;theAddComponentdialogappears.

2. OntheAddComponentdialog,clickOpenbuttoninthePartsection.

Page 204: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. BrowsetothelocationNX10/C3/Oldham_Couplinganddouble-clickonShaft.prt.

4. UnderthePlacementsection,selectPositioning>ByConstraints.

5. UndertheSettingssection,selectReferenceSet>EntirePart.

6. ClickOKontheAdd

Page 205: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Componentdialog;theAssemblyConstraintsdialogappears.

Afteraddingthecomponentstotheassemblyenvironment,youhavetoapplyconstraintsbetweenthem.Byapplyingconstraints,youestablishrelationshipsbetweencomponents.Youcanapplythefollowingtypesofconstraintsbetween

Page 206: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

components.

TouchAlign:Usingthisconstraint,youcanmaketwofacescoplanartoeachother.NotethatifyousettheOrientationtoAlign,thefaceswillpointinthesamedirection.Youcanalsoalignthecenterlinesofthecylindricalfaces.

Page 207: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Concentric:Thisconstraintmakesthecentersofcircularedgescoincident.Inaddition,thecircularedgeswillbeonthesameplane.

Distance:Thisconstraintprovidesanoffsetdistancebetweentwoobjects.

Fix:Thisconstraintfixes

Page 208: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

acomponentatitscurrentposition.

Parallel:Thisconstraintmakestwoobjectsparalleltoeachother.

Perpendicular:Thisconstraintmakestwoobjectsperpendiculartoeachother.

Fit:Thisconstraint

Page 209: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

bringstwocylindricalfacestogether.Notethattheyshouldhavethesameradius.

Bond:Thisconstraintmakestheselectedcomponentsrigidsothattheymovetogether.

Center:Thisconstraintpositionstheselectedcomponentatacenterplane

Page 210: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

betweentwocomponents.

Angle:Appliesanglebetweentwocomponents.

Align/Lock:Alignstheaxesoftwocylindricalfacesandlockstherotation.7. OntheAssembly

Constraintsdialog,

Page 211: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

selectType>TouchAlign.

8. UndertheGeometrytoConstrainsection,selectOrientation>InferCenter/Axis.

9. OntheAssemblyConstraintsdialog,uncheckthePreviewComponentinMainWindowoption.

10. ClickonthecylindricalfaceoftheShaft.

Page 212: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. Clickonany

cylindricalfaceoftheFlange.

12. UndertheGeometrytoConstrainsection,selectOrientation>

Page 213: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Align.13. Clickonthefrontface

oftheshaft.

14. Rotatetheflangeandclickontheslotfaceasshowninfigure.

Page 214: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. ClickontheYZplane

oftheShaft.

Page 215: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. ClickontheXYplaneoftheFlange.

Page 216: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

17. ClickOKtoassemblethecomponents.

Page 217: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CheckingtheDegreesoftheFreedom

Page 218: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Tocheckthedegreesoffreedomofacomponent,clickAssemblies>ComponentPosition>ShowDegreesofFreedom .

2. ClickontheFlangetodisplaythedegreesoffreedom.

Page 219: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

YouwillnoticethattheFlangehassixdegreesoffreedom.

Page 220: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

FixingtheFlange1. Tofixtheflange,click

Assemblies>ComponentPosition>AssemblyConstraints ontheribbon.

2. OntheAssemblyConstraintsdialog,clickType>Fix.

3. ClickontheFlange,andthenclickOK.

4. Ontheribbon,click

Page 221: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

View>Orientation>More>Refresh .

5. Toviewthedegreesoffreedom,clickShowDegreesofFreedomontheComponentPositiongroupandselecttheFlangeandShaft.

Youwillnoticethattherearefullyconstrained.

Page 222: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

HidingtheFlange1. TohidetheFlange,

clickonitandselectHidefromthecontextualtoolbar.

Page 223: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheThirdComponent1. ClickAdd onthe

Componentgroup.2. OntheAdd

Componentdialog,

Page 224: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clicktheOpenbutton.3. Double-clickonthe

Key.prt.4. ClickOK.5. OntheAssembly

Constraintsdialog,selectType>TouchAlign.

6. UndertheGeometrytoConstraintssection,selectOrientation>Align.

7. ClickonthefrontfaceoftheKeyandfront

Page 225: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

faceoftheShaft.

Page 226: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickontheXYplaneoftheKey.

Page 227: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. Clickonthefaceontheshaftasshowninfigure.

Page 228: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. UndertheGeometryto

Constrainsection,selectOrientation>Touch.

11. ClickonthesidefaceoftheKeyandselect

Page 229: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thefaceonshaftasshowninfigure.

Page 230: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickOK.ShowingtheHiddenFlange1. Toshowthehidden

flange,clickView>Visibility>ShowAll

Page 231: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ontheribbon.

Page 232: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

HidingtheReferencePlanes,sketches,andConstraintsymbols1. Tohidethereference

planes,sketches,andconstraintsymbols,clickView>Visibility>ShowandHideontheribbon.

2. OntheShowandHidedialog,clickthehideiconsintheSketches,Datums,and

Page 233: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AssemblyConstraintsrows.

Page 234: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 235: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. ClickCloseonthe

dialog.

Page 236: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SavingtheAssembly1. ClickFile>Save>

Save;theNamePartsdialogappears.

2. Type-inFlange_subassemblyintheNameboxandclicktheFolderbutton.

3. BrowsetoNX10/C3/Oldham_CouplingfolderandthenclickOKbuttontwice.

Page 237: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickFile>Close>AllParts.

StartingtheMainassembly1. ClickFile>Newon

theribbon.2. OntheNewdialog,

clicktheAssemblytemplate.

3. Type-inMain_assemblyintheNameboxandclick

Page 238: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Folderbutton.4. BrowsetoNX10/C3/

Oldham_CouplingfolderandthenclickOKbuttontwice;theAddComponentdialogappears.

AddingDisctotheAssembly1. ClicktheOpenbutton.2. Double-clickon

Disc.prt.

Page 239: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. UnderthePlacementsection,selectPositioning>AbsoluteOrigin.

4. SetReferenceSettoModel.

5. ClickOKtoplacetheDiscattheorigin.

FixingtheDisctotheOrigin1. ClickAssemblies>

Component>

Page 240: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AssemblyConstraintsontheribbon;theAssemblyConstraintsdialogappears.

2. OntheAssemblyConstraintsdialog,selectType>Fix.

3. SelecttheDiscandclickOK.

Page 241: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PlacingtheSub-assembly1. ClicktheAdd

buttononthe

Page 242: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Componentgroup.2. ClicktheOpenbutton.3. Double-clickon

Flange_subassembly.prt4. OntheAdd

Componentdialog,selectPositioning>ByConstraints.

5. ClickOK;theAssemblyConstraintsdialogappears.

6. SetTypetoTouchAlign

7. SetOrientationto

Page 243: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Touch.8. Clickonthefaceofthe

Flangeasshowninfigure.

9. Clickonthefaceofthe

Page 244: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Discasshowninfigure.

10. SetTypetoConcentric.

Page 245: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. ClickonthecircularoftheFlange.

12. Clickonthecircular

edgeoftheDisc.

Page 246: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. ClickOKtoassemblethesubassembly.

PlacingsecondinstanceoftheSub-

Page 247: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

assembly1. Insertanotherinstance

oftheFlangesubassembly.

2. ApplytheTouchAlignandConcentricconstraints.NotethatyouhavetoclicktheReverseLastConstraintbuttonwhileapplyingtheConcentricconstraint.

Page 248: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SavingtheAssembly1. ClickSaveonthe

QuickAccessToolbar,orclickFile>Save.

Page 249: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL2Inthistutorial,youproducetheexplodedviewoftheassemblycreatedintheprevioustutorial.

Page 250: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ProducingtheExplodedview1. Toproducethe

explodedview,clickExplodedViews>

Page 251: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NewExplosion ;theNewExplosiondialogappears.

2. Type-inOldham_ExplosionintheNamebox.

3. ClickOK.4. OntheAssembly

Navigator,clicktherightmousebuttononFlange_subassemblyx2.

Page 252: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. SelectUnpack.6. Deselectthe

Flange_subassemblyinstances.

7. ClickExplodedViews>EditExplosionontheribbon;theEdit

Page 253: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Explosiondialogappears.

8. SelectFlange_subassemblyfromtheAssemblyNavigator.

9. ClickMoveObjects

Page 254: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

onthedialog;thedynamictriadappearsontheflangesubassembly.

10. ClicktheSnapHandlestoWCSbuttonontheEdit

Page 255: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Explosiondialog;thedynamictriadsnapstoWCS.

11. ClicktheY-Handleon

thedynamictriad.

Page 256: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Enter-100intheDistancebox.

13. ClickOKtoexplodetheflangesubassembly.

14. ClickEditExplosionbuttononthe

ExplodedViews

Page 257: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

group.15. ClickSelectObjects

ontheEditExplosiondialog.

16. RotatethemodelandselecttheKeyfromtheassembly.

17. ClickMoveObjectsonthedialog.

18. ClickSnapHandlestoWCS button.

Page 258: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 259: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

19. ClicktheY-Handleonthedynamictriad.

20. Enter80intheDistancebox.

21. ClickOKtoexplodetheKey.

22. ActivatetheEditExplosiondialog.

Page 260: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

23. ExplodetheshaftinY-directionuptothedistanceof-80mm.

24. Likewise,explodethe

otherflangesubassemblyandits

Page 261: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

partsintheoppositedirection.Theexplosiondistancesaresame.

CreatingTracelines

Page 262: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Tocreatetracelines,clickExplodedViews>Tracelines ontheribbon;theTracelinesdialogappears.

2. ClickonthecenterpointoftheFlange.

Page 263: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. OntheTracelines

dialog,selectEndObject>Point.

4. Clickonthecenterpointofthecircularedgeoftheshaft.

Page 264: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClickOKtocreatethe

traceline.

Page 265: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClicktheTracelinesbuttononthe

ExplodedViewsgroup.

Page 266: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. UndertheStartsection,selectInferred>EndPoint .

8. Selecttheedgeonthekeywayoftheshaft.

Page 267: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. Double-clickonthe

arrowdisplayedontheedgetoreversethedirection.

10. UndertheEndsection,selectInferred>EndPoint.

11. Clickontheedgeonthekey.

Page 268: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Double-clickonthe

arrowtoreversethedirection.

Page 269: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. ClickOKtocreatethe

traceline.14. Createtracelines

betweentheotherparts.15. Changetheviewto

Page 270: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

WireframewithHiddenEdges.

16. ClickSaveontheQuickAccessToolbar,orclickFile>Save.

Page 271: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter4:GeneratingDrawings

Inthischapter,yougeneratedrawingsofthepartsandassemblyfrompreviouschapters.

Page 272: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Inthischapter,youwill:

OpenandeditadrawingtemplateInsertstandardviewsofapartmodelAddmodelandreferenceannotationsAddanotherdrawingsheetInsertexplodedviewoftheassemblyInsertabillof

Page 273: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

materialsoftheassemblyApplyballoonstotheassembly

TUTORIAL1Inthistutorial,youwillgeneratedrawingsofpartsconstructedinpreviouschapters.

Page 274: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 275: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OpeningaNewDrawingFile1. StartNX10.2. Toopenanew

drawing,clicktheNewbuttonontheStandardgroup,orclickFile>New.

3. OntheNewdialog,selecttheDrawingtab.

4. ClickA3-Sizeinthe

Page 276: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Templatesection.5. ClickOK;anew

drawingwindowappears.Inaddition,thePopulateTitleBlockdialogappears.

6. Selecttheindividuallabelsandtype-intheirvalues.

7. ClicktheClosebuttononthisdialog.

EditingtheDrawing

Page 277: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Sheet1. Toeditthedrawing

sheet,clickHome>NewSheet>EditSheet ontheribbon;theSheetdialogappears.

2. ExpandtheSettingssectionandsetUnitstoMillimeters.

3. SettheProjectiontypeto3rdAngleProjection .

Page 278: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickOKontheSheetdialog.

GeneratingtheBaseView1. Togeneratethebase

view,clickBaseViewontheViewgroup;

theBaseViewmessageboxappears.

2. ClickYesonthemessagebox;thePart

Page 279: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Namedialogappears.3. Browsetothelocation

NX10/C3/Oldham_Couplinganddouble-clickonFlange.prt;theBaseViewdialogappears.

Inaddition,theviewappearsalongwiththepointer.4. UndertheModelView

section,selectModelViewtoUse>Front.

Page 280: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Placetheviewasshowninfigure;theProjectedViewdialogappears.

6. ClickClosetoclosethedialog.

Page 281: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

GeneratingtheSectionView1. Togenerateasection

view,clickHome>

Page 282: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

View>SectionViewontheribbon;the

SectionViewdialogappears.

2. Clickonthebaseview;thesectionlineappears.

3. Clickonthecenterpointofthebaseview.

Page 283: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Dragthepointertowardrightandclicktopositionthesectionview.

Page 284: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Generatingthe

Page 285: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DetailedViewNow,youneedtogeneratethedetailedviewofthekeywaythatappearsonthefrontview.1. Togeneratethe

detailedview,clickDetailView buttonontheViewgroup.

2. OntheDetailViewdialog,selectType>Circular.

Page 286: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Specifythecenterpointandboundarypointofthedetailviewasshown.

Page 287: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. UndertheScalesection,selectScale>2:1.

5. Positionthedetailviewbelowthebaseview.

Page 288: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SettingtheAnnotationPreferences1. Tosettheannotation

preferences,clickFile>Preferences>Drafting;theDraftingPreferencesdialogappears.

Page 289: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Onthedialog,type-in

OrientationandLocationintheFindboxandpressEnter.

3. SettheOrientationvaluetoHorizontaltext.

Page 290: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Onthedialog,select

Dimension>Text>Unitfromthetree.

5. SettheDecimalDelimitervalueto.Period.

Page 291: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Onthedialog,select

Dimension>Text>DimensionTextfromthetree.

7. UndertheFormatsection,type-in3.5intheHeightbox.

Page 292: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. SelectCommon>Line/Arrow>Arrowheadfromthetree.

9. UndertheWorkflowsection,checktheAutomaticOrientationoption.

10. UndertheFormatsection,type-in3.5and30intheLengthandAngleboxes,respectively.

11. ClickCommon>

Page 293: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Line/Arrow>ExtensionLine.

12. Type-in1intheGapboxes.

13. Typein2intheExtensionLineOverhang.

14. ClickCommon>Lettering.

15. UndertheTextParameterssection,type-in3.5inHeightbox,

16. ClickOK.

Page 294: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DimensioningtheDrawingViews1. Toadddimensions,

clickHome>Dimension>RapidDimension ontheribbon.

2. Onthesectionview,clickthehorizontallinelocatedatthetop.

Page 295: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Dragthepointerupandclicktopositionthedimension.

Page 296: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Clickontheendsofthesectionview,asshown.

Page 297: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Dragthepointerupandclicktopositionthedimension.

Page 298: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Addanotherlinear

Page 299: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dimensiontothesectionview.

Page 300: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Onthesectionview,clickonthearclocateatthebottom.

Page 301: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. Dragthepointerdownwardandclickto

Page 302: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

positiontheradialdimension.

Page 303: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. OntheRapid

Dimensiondialog,undertheMeasurementsection,selectMethod>Cylindrical.

10. Clickontheendsofthe

sectionview,asshown.

Page 304: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. Dragthepointerrightwardsandclicktopositionthedimension.

Page 305: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Createtheotherdimensionsonthe

Page 306: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

sectionview,asshown.

13. Createtheradial

Page 307: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dimensiononthefrontview,asshown.

14. Rightclickontheradialdimensionand

Page 308: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

selectEdit .15. Createthedimensions

onthedetailview,asshown.

SavingtheDrawing1. OntheQuickAccess

Toolbar,clickSave;theNamePartsdialog

Page 309: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

appears.2. Type-inFlange

DrawingintheNameboxandclickFolderbutton.

3. BrowsetoNX10/C3folderandthenclickOKbuttontwice

4. Closethedrawing.

Page 310: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL2Inthistutorial,yougeneratethedrawingoftheDiscconstructedinChapter1.

Creatingacustomtemplate1. ClosetheNX9

applicationwindow.2. ClickStart>Apps>

SiemensNX10.0.3. RightclickontheNX

10.0iconandselect

Page 311: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Runasadministrator.4. ClickOKonthe

messagebox.5. Ontheribbon,clickthe

Newbutton.6. OntheNewdialog,

double-clickontheModeltemplate.

7. Ontheribbon,clickApplications>Design

>Drafting .8. OntheSheetdialog,

selectStandardSize.

Page 312: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. SetSizetoA3–297x420.

10. SetScaleto1:1.11. UndertheSettings

section,setUnitstoMillimeters.

12. Select3rdAngleProjectionanduncheckAlwaysStartDrawingViewCommand.

13. ClickOKtoopenablanksheet.

Page 313: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingBordersandTitleBlock1. Ontheribbon,click

DraftingTools>DrawingFormat>BordersandZonesontheribbon.

2. OntheBordersandZonesdialog,leavethedefaultsettingsandclickOK.

Page 314: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Ontheribbon,click

Home>Table>TabularNote .

4. OntheTabularNotedialog,underthe

Page 315: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Originsection,expandtheAlignmentsectionandselectAnchor>BottomRight.

5. UndertheTableSizesection,setNumberofColumnsto3andNumberofRowsto2.

6. Type-in50inColumnWidthbox.

7. Clickonthebottomrightcornerofthesheetborder.

Page 316: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickCloseontheTabularNotedialog.

9. Clickontheleftverticallineofthetabularnote.

10. Presstheleftmousebuttonanddragtoward

Page 317: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

right.11. Releasetheleftmouse

buttonwhencolumnwidthischangedto35.

12. Likewise,changethewidthofthesecondandthirdcolumns.

Page 318: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. Clickinsidethesecondcellofthetoprow.

14. Presstheleftmousebuttonanddragtothethirdcell.

15. ClicktherightmousebuttonandselectMergeCells.

Page 319: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. Changetheheightof

thetoprow.

Page 320: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

17. ClickYesonthe

messagebox.18. Clicktherightmouse

buttoninthesecondcellofthetoprow.SelectSettings.

19. OntheSettingsdialog,selectPrefix/Suffixfromthetree.

20. Type-inTitle:inthe

Page 321: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Prefixbox.21. ClickClose.

22. Likewise,addprefixes

toothercells.

23. Clicktherightmousebuttoninthefirstcellofthetoprow.

Page 322: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

24. ClickImport>Image.25. Selectyourcompany

logoimageandclickOK.

26. Ontheribbon,clickDraftingTools>DrawingFormat>DefineTitleBlock .

27. Clickonthetable,andthenclickOK.

28. Ontheribbon,clickDraftingTools>DrawingFormat>

Page 323: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MarkasTemplate .29. Onthedialog,select

MarkasTemplateandUpdatePAXFile.

30. UnderthePAXFileSettingssection,type-inCustomTemplateinthePresentationNamebox.

31. SelectTemplateType>ReferenceExistingPart.

32. ClicktheBrowse

Page 324: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

icon.33. GotoC:\ProgramFiles\Siemens\NX10.0\LOCALIZATION\prc\english\startup34. Click

ugs_drawing_templates35. ClickOK.36. OntheInput

Validationbox,clickYes.

37. ClickOKtwice.38. Ontheribbon,click

DraftingTools>

Page 325: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TrackDrawingChanges>Create

SnapshotData .39. ClickOKonthe

messagebox.40. Saveandclosethefile.Openinganewdrawingfileusingthecustomtemplate1. Ontheribbon,click

theNewbutton.

Page 326: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OntheNewdialog,undertheDrawingtab,selectRelationship>ReferenceExistingPart.

3. UndertheTemplatessection,selectCustomTemplate.

4. UndertheParttocreateadrawingofsection,clicktheBrowse button.

5. OntheSelectmaster

Page 327: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

partdialog,clickOpen .

6. GotothelocationofDisc.prtanddouble-clickonit.

7. ClickOKtwice.8. OnthePopulateTitle

Blockdialog,type-invalues,asshown.

9. ClickClose.

Page 328: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

GeneratingDrawingViews

Page 329: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. OntheViewCreationWizarddialog,selectLoadedParts>Disc.prt.

2. ClickNext.3. OntheOptionspage,

selectViewBoundary>Manual.

4. UnchecktheAuto-ScaletoFitoption.

5. SelectScale>1:1.6. SelectHiddenLines>

Dashed.7. ClickNext.

Page 330: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. OntheOrientationpage,selectModelViews>Front.

9. ClickNext.10. OntheLayoutpage,

selecttheview,asshown.

Page 331: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. SelectOption>Manual.

12. Clicktodefinethe

centeroftheviews,asshown.

Page 332: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingDimensions1. Addcenterlinesand

dimensionstothedrawing.

Page 333: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Saveandclosethedrawingfile.

Page 334: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL3Inthistutorial,youwillgeneratethedrawingofOldhamcouplingassemblycreatedinthepreviouschapter.

Creatingtheassemblydrawing1. Openthe

Main_assembly.prtfile.

2. ClickApplications>

Page 335: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Design>Drafting.3. OntheSheetdialog,

selectStandardSize.4. SetSizetoA3-297x

420.5. SetScaleto1:2.6. UndertheSettings

section,checkAlwaysStartViewCreation.

7. SelectBaseViewcommand.

8. ClickOK.9. OntheBaseView

dialog,underthe

Page 336: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ModelViewsection,selectModelViewtoUse>Isometric.

10. UndertheScalesection,selectScale>1:2.

11. Clickontheleftsideofthedrawingsheet.

12. ClickCloseontheProjectedViewdialog.

Page 337: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

GeneratingtheExplodedView1. Ontheribbon,click

Home>View>BaseView.

Page 338: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OntheBaseViewdialog,selectModelViewtoUse>Trimetric.

3. Clickontherightsideofthedrawingsheet.

4. ClickClose.

Page 339: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

GeneratingthePartlist1. Togenerateapartlist,

clickHome>Table>

Page 340: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PartList ontheribbon.

2. Placethepartlistatthetop-rightcorner.

GeneratingBalloons1. Togenerateballoons,

clickHome>Table>AutoBalloon onribbon.

2. Selectthepartlist.3. ClickOK.

Page 341: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. OnthePartListAuto-Balloondialog,selectTrimetric@2.

5. ClickOKtogenerate

balloons.

Page 342: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Saveandclosethefile.

Page 343: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter5:SketchingInthischapter,youwilllearnthesketchingtools.Youwilllearntocreate:

RectanglesPolygonsResolvingSketchGeometricConstraints

Page 344: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

StudioSplinesEllipsesCirclesArcsTrimFilletsandChamfers

TUTORIAL1(CreatingRectangles)A rectangle is a four-sidedobject. You can create arectangle by just specifyingits two diagonal corners.

Page 345: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

However, there are variousmethodstocreatearectangle.Thesemethods are explainednext.

1. Ontheribbon,clickDirectSketch>SketchandselecttheFrontplane.

2. Ontheribbon,clickDirect

Page 346: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Sketch>Rectangle .

3. Selecttheoriginpointtodefinethefirstcorner.

4. Move the pointerandclicktodefinethesecondcorner.

Page 347: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

YoucanalsotypetheWidthand Height values to createtherectangle.

5. OntheRectangletoolbar,clickthe3

Points icon

Page 348: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

undertheRectangleMethodsection.Thisoptioncreatesaslantedrectangle.

6. Selecttwopointstodefinethewidthandinclinationangleoftherectangle.

Page 349: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Selectthethirdpointtodefineitsheight.

Page 350: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. OntheRectangletoolbar,clickthe

FromCentericonundertheRectangleMethodsection.

9. Clicktodefinethecenterpointoftherectangle.

10. Movethepointerandclicktodefinethemidpointof

Page 351: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

oneside.Also,theinclinationangleisdefined.

11. Movethepointerandclicktodefinethecornerpoint.

Page 352: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. ClickClose on

theRectangletoolbar.

Multi-SelectionGestureDrop-downThisdrop-downisavailable

Page 353: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ontheTopBorderBarandhasoptionstoselectmultipleobjects.TheRectangleoptionhelpsyoutoselectmultipleelementsbydraggingarectanglecoveringthem.TheLassooptionhelpsyoutoselectmultipleelementsbydraggingthepointeraroundthem.1. OntheTopBorder

Bar,selectLasso

Page 354: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

fromtheMulti-SelectionGestureDrop-down.

2. OntheTopBorderBar,SelectionScopetoWithinActiveSketchOnly.

3. Pressandholdtheleftmousebuttonanddrag

Page 355: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thepointercoveringalltherectangles.

4. PressDeletetoerasetherectangles.

5. ClickOK.

Page 356: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL2(CreatingPolygons)APolygonisashapehavingmanysidesrangingfrom3to513.InNX,youcancreateregularpolygonshavingsideswithequallength.Followthestepsgivennexttocreateapolygon.1. ActivatetheDirect

Sketchmode.2. Ontheribbon,click

Page 357: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DirectSketch>Polygon .

3. OnthePolygondialog,type8intheNumberofSidesboxundertheSidessection.

4. UndertheSizesection,selectSize>InscribedRadius.Thisoptioncreatesapolygonwithitssidestouchinganimaginarycircle.Youcanalsoselectthe

Page 358: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CircumscribedRadiusoptiontocreateapolygonwithitsverticestouchinganimaginarycircle.

5. Clicktodefinethecenterofthepolygon.

6. Type0intheRotationbox.

7. Movethepointerandnoticethattherotationofthepolygonisconstrained.

Page 359: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. Type50intheRadiusboxandpressEnter.

9. ClickCloseonthedialogtodeactivatethetool.

Page 360: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Circleby3Points1. Ontheribbon,click

Home>DirectSketch>Circle

2. OntheCircletoolbar,clickCircleby3Points iconundertheCircleMethodsection.

3. Clickontheverticesofthepolygon.Acircleiscreatedpassing

Page 361: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

throughthevertices.

TUTORIAL3(StudioSplines)

Page 362: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

StudioSplinesarenon-uniformcurves,whichareusedtocreateirregularshapes.InNX,youcancreatestudiosplinesbyusingtwomethods:ThroughPoints,andByPole.1. DownloadtheStudio-

splineexample.jpgfile.

2. Ontheribbon,clickHome>Feature>

Page 363: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Datum>RasterImage .

3. OntheRasterImagedialog,clicktheBrowse icon.

4. Gotothelocationofthedownloadedimagefileanddouble-clickonit.

5. SelecttheXZPlanefromtheDatumCoordinateSystem.

6. UndertheOrientation

Page 364: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

section,selectBasepoint>BottomCenter.

7. SettheReferenceDirectiontoVertical.

8. ClickontheAnglehandle(SphericalDot)oftheDynamicCoordinateSystem,andenter180intheAnglebox.

Page 365: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. ExpandtheImageSettingssectionandsettheOverallTranslucencyto50.

10. ClickOK.

Page 366: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. ActivatetheSketchmodeontheXZPlane.

12. OntheRibbon,clickDirectSketch>MoreCurve>StudioSpline

.13. OntheStudioSpline

dialog,selectType>ThroughPoints.

14. Selectthefivepoints,asshown.

Page 367: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. Selectthethreepoints,asshown.

Page 368: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. Likewise,selectotherpoints,asshown.

17. UndertheParameterizationsection,settheDegreevalueto2,andchecktheClosedoption.

18. ClickOK.

Page 369: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

19. ClickYesontheContinuousAutoDimensioningmessagebox.Theautodimensionsarenotcreated.

20. Double-clickonthespline.

Page 370: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

21. OntheStudioSplinedialog,selectType>ByPoles.

22. Dragthepole,asshown.

23. Likewise,modifytheotherpolelocations,asshown.

Page 371: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

24. Selectapointonthespline,asshown.Anewpoleisadded.

Page 372: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

25. Dragthenewpoletomodifythespline.

Page 373: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

26. Likewise,addpoleswherevertheyarerequired,andmodifytheirposition.

27. ClickOK.28. Clickontheimageand

selectHide.

Page 374: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

29. ClickFinishSketch.TUTORIAL4(GeometricConstraints)1. ActivatetheDirect

Page 375: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Sketchmode.2. Ontheribbon,click

Home>DirectSketch>Profile .

3. Selectthesketchorigin.

4. Movethepointertowardsrighthorizontallyandclick.

5. Movethepointerupverticallyandclick.

6. Movethepointertowardleftandclick.

Page 376: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NoticethattheHorizontalandVerticalconstraintsarecreated,automatically.

7. Movethepointerup

Page 377: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

verticallyandclick.8. OntheProfiletoolbar,

clicktheArc icon.9. Movethepointertothe

endpointofthepreviousline,andthenmoveittowardleft.Anarcnormaltothelineappears.

Page 378: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. Movethepointertotheendpointofthepreviousline,movetowardup,andleft.Noticethatanarc

Page 379: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

tangenttothepreviousline.

11. Clicktocreateatangentarc.

Page 380: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. MovethepointerdownwardandnoticetheTangentconstraint.

13. Clickwhenadotted

Page 381: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

lineappearsfromthehorizontalline.

14. Movethepointertowardleftandclickwhenadottedlineappearsfromthesketchorigin.

Page 382: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. Movethepointerdownwardandclickthesketchorigin.

Page 383: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. Ontheribbon,clickHome>DirectSketch>Circle.

17. Selectthecenterofthe

Page 384: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

tangentarc,movethepointeroutward,andclick.Aconcentricconstraintiscreatedbetweenthecircleandthearc.

18. Placethepointeronthe

Page 385: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

midpointoftheleftverticalline,andmovethepointer.

19. Clickwhenahorizontaldottedlineappears.

20. Movethepointerand

Page 386: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clicktocreateacircle.21. Likewise,create

anothercircle.22. PressEsc.

Page 387: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingConstraintsGeometricConstraintsareusedtocontroltheshapeofasketchbyestablishingrelationshipsbetweenthesketchelements.YoucanaddrelationsusingtheGeometricConstraintstool.1. Selecttheline

connectedtothetangentarc,andclickVerticalfromthe

Page 388: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Shortcutstoolbar.Theverticalconstraintisappliedtotheline.

2. Selectthelower

verticallines.3. ClicktheEqual

Length icononthe

Page 389: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Shortcutstoolbartomakethelinesequal.

4. PressEsc.5. Selectthetwo

horizontallines,asshown.

6. ClicktheEqualLength iconontheShortcutstoolbartomakethelinesequal.

Page 390: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. PressEsc.8. Selecttheothertwo

verticallinesandclick

Page 391: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theEqualLengthicontomakethemequal.

9. PressEsc.10. Selectthetwocircles

locatedatthebottom.11. ClicktheEqual

Radius iconontheShortcutstoolbar.

12. Selectthecenterpointofthecircleandthelefttheverticalline.

Page 392: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. ClicktheMidpointicononthedialog.Themidpointoftheverticallineandthecenterpointofthecirclebecomecollinear.

Page 393: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. Likewise,maketheothercirclecollinear

Page 394: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

withthemidpointoftherightverticalline.

AddingDimensions1. Double-clickonthe

dimensionofthelowerrightverticalline,type30andpressEnter.

Page 395: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Likewise,changethedimensionoftheupperverticallineto35.

3. Ontheribbon,clickHome>DirectSketch

Page 396: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

>RapidDimension.4. Selectthelower

horizontalline,movethepointer,andclicktopositionthedimension.

5. Type40andpressEnter.

6. Likewise,addotherdimensionstothesketchtoconstrainitfully.

Page 397: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL5(ResolvingOver-

Page 398: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstrainedSketch)1. ActivatetheDirect

Sketchmodeandcreatethesketch,asshown.

2. Ontheribbon,click

Page 399: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Home>DirectSketch>RapidDimension.

3. Selectthearcandpositionthedimension.TheUpdateSketchmessageboxappearsshowingthatthesketchisoverconstrained.

4. ClickOKandpressEsc.Theoverconstrainedsketchobjectsappearingreycolorandtheover-

Page 400: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

constrainingdimensionsandconstraintsappearsinred.

5. Selectthelineardimension,asshownandclickDelete.

Page 401: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickOKontheDeleteDimensionsmessagebox.Now,thesketchisfullyconstrained.

Page 402: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL6(Ellipses)Ellipsesarealsonon-uniformcurves,buttheyhavearegularshape.Theyareactuallysplinescreatedinregularclosedshapes.1. ActivatetheDirect

Sketchmode.2. Ontheribbon,click

Home>DirectSketch

Page 403: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

>MoreCurves>Ellipse .

3. Pickapointinthegraphicswindowtodefinethelocationoftheellipse.

4. Type40and20intheMajorRadiusandMinorRadiusboxesontheEllipsedialog.Youcanalsousethearrowhandlestochangethemajorand

Page 404: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

minorradiusvalues.

5. Type30intheAnglebox.YoucanalsousetheAnglehandletorotatetheellipse.ClickOK.

Page 405: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Notethattheellipseisnotconstrainedfully.Followthestepsgivennexttofully-constraintheellipse.6. Ontheribbon,click

Home>DirectSketch

Page 406: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

>Line .7. Selectcenterpointof

theellipse.8. Selectapointonthe

ellipse.9. Likewise,create

anotherline.

Page 407: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. Ontheribbon,clickHome>DirectSketch>More>GeometricConstraints .

11. ClickOKonthemessagebox.

Page 408: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. OntheGeometricConstraintsdialog,clicktheParalleliconundertheConstraintssection.

13. Selectthelineandellipse,asshown.

Page 409: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. OntheGeometricConstraintsdialog,clickthePerpendicular iconundertheConstraints

Page 410: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

section.15. Selectthetwolinesto

makethemperpendiculartoeachother.

16. ClosetheGeometricConstraintsdialog.

17. Ontheribbon,clickHome>DirectSketch>RapidDimension.

18. Selectthemajoraxisline,movethepointer

Page 411: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

inthedirectionperpendiculartotheline,andclicktopositionthedimension.

19. Type40andpressEnter.

20. Likewise,dimensiontheminoraxisline.

Page 412: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

21. SelecttheMajoraxislineandtheX-axis.

22. Movethepointerandclick.

23. Type30andpressEnter.

Page 413: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

24. ClosetheRapidDimensiondialog.

25. ClickonthemajoraxislineandselectConverttoReference.

Page 414: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

26. Likewise,converttheotherlinetoreference.

Page 415: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

27. Double-clickontheellipseandrotateitusingtheAnglehandle.

28. ClickOKandnoticethattheellipsereturns

Page 416: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

toitposition.TUTORIAL7(Conics)1. ActivatetheDirect

Sketchmode.2. Createatriangleusing

thePolygontool.

Page 417: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Ontheribbon,clickHome>DirectSketch>MoreCurve>

Conic .4. Selectthestartandend

limits,andcontrol

Page 418: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

point,asshown.

5. SettheRhoValueto0.25.

6. ExpandthePreview

Page 419: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

sectionandclickShowResult.

7. ClickUndoResultonthedialog.

8. SettheRhoValueto

Page 420: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

0.75andclickShowResult.

9. ClickOK.

Page 421: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL8(QuickExtend,QuickTrim,MakeCorner,andOffsetCurve)TheQuickExtendtoolissimilartotheQuickTrimtoolbutitsuseisoppositeoftheQuickTrimtool.Thistoolisusedtoextendlines,arcsandotheropenentitiestoconnecttootherobjects.

Page 422: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Createasketchasshownbelow.

2. ClickHome>DirectSketch>QuickExtend ontheribbon.

Page 423: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Selectthehorizontalopenline.Thiswillextendthelineuptoarc.

4. Likewise,extendthe

Page 424: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

otherelements,asshown.

5. ClosetheQuickExtenddialog.

MakeCorner

Page 425: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Ontheribbon,clickHome>DirectSketch>Make

Corner .2. Clickontheending

portionofthearc.3. Clickonthestarting

portionofthehorizontalline.

Page 426: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClosetheMakeCornerdialog.

Page 427: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

QuickTrim1. Ontheribbon,click

Home>DirectSketch>QuickTrim

.

Page 428: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Selectthehorizontalline.

3. ClosetheQuickTrimdialog.

Page 429: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OffsetCurveTheOffsetCurvetoolcreatesparallelcopiesoflines,circles,arcsandsoon.1. Ontheribbon,click

Home>DirectSketch>MoreCurve>OffsetCurve .

2. Selectanentityandnoticethatalltheconnectedentitiesare

Page 430: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

selected.3. Type-inavalueinthe

DistanceboxontheOffsetCurvedialog(or)dragthearrowthatappearsontheoffsetcurve.

4. ClickReverseDirection icontoreversetheoffsetside.

5. ClickOK.

Page 431: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL9ThistutorialteachesyoutouseFillet,Chamfer,andMirrorCurvetools.Fillet

Page 432: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TheFillettoolconvertsthesharpcornersintoroundcorners.1. Drawthelinesas

shownbelow.

Page 433: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. ClickHome>DirectSketch>Fillet ontheribbon.

3. Clickonthecorner,asshown.

Page 434: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Movethepointerandclicktodefinetheradius.Youcanalsotypetheradiusvalue.

Page 435: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. OntheFillettoolbar,clicktheDeleteThirdCurve icon.

6. Selecttherightandleftverticallines.

7. Movethepointerandselectthehorizontalconnectingthetwoverticallines.

Page 436: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ChamferTheChamfertoolreplacesthesharpcornerswithanangledline.ThistoolissimilartotheFillettool,

Page 437: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

exceptthatanangledlineisplacedatthecornersinsteadofaround.1. ClickHome>Direct

Sketch>ChamferontheRibbon.

2. OntheChamferdialog,selectChamfer>Symmetric.

3. Clickonthecorner,asshown.

Page 438: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 439: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Type-inavalueintheDistanceboxandpressEnter.

5. Closethedialog.

MirrorCurveTheMirrorCurvetool

Page 440: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

createsamirrorimageofobjects.Youcancreatesymmetricalsketchesusingthistool.1. Ontheribbon,click

Home>DirectSketch>Mirror

Curve2. Dragaselectionlasso

coveringallthesketchentities.

Page 441: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. OntheMirrorCurvedialog,clickSelectCenterlineandselecttheX-axis.

4. ClickOKtomirrortheselectedentities.

Page 442: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 443: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. OntheRibbon,clickHome>DirectSketch

>Arc .6. Selectthestartandend

pointsofthearc,asshown.

Page 444: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. MovethepointerrightwardsandclickwhentheTangentglyphappears.

Page 445: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClosetheArctoolbar.AddingDimensions

Page 446: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Double-clickontheradialdimension,asshown.

2. Type15andpressEnter.

Page 447: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. OntheRibbon,clickHome>DirectSketch>RapidDimension

.4. Selecttheleftmost

verticallineandthecenterpointofthearc,asshown.

5. Type125andpressEnter.

Page 448: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Selectthefillet,type5andpressEnter.

7. Likewise,createother

Page 449: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dimensions,asshown.

8. Zoomtothetopportionofthesketch,selectthepoints,and

Page 450: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

pressDelete.

9. ClickFinishSketch.

Page 451: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 452: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 453: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter6:AdditionalModelingTools

Inthischapter,youwill:

ConstructaSweep

Page 454: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

featureConstructaSweptfeaturealongguidecurvesCreateHolesAddGroovesandSlotsMakePatternFeaturesConstructTubefeaturesConstructInstanceGeometryApplyBoolean

Page 455: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

operationsAddchamfers

TUTORIAL1Inthistutorial,youwillconstructahelicalspringusingtheHelixandSweepalongGuidetools.

Page 456: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Constructingthe

Page 457: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Helix1. OpenaNXfileusing

theModeltemplate.2. Toconstructahelix,

clickCurve>Curve>Helix ontheribbon.

3. OntheHelixdialog,selectType>AlongVector.

4. Specifythesettingsin

theSizesection,asgivennext.

Page 458: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Specifythesettingsin

thePitchsection,asgivennext.

6. Specifythesettingsin

Page 459: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theLengthsection,asgivennext.

7. ExpandthedialogandspecifythesettingsintheSettingssection,asgivennext.

Page 460: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickOKtoconstructthehelix.

Page 461: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheDatumPlane

Page 462: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Toaddadatumplane,clickHome>Feature>DatumPlane ontheribbon.

2. OntheDatumPlanedialog,selectType>OnCurve.

3. Selectthehelixfromthegraphicswindow.

4. UndertheLocationonCurvesection,selectLocation>ThroughPoint.

Page 463: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Selecttheendofthehelix.

6. UndertheOrientationonCurvesection,selectDirection>NormaltoPath.

7. Leavethedefault

Page 464: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

valuesandclickOK.ConstructingtheSweepfeature1. Ontheribbon,click

Home>DirectSketch>Sketch.

2. Selecttheplanecreatednormaltothehelix.

3. ExpandtheSketchOriginsectionandclickSpecifyPoint.

4. Selecttheendpointof

Page 465: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thehelixtodefinethesketchorigin.

5. ClickOK.6. Drawcircleof4mm

diameter.

Page 466: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Right-clickandselect

FinishSketch .8. OnTopBorderBar,

clicktheOrientView>Isometric.

Page 467: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. Toconstructasweepfeature,clickSurface>More>Sweep

alongGuide ontheribbon.

10. Selectthecircletodefinethesectioncurve.

11. UndertheGuidesection,clickSelectCurve.

12. Selectthehelix.13. Leavethedefault

Page 468: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

settingsandclickOKtoconstructthesweepfeature.

14. ClickontheplaneandselectHide.

Also,hidethesketch.

Page 469: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. Saveandclosethefile.

Page 470: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL2Inthistutorial,youconstructapulleywheelusingtheRevolveandGroovetools.

Page 471: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. OpenafileintheModelingEnvironment.

2. ConstructthesketchontheYZplane,asshowninfigure.

Page 472: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Finishthesketch.4. Constructtherevolved

feature.

Page 473: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheGroovefeature1. Toconstructagroove

Page 474: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

feature,clickHome>Feature>More>DesignFeature>Groove ontheribbon.

NoteSometoolsdonotappearontheribbon.Todisplaytherequiredtools,selectthemfromthemenu,asshowninfigure.

Page 475: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OntheGroovedialog,clicktheUGroovebutton.

3. Selecttheoutercylindricalfaceoftherevolvedfeature.

4. Specifythevalueson

theUGroovedialog,

Page 476: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

asshowninfigure.

5. ClickOK;thePosition

Groovedialogappears.6. Clickonthecylindrical

edgesofthemodelandgroovepreview,asshown.

Page 477: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Enter7.5onthe

CreateExpressiondialog.

Page 478: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickOKtoaddthe

groove.

Page 479: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. ClickCancel.10. Saveandclosethe

model.

TUTORIAL3Inthistutorial,youconstructashampoobottleusingtheSwept,Extrude,andThreadtools.

CreatingSectionsandGuidecurves

Page 480: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Toconstructasweptfeature,youneedtocreatesectionsandguidecurves.1. Openafileinthe

ModelingEnvironment.

2. Ontheribbon,clickHome>DirectSketch>Sketch.

3. SelecttheXYplane.4. OntheCreateSketch

dialog,clickOKtostartthesketch.

Page 481: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Ontheribbon,clickHome>DirectSketch>Ellipse .

6. Selecttheoriginpointofthecoordinatesystem.

7. SpecifyMajorRadiusas50mm.

8. SpecifyMinorRadiusas20mm.

9. SpecifyAngleas0.10. Leavethedefault

settingsandclickOK.

Page 482: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. ClickFinishSketch.12. Changetheorientation

toIsometric.13. Ontheribbon,click

Home>DirectSketch>Sketch.

14. SelecttheXZplane.

Page 483: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. ClickOK.16. Ontheribbon,click

Home>Directsketch>StudioSpline .

17. OntheStudioSplinedialog,selectType>ThroughPoints.

18. Drawasplinesimilarlytotheoneshowninfigure.

Page 484: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Ensurethatthefirstpointofthesplinecoincideswiththeprevioussketch.

Page 485: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. ClickOK.17. Applydimensiontothe

spline,asshowninfigure.

Page 486: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. Ontheribbon,click

Page 487: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Home>DirectSketch>MirrorCurve .

19. Selectthespline.20. OntheMirrorCurve

dialog,clickSelectCenterlineandthenselecttheverticalaxisofthesketch.

21. ClickOK.

Page 488: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

22. ClickFinishSketch.23. Changetheview

Page 489: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

orientationtoIsometric.

Creatinganothersection1. Ontheribbon,click

Home>Feature>DatumPlane.

2. OntheDatumPlanedialog,selectType>AtDistance.

3. SelecttheXYplanefromthecoordinatesystem.

Page 490: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Type-in225intheDistancebox.

5. ClickOK.

Page 491: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Startasketchonthenewdatumplane.

7. Drawacircleof40mmdiameter.

8. ClickFinishSketch.9. Changetheviewto

Page 492: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Isometric.

Constructingthesweptfeature1. Ontheribbon,click

Home>Surface>Swept .

2. Selectthecircleandclickthemiddlemousebutton.

Page 493: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Selecttheellipse.

Ensurethatthearrowsonthe

Page 494: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

circleandtheellipsepointtowardssamedirection.UsetheReverseDirectionbuttonintheSectionssectiontoreversethedirectionofarrows.8. ClickSelectCurvein

theGuides(3maximum)section.

9. Selectthefirstguidecurveandclickthemiddlemousebutton.

10. Selectthesecondguide

Page 495: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

curve.11. ClickOKtoconstruct

thesweptfeature.

Page 496: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheExtrudedfeature1. Clickonthecircleon

thetopofthesweepfeature.

2. ClickExtrudeonthecontextualtoolbar.

Page 497: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. OntheExtrudedialog,undertheBooleansection,selectBoolean>Unite.

4. Extrudethecircleupto25mm.

Page 498: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheEmbossfeature1. OntheFeaturegroup,

clicktheDatumPlane

Page 499: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

button.2. OntheDatumPlane

dialog,selectType>AtDistance.

3. SelecttheXZplanefromthecoordinatesystem.

4. Enter50intheDistancebox.

5. ClickReverseDirectiontocreatetheplane,asshown.ClickOK.

Page 500: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Createasketchonthe

planeasshownin

Page 501: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

figure.Themajorandminorradiusesoftheellipseare50and20,respectively.

Page 502: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickFinishSketch.7. Ontheribbon,click

Home>Feature>More>DesignFeature>Emboss .

8. Selectthesketch.9. OntheEmbossdialog,

underFacetoEmboss,clickSelectFace.

10. Selectthesweptfeature.

Page 503: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. UndertheEndCapsection,specifythesettings,asgivenin

Page 504: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

figure.

12. LeavethedefaultsettingsandclickOKtoaddtheembossedfeature.

Page 505: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingEdgeBlend1. Ontheribbon,click

Home>Feature>

Page 506: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

EdgeBlend.2. Clickonthebottom

andtopedgesofthesweptfeature.

3. SetRadius1to5mm.

Page 507: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickApplytoaddtheblend.

5. SetRadius1to1mm.

Page 508: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. SelecttheedgesoftheembossfeatureandclickOK.

Page 509: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ShellingtheModel1. Ontheribbon,click

Home>Feature>Shell .

2. OntheShelldialog,selectType>RemoveFaces,thenShell.

3. SetThicknessto2mm.

4. Selectthetopfaceofthecylindricalfeature.

Page 510: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClickOKtoshellthe

geometry.

Page 511: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingThreads1. Ontheribbon,click

Page 512: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Home>Feature>More>Thread .

2. OntheThreaddialog,setThreadTypetoDetailed.

3. Selectthecylindricalface.

Page 513: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. SetPitchto8mm.5. Leavetheotherdefault

settingsandclickOKtoaddthethread.

Page 514: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Savethemodelandcloseit.

TUTORIAL4Inthistutorial,youconstructapatternedcylindricalshell.

Page 515: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Constructingacylindricalshell1. Startanewfileusing

theModeltemplate.2. Ontheribbon,click

Page 516: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Home>Feature>More>DesignFeature>Cylinder.

3. OntheCylinderdialog,selectType>Axis,Diameter,andHeight.

4. SelecttheZ-axisfromthetriad.

Page 517: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. SpecifyDiameterandHeightas50and100,respectively.

6. LeavethedefaultsettingsandclickOK.

Page 518: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Ontheribbon,clickHome>Feature>Shell.

8. SetThicknessto3mm.

Page 519: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. Selectthetopand

bottomfacesofthecylindricalfeature.

10. ClickOKtoshellthegeometry.

Page 520: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Addingslots1. Ontheribbon,click

Feature>More>DesignFeature>Slot

Page 521: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

.2. OntheSlotdialog,

selectRectanglethenclickOK.

3. ClickontheYZplane.

4. ClickFlipDefault

Page 522: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Side.5. SelectZ-axisfromthe

DatumCoordinateSystem.

Page 523: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. OntheRectangularSlotdialog,type-in8,3,and30intheLength,WidthandDepthboxes,respectively.

7. ClickOK.ThePositioningdialogappears.Inaddition,theslottoolappears.8. OnthePositioning

dialog,clickthe

Page 524: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Horizontal button.9. Selectthecircularedge

ofthecylindricalfeature.

10. OntheSetArc

Page 525: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Positiondialog,clickArcCenteronthedialog.

11. Selectthecircularedgeontheslottool.

12. OntheSetArc

Page 526: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Positiondialog,clickArcCenter.

13. Enter-8mminthedialog.

14. ClickOKtwicetoaddtheslotfeature.

Page 527: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. ClickCancel.

ConstructingtheLinearpattern1. Ontheribbon,click

Page 528: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Home>Feature>PatternFeature .

2. OnthePatternFeaturedialog,selectLayout>Linear .

3. Selecttheslotfeature.4. UnderthePattern

Definitionsection,selectDirection1>SpecifyVector.

5. SelecttheZ-axisvector.

Page 529: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. SelectSpacing>CountandPitch.

7. Type-in6intheCountbox.

8. Enter16inthePitchDistancebox.

Page 530: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. ClickOKtomakethelinearpattern.

Constructingthe

Page 531: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Circularpattern1. Ontheribbon,click

Feature>PatternFeature .

2. OnthePatternFeaturedialog,selectLayout>Circular.

3. PressCtrlkeyandthenselectthelinearpatternandtheslotfeaturefromthePartNavigator.

Page 532: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. UnderthePatternDefinitionsection,selectRotationAxis>SpecifyVector.

5. SelecttheZ-axisvector.

Page 533: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Now,youhavetospecifythepointthroughwhichtherotationaxispasses.

Page 534: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Clickonthecircularedgeofthecylindricalfeature(toselectthecenterpointofthecylinder).

Page 535: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. SelectSpacing>CountandSpan.

8. Type-in12inthe

Page 536: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Countbox.9. Type-in360inthe

SpanAnglebox.10. ClickOKtomakethe

circularpattern.

Page 537: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. Saveandclosethe

model.

Page 538: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL5Inthistutorial,youwillconstructachain.

ConstructingtheTubefeature

Page 539: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. OpenanewfileusingtheModeltemplate.

2. Ontheribbon,clickHome>DirectSketch>Sketch.

3. SelecttheXZplane.4. Ontheribbon,click

Home>DirectSketch>Profile.

5. Clickonthescreentodefinethefirstpoint.

6. Dragthepointerrightwardsandclicktodefinethesecond

Page 540: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

point.

7. OntheProfiledialog,clickArc.

8. Dragthemousetowardright,andthendownwards.

9. Clicktodrawthearc.

Page 541: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. Dragthemousetowardleftandclicktodefineahorizontalline.

Page 542: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. OntheProfiledialog,clickArc.

12. Dragthemousetowardleft,andthenupwards.

13. Clickonthestartpointofthesketchtodraw

Page 543: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thearc

14. ClosetheProfiledialog.

15. Ontheribbon,clickHome>DirectSketch>More>MakeSymmetric.

16. Selectthetwoarcsand

Page 544: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clickontheverticalaxis.

17. ClickReset ontheMakeSymmetricdialog.

18. Selectthehorizontallines,andthenclickonthehorizontalaxis.

Page 545: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

19. Adddimensionstothesketch.

20. ClickFinishSketchontheDirectSketchgroup.

21. Toconstructatubefeature,clickHome>

Page 546: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Surface>More>Tube ontheribbon.

22. Selectthesketch.23. OntheTubedialog,

type-in1.5and0intheOuterDiameterandInnerDiameterboxes,respectively.

24. ClickOKtoconstructthetubefeature.

Page 547: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PatterningtheTubegeometry1. Ontheribbon,click

Home>Feature>PatternFeature.

2. OnthePattern

Page 548: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Featuredialog,selectLayout>Linearandclickonthetubefeature.

3. UnderthePatternDefinitionsection,selectDirection1>SpecifyVector.

4. SelecttheX-axisvector.

Page 549: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. UnderDirection1,

selectSpacing>CountandPitch.

6. Type-in6and12intheCountandPitchboxes,respectively.

Page 550: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. ExpandtheOrientationsectionandselectOrientation>CSYStoCSYS.

8. UnderOrientation,selectSpecifyFromVectorCSYS>CSYSDialog .

9. OntheCSYSdialog,selectType>Dynamic.

10. AcceptthedefaultpositionoftheDynamicCSYSand

Page 551: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clickOK.

11. OnthePatternFeaturedialog,underOrientation,selectSpecifyToCSYS>

Page 552: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CSYSDialog.12. RotatetheDynamic

CSYSabouttheX-axis.Therotationangleis-90degrees.

Page 553: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. ClickOK.14. OnthePattern

Featuredialog,underOrientation,checktheRepeat

Page 554: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Transformationoption.

15. ClickOKtomakepatternofthetube.

16. Saveandclosethefile.

Page 555: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

BooleanOperationsTypesofBooleanoperations.

UniteSubtractIntersectThesetoolscombine,subtract,orintersecttwobodies.ActivatethesetoolsfromtheCombinedrop-downontheFeaturegroup.

Page 556: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Unite:ThistoolcombinestheToolBodyandtheTargetBodyintoasinglebody.

Subtract:ThistoolsubtractstheToolbodyfromtheTargetbody.

Page 557: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Intersect:Thistoolkeepstheintersectingportionofthetoolandtargetbodies.

TUTORIAL6Inthistutorial,youwillconstructthemodelshowninfigure.

Page 558: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Constructingthefirstfeature1. Openanewpartfile.2. Constructthefirst

Page 559: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

featureontheXYplane(extrudethesketchuptoadistanceof10mm).

Page 560: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheSecondFeature1. Drawthesketchonthe

topfaceofthefirstfeature.

Page 561: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Ontheribbon,clickHome>Feature>Extrude.

3. Selectthesketch.

Page 562: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Type-in45intheEndbox.

5. UndertheBoolean

section,selectBoolean>Unite.

6. ClickOK.

Page 563: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Constructingthethirdfeature1. Ontheribbon,click

Page 564: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Home>Feature>DatumPlane.

2. OntheDatumPlanedialog,selectType>AtDistance.

3. Clickontheright-sidefaceofthemodelgeometry.

4. Type-in50intheDistanceboxandclicktheReverseDirectioniconontheDatumPlanedialog.

Page 565: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClickOK.6. Drawthesketchonthe

newdatumplane.

Page 566: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Ontheribbon,clickHome>Feature>More>Rib.

Page 567: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. Selectthesketch.9. OntheRibdialog,

selectWalls>ParalleltoSectionPlane.

10. UndertheWallssection,selectDistance>Symmetricandtype-in10intheThicknessbox.

11. CheckCombineRibwithTarget.

12. ClickOK.

Page 568: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DrillingHoles1. Todrillholes,click

Home>Feature>Hole ontheribbon.

Page 569: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OntheHoledialog,selectType>DrillSizeHole.

3. UndertheFormsandDimensionssection,selectSize>16.

4. SelectDepthLimit>ThroughBody.

5. Clickonthetopfaceofthemodel.

Page 570: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Clicktoplaceonemorepoint.

7. ClickCloseontheSketchPointdialog.

Page 571: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. Adddimensionstodefinetheholelocation.

Page 572: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 573: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. ClickFinishontheribbon.

10. ClickApplytocreatethehole.

Page 574: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. Drillanotherholeonthefrontfaceofthesecondfeature.

Page 575: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 576: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 577: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingChamfers1. Toaddachamfer,

clickHome>Feature

Page 578: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

>Chamfer ontheribbon.

2. OntheChamferdialog,selectCross-section>Asymmetric.

3. UndertheOffsetssection,type-in25and45intheDistance1andDistance2boxes.

4. Clickonthecorneredgeofthefirstfeature.

Page 579: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClickApplyaddthechamfer.

Page 580: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. OntheChamferdialog,selectCrossSection>Symmetric.

7. Type-in45intheDistancebox.

8. Clickonthecorner

Page 581: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

edgeofthesecondfeature.

9. ClickOK.

Page 582: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. Savethemodel.EditParameters1. ClickontheDrilled

holeandselectEditParametersfromthe

Page 583: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Shortcutstoolbar.

2. OntheHoledialog,selectType>GeneralHole.

3. UndertheFormandDimensionssection,

Page 584: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

selectForm>Counterbored.

4. SettheDimensionsofthecounterboredhole,asshown.

Page 585: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Youcanalsochangethelocationoftheholebydoubleclickingonthelocationdimensionsandchangingtheirvalues.

5. ClickOK.

Page 586: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ShowDimensions1. Clickonthebase

featureandselectShowDimensionsfromtheShortcutstoolbar.

Page 587: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Doubleclickonthe

lineardimensionoftheextrudefeature.

Page 588: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. OntheFeatureDimensiondialog,type-in20inthevalueboxandclickOK.

4. RightclickandselectRefreshorpressF5.

Page 589: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

EditingFeaturesbyDouble-clicking1. Double-clickonthe

chamfer.

Page 590: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. OntheChamferdialog,type-in30intheDistance1boxandclickOK.

Page 591: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SupressFeatures1. Clickonthechamfer

faceandselectSuppressontheShortcutstoolbar.

Page 592: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OnthePartNavigator,checktheChamferfeaturetounsuppressit.

3. OnthePartNavigator,rightclickonthe

Page 593: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SketchonthebasefeatureandselectEditParameters.

4. OntheEditSketchDimensionsdialog,selectthe125dimensionandchangeitsnametoLength.

5. ClickApplyandOK.6. OntheTopBorder

Page 594: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Bar,clickMenu>Edit>Feature>SuppressbyExpression.

7. SelectthepreviouslyunsuppressedchamferandclickApply.

8. ClickShowExpressionsonthedialog.TheInformationwindowappearsshowingthechamferexpression.Thevalue1indicates

Page 595: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thatitiscurrentlyunsuppressed.

9. ClosetheInformationwindow.

10. Ontheribbon,clickTools>Utilities>Expression.

11. OntheExpressionsdialog,selectListedExpressions>All.

12. Scrolldownandselectp361(Chamfer(11)SuppressionStatus)fromthelisted

Page 596: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

expressions.13. Enter

Chamfer_SuppressionintheNamebox.

14. Enterif(Length=>125)(1)else(0)intheFormulabox.

15. ClickOK.16. OnthePartNavigator,

rightclickontheSketchonthebasefeatureandselectEditParameters.

17. OntheEditSketch

Page 597: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Dimensionsdialog,selectthe125dimensionandchangeitsvalueto124.

18. ClickOK.Thechamfer

issuppressedasthelengthvalueislessthan125.

Page 598: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

19. Closethefile.TUTORIAL7Inthistutorial,youcreatethemodelshowninfigure.

Page 599: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Constructingthefirstfeature1. Openanewpartfile.2. Ontheribbon,click

Home>Features>

Page 600: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Extrude.3. ClickontheXYplane.4. Constructtwocircles

andadddimensionstothem.

Page 601: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Ontheribbon,clickHome>Curve>

QuickTrim andtrimtheintersectingentities.

Page 602: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Ontheribbon,clickHome>Curve>Fillet andsettheRadiusvalueto10.

Page 603: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Selecttheintersectingcornersofthecircles.

8. ClickFinishSketch.9. Extrudethesketchup

to5mmdistance.

Page 604: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheExtrudedcut1. Ontheribbon,click

Home>Feature>Extrude.

2. Clickonthetopfaceofthemodel.

Page 605: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Ontheribbon,clickHome>Curve>OffsetCurve .

4. Clickonanyedgeofthetopface.

5. OntheOffsetCurvedialog,settheDistancevalueto20.

6. ClicktheReverseDirectionbutton.

7. ClickOK.

Page 606: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickFinish.9. OntheExtrudedialog,

clicktheReverseDirection buttonundertheDirectionsection.

Page 607: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. ClickOK.

ConstructingtheExtrudedcut1. Ontheribbon,click

Home>Feature>Extrude.

2. Clickonthetopfaceof

Page 608: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

themodelgeometry.3. Ontheribbon,click

Home>Curve>Polygon .

4. OnthePolygondialog,type-in6intheNumberofSidesbox.

5. SelectSize>CircumscribedRadius.

6. SettheRadiusto4.7. SettheRotationto0.8. Clicktodefinethe

Page 609: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

centerpointofthepolygon.

9. Drawahorizontallineconnectingthecenterpointofthepolygon

Page 610: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

andtheorigin.10. Clickonthehorizontal

lineandselectConverttoReference.

11. Adddimensionstothe

sketch.

Page 611: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. ClickFinish.13. Createthecut

throughoutthebody.

Page 612: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MakingtheAlongPattern1. Ontheribbon,click

Home>Feature>PatternFeature .

Page 613: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Selectthepolygonalcuttodefinethefeaturetopattern.

3. SelectLayout>Along.

4. SelectPathMethod>Offset.

5. OntheTopBorderBar,selectCurverule>TangentCurves.

Page 614: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickSelectPathand

selecttheouteredgeofthetopface.

Page 615: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. SelectSpacing>

CountandSpan.8. Type-in10inthe

Countbox.9. Type-in100inthe%

SpanBybox.

Page 616: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. UndertheOrientationsection,setOrientationtoNormaltoPath.

11. ClickOK.

Page 617: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MeasuringtheMassProperties1. Ontheribbon,click

Analysis>Measure>More>MeasureBodies

2. Selectthegeometry.Noticethevolumeofthegeometry.Youcanselectadifferentpropertyfromthedrop-downtoseeitsvalue.

Page 618: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

YoucanalsochecktheShowInformationWindowoptionundertheResultsDisplaysectiontodisplaythemasspropertiesintheInformationwindow.

Page 619: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. ClickCancelonthe

MeasureBodiesdialog.

4. OntheTopBorderBar,clickMenu>Edit>Feature>SolidDensity .

Page 620: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. OntheAssignSolidDensitydialog,selectUnits>Lbs–Inches.

6. Type0.45intheSolidDensitybox.

7. SelectthegeometryandclickOK.

8. Ontheribbon,clickAnalysis>Measure>More>MeasureBodies .

9. Selectthegeometryandnoticetheupdated

Page 621: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

massproperties.10. ClickCancel.11. Ontheribbon,click

Tools>Utilities>More>AssignMaterials .

12. Selectthegeometry.13. SelectIron_Malleable

fromtheMaterialssection.

14. ClickInspectMaterialfromtheMaterials

section.TheIsotropic

Page 622: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Materialdialogappearsshowingvariouspropertiesofthematerial.YoucanviewtheMechanical,Strength,Durability,Formabilityandotherpropertiesbyclickingoneachofthem.

15. ClosetheIsotropicMaterialdialogandclickOK.

16. UsetheMeasureBodiestooltoseethe

Page 623: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MassPropertiesofthegeometry.

17. Saveandclosethefile.TUTORIAL8Inthistutorial,youcreateaplasticcasing.

Page 624: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CreatingtheFirstFeature1. Openanewpartfile.

Page 625: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. CreateasketchontheXYPlane,asshowninfigure.

Page 626: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. ClickFinishSketch.

Page 627: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClicktheFeature>Extrudeontheribbon.

5. SettheDistanceto30.6. ExpandtheDraft

sectionandselectDraft>FromStartLimit.

7. SettheAngleto2deg.8. ClickOK.

Page 628: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CreatingtheExtrudedsurface

1. ClickFeature>

Page 629: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ExtrudeontheribbonandselecttheYZPlane.

2. Createasketch,asshown.NotethatthereshouldaTangentconstraintbetweenthearcandtheinclinededge

Page 630: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ofthegeometry.

3. ClickFinish.4. Onthe

dialog,undertheLimitssection,selectStart>

Page 631: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SymmetricValue.

5. Type-in50intheDistanceboxandclickOK.

Page 632: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TrimBody1. Ontheribbon,click

Extrude>TrimBody.

Page 633: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Now,youneedtoselectthetargetbody.2. Selectthesolidbody.

Next,youneedtoselectthetoolbody.3. SelectToolOption>

FaceorPlane.4. ClickSelectFaceor

Planeandselecttheextrudedsurface.

Page 634: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Makesurethatthearrowpointstowardsfront.Youcandouble-clickonittoreverseitsdirection.

6. ClickOKtotrimthesolid.

Page 635: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. HidetheextrudedsurfacebyclickingonitandselectingHide.

VariableRadius

Page 636: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Blend1. Onthe

ribbon,clickHome>Feature>EdgeBlend

.2. Selectthe

edgebetweenthetopandcurvedfaces.

Page 637: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. ExpandtheVariableRadiusPointssectionandclickSpecifyNew

Page 638: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Location.4. Selectthe

threepointsontheedge,asshown.

Page 639: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. UndertheVariableRadiusPointssection,

Page 640: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

expandtheListsection.

6. Selecttheradiuspointsone-by-oneandchangetheradiusvalues,asshown.

Page 641: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. ClickOKto

createthevariable

Page 642: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

radiusblend.

CornerSetbacks1. Ontheribbon,click

Home>Feature>EdgeBlend .

2. SettheRadius1to5

Page 643: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Selecttheedgesofthegeometry,asshown.

4. ExpandtheCornerSetbacksectionandclickSpecifyEnd

Page 644: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Point.5. Selectthevertexpoint,

asshown.

6. UndertheCornerSetbacksection,expandtheList

Page 645: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

section.7. Selectthesetback

pointsone-by-oneandchangethesetbackvalues,asshown.Youcanalsochangethesetbackvaluesonthehandleattachedtothecorner.

Page 646: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 647: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. UndertheEdgeBlend

section,clickSelectEdge.

9. Selecttheedges,asshown.

Page 648: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. UndertheCorner

Setbacksection,clickSpecifyEndPoint.

11. Selectthevertexpoint,asshown.

Page 649: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Changethesetback

valuesonthehandleattachedtothecorner.

Page 650: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. ClickOK.CreatingaBoss1. Ontheribbon,click

Home>Feature>

Page 651: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

More>DesignFeatures>Boss .

2. OntheBossdialog,type-in20and30intheDiameterandHeightboxes,respectively.

3. ClickonthetopfaceofthegeometryandclickOK.

4. OnthePositioningdialog,clicktheHorizontal icon.

Page 652: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Selecttheedge,asshown.

6. Selectthecircularedgeonthetopface,asshown.

Page 653: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. SelecttheArcCenterbutton.

8. Type-in30inthevalueboxandclickApply.

9. ClickthePerpendicular iconandselecttheYZ

Page 654: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

plane.10. Type-in20invaluebox

andclickOK.

SplitBody1. Createashellfeature

byremovingthebottomface.

Page 655: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

NoticethattheBossfeatureisalsoshelled.Toavoidthis,youneedtoseparatethebossfeaturefromtheotherbody.

Page 656: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OnthePartNavigator,rightclickontheShellfeatureandselectDelete.

3. Ontheribbon,clickFeature>More>Trim>SplitBody .

4. Selectthemodeltodefinethetargetbody.

5. SelectToolOption>NewPlane.

6. UndertheToolsection,clickSpecify

Page 657: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Plane.7. Selectthetopfaceof

thegeometryandclickOK.

Shellwithan

Page 658: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AlternateThickness1. Ontheribbon,click

Home>Feature>Shell .

2. Selectthebottomfaceofthegeometry.

3. UndertheThicknesssection,type-in2intheThicknessbox.

4. ExpandtheAlternateThicknesssectionandclickSelectFace.

5. Selectthecylindrical

Page 659: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

face,asshown.6. UndertheAlternate

Thicknesssection,type-in4intheThicknessbox.

Page 660: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. ClickOK.

OffsetFace1. Ontheribbon,click

Home>Feature>More>Offset/Scale>

Page 661: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OffsetFace .2. Selectthefaceofthe

geometry,asshown.

3. Dragthearrowhandledownward,andrelease

Page 662: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

whentheoffsetvalueissetto20.

4. ClickOK.DeleteBody

Page 663: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Ontheribbon,clickHome>Feature>More>Trim>DeleteBody .

2. SelectthebossfeatureandclickOK.

3. Savethefile.ScaleBody1. Ontheribbon,click

Home>Feature>More>Offset/Scale>ScaleBody .

Page 664: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OntheScaleBodydialog,selectType>Uniform.

3. Selectthegeometry.4. UndertheScalePoint

section,clickSpecifyPoint.

5. Selectthecenterpointofthecircularedge,asshown.

Page 665: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Type-in1.05intheUniformbox.

8. ExpandthePreviewsectionand

Page 666: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clickShowResult.

7. ClicktheUndoResult.8. SelectType>

General.9. UndertheScale

Factorsection,type-in1.2,1.5,and0.8intheXDirection,YDirection,andZDirectionboxes,respectively.

10. ClickShowResult.

Page 667: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. ClickUndoResult.12. SelectType>

Axisymmetric.13. UndertheScalePoint

section,clickSpecifyVector.

Page 668: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. SelecttheZaxisfromthetriad.

15. ClickSpecifyAxisThrough-pointandselectthecenterpointthecircularedge,asshown.

16. UndertheScaleFactorsection,type-in2intheAlongAxisbox.

17. ClickShowResult.

Page 669: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. ClickCancel.ExtractGeometry1. Ontheribbon,click

Home>Feature>

Page 670: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

More>AssociateCopy>ExtractGeometry .

2. OntheExtractGeometrydialog,selectType>CompositeCurve.

3. Selecttheedgesofthegeometry,asshown.

Page 671: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickOK.5. OnthePartNavigator,

rightclickontheCompositeCurveandselectHideParents.Thegeometryis

Page 672: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

hidden.

6. Rightclickonthe

Page 673: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CompositeCurveandselectShowParents.

7. Ontheribbon,clickHome>Feature>More>AssociateCopy>ExtractGeometry .

8. OntheExtractGeometrydialog,selectType>Face.

9. SelectthetopfaceofthegeometryandclickOK.

Page 674: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. RightclickontheextractedfaceandselectHideParents.

11. Rightclickonthe

extractedfaceandselectShowParents.

Page 675: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Ontheribbon,clickHome>Feature>More>AssociateCopy>ExtractGeometry .

13. SelectType>RegionofFaces.

14. Selecttheinnerhorizontalfaceoftheshellfeature.

Page 676: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. Selectthethinplanarfacetodefinetheboundary.

Page 677: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. UndertheRegionOptionssection,checktheTraverseInteriorEdgesoption.

17. ExpandthePreview

Page 678: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

sectionandclickPreviewRegion.

18. ClickFinishedPreview.

19. UnchecktheTraverseInteriorEdgesoption.

Page 679: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

20. ClickPreviewRegion.

21. ClickOK.22. Closethefile.TUTORIAL9Inthistutorial,youwilllearn

Page 680: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theReorderFeature,andReplaceFeaturetools.1. Downloadandopen

theTutorial9file.

Page 681: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Noticethattheedgeblendisappliedonlyontheoutsideedgesofthegeometry.2. InthePartNavigator,

Page 682: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clicktheEdgeBlend,dragit,andplaceabovetheShell.

Theedgeblendisappliedtotheinneredgesoftheshellfeature,automatically.

Page 683: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ReplaceFeatures1. InthePartNavigator,

rightclickontheExtrudefeatureandselectMakeCurrentFeature.

2. DownloadtheTutorial

Page 684: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9-Replacement.3. ClickFile>Import>

Part.4. OntheImportPart

dialog,unchecktheCreateNamedGroupoption,leavethedefaultsettings,andclickOK.

5. BrowsetothelocationoftheTutorial9-Replacementpartanddouble-clickonit.

6. OnthePointdialog,

Page 685: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

leavetheX,Y,andZvaluesto0andclickOK.

7. ClickCancel.8. InthePartNavigator,

rightclickontheShellfeatureandselectMakeCurrentFeature.

Page 686: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. InthePartNavigator,rightclickonthefirstExtrudefeatureandselectReplace.

10. OntheReplaceFeaturedialog,clickSelectFeatureundertheReplacementFeaturesection.

11. Selecttheimportedgeometry.

12. ClicktheNextbuttonintheMapping

Page 687: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

section.Thebackedgeoftheextrudefeatureishighlighted.

13. Selectthe

correspondingedgeonthereplacementfeature.

Page 688: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. Likewise,selectthecorrespondingreferencesonthereplacementfeature,andthenclickOK.

Page 689: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. Saveandclosethefile.

TUTORIAL10Inthistutorial,youwilllearntodividefaces,andapplydraftusingtheToPartingEdgesoption.

Page 690: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Downloadandopen

theTutorial10fileandopenit.

2. Ontheribbon,clickHome>Feature>

Page 691: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

More>DivideFace.

3. Selecttheoutercylindricalfaceofthegeometry.

4. ClickSelectObjectundertheDividingObjectssection.

5. Selectthedatumplane.6. LeavetheProjection

DirectiontoNormaltoFace.

7. ClickOK.The

Page 692: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

cylindricalfaceisdividedintotwoparts.

ApplyingDraftusingtheToPartingEdgesoption

Page 693: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Ontheribbon,clickHome>Feature>Draft .

2. OntheDraftdialog,selectType>ToPartingEdges.

3. ClickSelectPlaneundertheStationaryPlanesection.

4. Selectanypointonthepartingedge.

Page 694: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Selectthepartingedgeandenter10intheAngle1box.

Page 695: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickOK.7. Saveandclosethefile.TUTORIAL11

Page 696: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Inthistutorial,youwilllearntoapplydraftusingtheFromPlaneorSurfaceoption.1. Downloadandopen

theTutorial11fileandopenit.

Page 697: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Ontheribbon,clickHome>Feature>Draft .

3. OntheDraftdialog,selectType>FromPlaneorSurface.

Page 698: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. SelecttheZ-axisfromtriadtodefinethedraftingdirection.

5. UndertheDraftReferencessection,selectDraftMethod>PartingFace.

6. ClickSelectStationaryPartingFaceundertheDraftReferencessection.

7. Selectthepartingsurface.

Page 699: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickSelectFaceundertheFacestoDraftsection.

9. OntheTopBorderBar,settheFaceRuletoTangentFaces.

10. Selectanyoneofthe

Page 700: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

tangentiallyconnectedfaces.

11. Type10intheAngle1box.

12. ChecktheDraftBothSidesoptionunderthe

Page 701: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DraftReferencessection.

13. UnchecktheSymmetricAngleoptionundertheFacestoDraftsection.

14. Type15intheBelowAngle1box.

15. ClickOK.

Page 702: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. ClickonthepartingsurfaceandselectHide.

17. Saveandclosethefile.TUTORIAL12Inthistutorial,youwilllearn

Page 703: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

toapplydraftusingtheTangenttoFacesoption.1. Downloadandopen

theTutorial12fileandopenit.

2. Ontheribbon,click

Page 704: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Home>Feature>Draft .

3. OntheDraftdialog,selectType>TangenttoFaces.

4. SelecttheZ-axisfromtriadtodefinethedraftingdirection.

5. Selectthecylindricalface.Thefacesconnectedtangentiallytothecylindricalfacearedrafted

Page 705: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Type10intheAngle1boxandclickOK.

Page 706: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Saveandclosethefile.TUTORIAL13Inthistutorial,youwilllearntocreateFeaturegroups.

Page 707: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Downloadandopen

theTutorial13fileandopenit.

Page 708: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. OntheTopBorder

Bar,clickMenu>Format>Group>FeatureGroup .

3. TypeRib_with_blendsintheFeatureGroupName.

4. PresstheCtrlkeyandselectRib(3)andEdgeBlend(4)fromtheFeaturesinPartlist.

Page 709: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClicktheAdd icontoaddthemtotheFeaturesinGrouplist.

6. ClickOK.ThefeaturegroupappearsinthePartNavigator.

7. UnchecktheFeatureGroupoptioninthePartNavigator.TheFeaturegroupissuppressed.

8. ChecktheFeatureGroupoptionto

Page 710: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

unsuppressit.9. Saveandclosethefile.

Page 711: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter7:Expressions

Inthischapter,youwill:

UseProgramGeneratedExpressionsCreateyourown

Page 712: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ExpressionsCreateFamilyofPartsCreateexpressionsbymeasuringelementsExportandImportExpressions

TUTORIAL1Inthistutorial,youwillmodifythebasicexpressionswhichareautomaticallycreatedbyNX.

Page 713: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Startanewfileinthe

Modelingenvironment.

2. ActivatetheDirectSketchmodeontheXYplane.

3. Createthesketch,asshown.

Page 714: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Noticetheexpressionsthatareappliedtothedimensions.4. ClickFinishSketchon

theribbon.

Page 715: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClickOrientViewDrop-down>IsometricontheTopBorderBar(or)presstheEndkey.

6. Ontheribbon,clickHome>Feature>Extrude.

7. OntheExtrudedialog,setthevaluesintheLimitssection,asgivenbelow:

Start:Value

Page 716: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Distance:0End:ValueDistance:158. ExpandtheOffset

sectionandsetthevalues,asgivenbelow:

Offset:SymmetricEnd:59. ClickOK.

Page 717: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. Ontheribbon,click

Tools>Utilities>Expression .

11. OntheExpressionsdialog,selectListedExpressions>All.Alltheexpressionsinthe

Page 718: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

filearedisplayed.12. SelecttheExtrude

featurefromthegraphicswindowtoonlydisplayitsexpressions.

13. Selectp6(Extrude(2)StartOffset)fromtheexpressionssheet.

14. Type3intheFormula

Page 719: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

boxandclickAcceptEdit .

15. ClickOKtoupdatethemodel.

16. SelecttheExtrudefeaturefromthePartNavigator.

17. ExpandtheDetails

Page 720: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

sectiononthePartNavigator.

18. Double-clickontheStartLimitvalueandtype10.Themodelisupdated,asshown.

19. Saveandclosethepart

Page 721: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

file.TUTORIAL2Inthistutorial,youwillcreateexpressionstodrivetheparametersofabolt.1. Startanewpartfile.2. ActivatetheExtrude

commandandselecttheYZplane.

3. Createacircleof20mmdiameter.

Page 722: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickFinish.5. Extrudethesketchup

to80mmdistance.

Page 723: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ActivatetheExtrudecommandandselecttherightendfaceofthecylinder.

7. Createahexagon,asshown.

Page 724: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickFinish.9. Extrudethesketchup

to10mmdistance.

Page 725: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. Ontheribbon,clickTools>Utilities>Expression .

11. OntheExpressionsdialog,selectListedExpressions>All.

Page 726: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Selectp7(Extrude(1)DiameterDimensiononArc1).

13. TypeDiameterintheNameboxandclickAcceptEdit .

14. Selectp18(Extrude(2)ParallelDimensionbetweenLine1andPoint2).

15. TypeDiameterintheFormulaboxandclickAcceptEdit.

16. Selectp9(Extrude(2)

Page 727: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

EndLimit).17. Type0.75*Diameterin

theFormulaboxandclickAcceptEdit.

18. ClickOKtoupdatethemodel.

Page 728: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

19. SelecttheExtrude(1)featurefromthePartNavigator.

20. ExpandtheDetailssectiononthePartNavigator.

21. Double-clickontheDiametervalueandtype10.Themodelisupdated,asshown.

Page 729: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

22. Ontheribbon,clickHome>Feature>More>DesignFeature>Thread .

23. OntheThreaddialog,settheTypetoDetailed.

Page 730: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

24. Selectthecylindricalfaceofthegeometry.

25. ClickOKtocreatethethread.

26. PressCtrl+EtoopentheExpressionsdialog.

27. SelecttheThreads

Page 731: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

featurefromthePartNavigatorandnoticealltheexpressionsrelatedtoit.

28. Selectp19(Threads(3)MajorDiameter).

29. TypeDintheNamebox.

30. TypeDiameterintheFormulaboxtomakethemajordiametervalueequaltothediameterofthecylinder.

Page 732: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

31. ClickAcceptEdit.32. Selectp22(Threads

(3)Pitch).33. TypePitchinthe

NameboxandclickAcceptEdit .

34. Selectp20(Threads(3)MinorDiameter).

35. TypeD2andD-1.08*PitchintheNameandFormulaboxes,respectively.

36. ClickAcceptEdit.

Page 733: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

37. Selectp23(Threads(3)Length).

38. TypeLengthand2*DintheNameandFormulaboxes,respectively.

39. ClickAcceptEditandOK.Themodelisupdated,asshown.

Page 734: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

40. SelecttheExtrude(1)featurefromthePartNavigator.

41. ExpandtheDetailssectiononthePartNavigator.

42. Double-clickonthe

Page 735: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Diametervalueandtype20.Themodelisupdated,asshown.

43. SelecttheThreadsfeaturefromthePartNavigatorandchangethePitchvalueinthe

Page 736: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Detailssectionto2.5.Thepitchandminordiameterofthethreadsareupdated.

Insteadofupdatingthepitchanddiametervaluesmanually,youcanusea

Page 737: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

spreadsheettochangeallthevalues.CreatingFamilyofParts1. Ontheribbon,click

Tools>Utilities>Spreadsheet .TheWorksheetinModelingisopened.

2. IntheWorksheetenvironment,click

Page 738: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ADD-INS>ExtractExprontheribbon.Theexpressionsareaddedtothespreadsheet.

3. CopythecontentsofcolumnBintocolumnCandD.

Page 739: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. TypeM20x2.5,

M10x1.25,andM6x0.75inthefirstrowsofcolumnsB,C,andD,respectively.

Page 740: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClickinthesecondrowofthecolumnBandchangeitsexpressionto=EXPRVAL("Diameter")

6. Likewise,changethe

expressionsofDvaluesincolumnsCandDto=Diameter.

Page 741: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. Editthevaluesofthehighlightedrows,asshown.

8. Dragthepointeracross

theA2andD13cells.

Page 742: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. ClickADD-INS>

DefineExprRngontheribbon.

10. ClickADD-INS>

Page 743: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Options>NXPreferences.

11. UnchecktheUseFixedUpdateRangeoptionandclickOK.

12. SelectthecontentsofthecolumnD.

Page 744: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. ClickADD-INS>

UpdateNXPart.14. Saveandclosethe

spreadsheet.Thepartisupdated.

Page 745: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. Ontheribbon,clickTools>Utilities>Spreadsheet .

16. SelectthecontentsofthecolumnC.

17. ClickADD-INS>UpdateNXPart.

18. Saveandclosethe

Page 746: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

spreadsheet.Thepartisupdated.

19. Likewise,selectthecontentsofthecolumnBandclickUpdateNXPart.

20. Inthespreadsheet,

Page 747: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

enterthelocationandpartname(forexample:C:\Users\Public\Documents\M20x2.5)atthebottomoftheB,C,andDcolumns.ThepartnamesshouldbeM20x2.5,M10x1.25,andM6x0.75.

21. DragthepointeracrosstheA2andD14cells.

Page 748: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

22. ClickADD-INS>DefineFmlyRngontheribbon.Theselecteddatawillbeusedtocreatethepartfamily.

23. ClickADD-INS>BuildFamilyonthe

Page 749: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ribbon.24. Closethespreadsheet

andclickDiscard.Thepartfamilyiscreatedinthespecifiedfolder.

25. Closethepartfile.

Page 750: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL31. DownloadtheTutorial

3fileoftheExpressionschapterandopenit.

Page 751: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Ontheribbon,clickTools>Utilities>Expressions.

3. OntheExpressions

Page 752: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialog,selectListedExpressions>Named.

4. TypeThicknessintheNamebox.

5. ClicktheMeasureDistance icononthedialog.

6. OntheMeasureDistancedialog,selectType>Length.

7. Selecttheedgeofthegeometry,asshown.

Page 753: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. ClickOK.9. ClickAcceptEdit.10. ClickOK.11. Ontheribbon,click

Home>Feature>

Page 754: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Shell.12. Selectthehorizontal

face,asshown.

13. Clickthedown-arrowonThicknesshandle

Page 755: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

andselectFormula.

14. OntheExpressions

dialog,typeThicknessintheFormulabox

Page 756: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

andclickAcceptEdit.15. ClickOKonthe

ExpressionsandShelldialogs.

16. ClickonthesecondextrudedfeatureandselectShowDimensions.

17. Double-clickonthelineardimensionandchangeitsvalueto10.

Page 757: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. ClickOKontheFeatureDimensiondialog.

19. PressF5onyourkeyboard.

Page 758: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL41. DownloadtheTutorial

Page 759: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4fileoftheExpressionschapterandopenit.

2. Ontheribbon,clickTools>Utilities>Expressions.

Page 760: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. OntheExpressionsdialog,selectListedExpressions>All.

4. OntheExpressiondialog,clicktheExportExpressionstoFile .

5. Browsetoalocationtosavethefile.

6. SettheExportOptionstoWorkPart.

7. TypeTutorial_4inthe

Page 761: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

FilenameboxandclickOK.Theexpressionsofthemodelareexportedtoatextfile.

8. OpentheTutorial_4.expfileinNotepadoranytexteditor.

9. Modifytheexpressionsinthetextfileandsaveit.

Page 762: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. SwitchtoNXapplicationwindow.

11. OntheExpressionsdialog,clicktheImportExpressionsfromFile icon.

12. GotothelocationofTutorial_4.expfileand

Page 763: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

double-clickonit.13. ClickOKonthe

Expressionsdialog.

14. Saveandclosethefile.

Page 764: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 765: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter8:SheetMetalModeling

ThisChapterwillshowyouto:

ConstructTabfeature

Page 766: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructFlangeContourFlangeClosedcornersLouversBeadsDrawnCut-outsGussetsFlatPattern

TUTORIAL1Inthistutorial,youconstructthesheetmetalmodelshowninfigure.

Page 767: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 768: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OpeningaNewSheetmetalFile1. Toopenanewsheet

metalfile,clickHome>Newontheribbon.

2. OntheNewdialog,clickNXSheetMetal.

3. ClickOK.

TheNXSheetMetalribbonappears,asshownbelow.

Page 769: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SettingtheParametersoftheSheetMetalpart1. Tosettheparameters,

clickFile>

Page 770: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Preferences>SheetMetal

OntheNXSheetMetalPreferencesdialog,,youcansetthepreferencesofthesheetmetalpartsuchasthickness,bendradius,reliefdepth,widthandsoon.Inthistutorial,youwillconstructthesheetmetalpartwiththedefaultpreferences.ClickOKonthedialog.

Page 771: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 772: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheTabFeature1. Toconstructthebase

feature,clickHome>Basic>Tab ontheribbon.

2. SelecttheXYplane.3. Constructthesketch,

asshown.

Page 773: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickFinish.5. ClickOKtoconstruct

thetabfeature.

Page 774: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Addingaflange1. Toaddtheflange,

clickHome>Bend>Flange ontheribbon.

2. Selecttheedgeonthetopface.

Page 775: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. SetLengthto100.4. ClickOKtoaddthe

flange.

Page 776: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheContourFlange1. Toconstructthe

Page 777: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

contourflange,clickHome>Bend>

ContourFlange ontheribbon.

2. OntheContourFlangedialog,clicktheSketchSectionicon.

3. OntheTopBorderBar,selectCurveRule>SingleCurve.

4. Clicktheedgeontheleftsideofthetopface.

Page 778: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. OntheCreateSketch

dialog,underthePlaneLocationsection,type-in100inthe%Arc

Page 779: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Lengthbox.6. UnderthePlane

Orientationsection,selectReversePlaneNormal.

Page 780: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. ClickOK.8. Drawthesketch,as

Page 781: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

shown.

9. ClickFinish.

Page 782: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. OntheContourFlangedialog,undertheWidthsection,selectWidthOption>ToEnd.

11. Clickonthearrowattachedtothesketch.

Page 783: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. ClickOKtoconstructthecontourflange.

Page 784: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheClosedCorner1. Toaddtheclosed

Page 785: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

corner,clickHome>Corner>ClosedCorner .

2. Selectthetwobendsformingthecorner.

Page 786: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. OntheClosedCornerdialog,undertheCornerPropertiessection,selectTreatment>Open.

Page 787: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickOKtoaddtheopencorner.

YoucanalsoapplycornertreatmentusingtheoptionsintheTreatmentsdrop-down.Thedifferenttypesofthecornertreatmentsaregivennext.

Page 788: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 789: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 790: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 791: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 792: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheLouver1. Toaddthelouver,

clickHome>Punch>Louver ontheribbon.

2. Selectthefrontfaceof

Page 793: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theflange.

3. Constructthesketch,asshowninfigure.

Page 794: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickFinish.5. OntheLouverdialog,

selectLouverShape>Formed.

6. Type-in5intheDepth

Page 795: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

boxandclicktheReverseDirectioniconbelowit.

7. Type-in10intheWidthboxandclicktheReverseDirectioniconbelowit.

8. ClickOKtoaddthelouver.

Page 796: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MakingthePatternAlongcurve1. Ontheribbon,click

Home>Feature>

Page 797: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PatternFeature .2. Selectthelouver

feature.3. OntheLouverdialog,

underPatternDefinitionsection,selectLayout>Along.

4. UnderDirection1section,clickSelectPath.

5. OntheTopBorderBar,selectCurveRule>SingleCurve.

Page 798: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. Selecttheverticaledgeoftheflangefeature.

7. UndertheDirection1section,selectSpacing

Page 799: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

>CountandSpan.8. SetCountto3.9. Set%SpanByas60.10. Makesurethatthe

arrowpointsdownwards.Youcandouble-clickonittoreverseitsdirection.

11. ClickOKtoconstructthepatternalongcurve.

Page 800: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheBead1. Toaddthebead,click

Home>Punch>

Bead onthe

Page 801: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ribbon.2. Selectthetopfaceof

thetabfeature.

Page 802: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Drawalineanddimensionit.

4. ClickFinishontheribbon.

Page 803: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. UndertheBeadPropertiessection,selectCrossSection>Circular.

6. SetDepthto4andclicktheReverseDirectioniconbelowit

7. SetRadiusto4.8. SelectEndCondition

>Formed.9. ClickOKtoaddthe

bead.

Page 804: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheDrawnCutout1. Toaddthedrawn

Page 805: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

cutout,clickHome>Punch>DrawnCutout ontheribbon.

2. Selectthefaceofthecontourflange.

Page 806: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Drawacircleand

dimensionit.

Page 807: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickFinishonthe

ribbon.5. SetDepthto10.6. SetSideAngleto5.

Page 808: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. SelectSideWalls>MaterialOutside.

8. ExpandtheDrawnCutoutdialogandunchecktheRoundSectionCornersoptionundertheRoundingsection.

9. SetDieRadiusto3.10. ClickOKtoaddthe

drawncutout.

Page 809: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingGussets1. Toaddgussets,click

Home>Punch>

Page 810: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Gusset ontheribbon.

2. Clickonthebendfaceofthecontourflange.

3. OntheGussetdialog,selectType>AutomaticProfile.

4. UndertheLocationsection,selectYCfromthedrop-down.

5. UndertheShapesection,setDepthto12.

Page 811: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. SelectForm>Round.7. SetWidthto10.8. SetSideAngleto2.9. SetPunchRadiusand

DieRadiusto2.10. ClickOKtoadd

gussets.

Page 812: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ConstructingtheMirrorFeature1. Toconstructthemirror

feature,clickHome>

Page 813: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Feature>More>MirrorFeatureontheribbon.

2. UnderthePartNavigator,presstheCtrlkey,andthenselectthecontourflange,closedcorner,beadfeature,andgusset.

Page 814: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 815: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. UndertheMirrorPlanesection,clickSelectPlane.

4. SelecttheYZplane.

Page 816: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. ClickOKtoconstructthemirrorfeature.

MakingtheFlat

Page 817: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Pattern1. Tomaketheflat

pattern,clickHome>FlatPattern>FlatPattern ontheribbon.

2. Clickonthetopfaceofthetabfeature.

Page 818: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. UnchecktheMovetoAbsoluteCSYSoption.

4. ClickOKtomakethe

Page 819: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

flatpattern.5. OntheSheetMetal

message,clickOK.6. Toviewtheflat

pattern,clickView>Orientation>More>ViewLayout>NewLayout ontheribbon.

7. OntheNewLayoutdialog,selectFLAT-PATTERN#1andclickOK.

Page 820: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. Toviewthe3Dmodel,

clickView>Orientation>More>NewLayoutonthe

Page 821: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ribbon.9. OntheNewLayout

dialog,selectIsometricandclickOK.

Page 822: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. Saveandclosethefile.

Page 823: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 824: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 825: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter9:Top-DownAssemblyInthischapter,youwilllearnto

Createatop-downassembly

Page 826: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

InsertfastenersCreateSequencesCreateDeformablePartsandassemblethem

Page 827: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL1Inthistutorial,youwillcreatethemodelshowninfigure.Youusetop-downassemblyapproachtocreatethismodel.

Page 828: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CreatingaNewAssemblyFile

1. ClicktheNewiconon

Page 829: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theQuickAccessToolbar,selecttheAssemblytemplate,andclicktheBrowseiconlocatednexttotheNamebox.

2. Createanewfolderandopenit.

Page 830: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. TypeTutorial1intheFileNamebox.

4. ClickOKtwice.

5. ClickCancelontheAddComponentdialog.

CreatingacomponentintheAssembly

Page 831: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Inatop-downassemblyapproach,youcreatecomponentsofanassemblydirectlyintheassemblybyusingtheCreateNewtool.1. Ontheribbon,click

Assemblies>Component>Create

New .2. SelecttheModel

template,typeBaseintheNamebox,and

Page 832: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clickOK.3. ClickOKonthe

CreateNewComponentdialog.

4. ClicktheAssemblyNavigatortabontheResourceBar.

5. Double-clickontheBasecomponent.Thepartmodeisactivated.

Page 833: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. ClickHome>Sketch

ontheribbonandselecttheXYplanefromDatumCoordinateSystemandclickOK.

7. Createthesketchasshownbelow.

Page 834: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. ClickFinishSketch.3. ClickHome>Feature

>ExtrudeontheRibbonandextrudethesketchupto40mm.

Page 835: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Createacylinderof50

mmdiameterand95mmlengthonthetopface.

Page 836: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Ontheribbon,click

Home>Features>Hole.

6. OntheHoledialog,selectType>General

Page 837: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Hole.7. IntheFormand

Dimensionssection,settheparameters,asshown.

Form:CounterboredC-BoreDiameter:30C-BoreDepth:12Diameter:25DepthLimit:ThroughBody8. Selectthecenterpoint

Page 838: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ofthetopcircularedge.

9. ClickOK.

10. Ontheribbon,clickthe

Assemblies>Context

Page 839: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Control>WorkonAssembly.

CreatingtheSecondComponentoftheAssembly1.Ontheribbon,clickAssemblies>Component>

CreateNew .2.SelecttheModeltemplate,typeFlangeintheNamebox,andclickOK.

Page 840: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3.ClickOKontheCreateNewComponentdialog.4.IntheAssemblyNavigator,double-clickontheFlangetoactivatetheWorkpartmode.5.ClickHome>DirectSketch>SketchontheRibbon.6.OntheTopBorderBar,settheSelectionScopetoEntireAssembly.7.Selecttopfaceofthe

Page 841: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Base.

8.ClickOK.9.Ontheribbon,clickHome>DirectSketch>

ProjectCurve .

Page 842: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10.OntheTopBorderBar,clicktheCreateInterpartLink icon.11.SelectthecircularedgeoftheBase.

Page 843: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12.ClickOKtwice.13.Drawacircleof120mmdiameter.

14.ClickFinishSketch.15.ActivatetheExtrude

Page 844: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

toolandextrudethesketchupto40.

16.ClickthePartNavigatortabontheResourceBarandnoticethe

Page 845: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

LinkedComponentCurve(1).17.IntheAssemblyNavigator,double-clickonTutorial1toswitchtotheassemblymode.CreatingthethirdComponentoftheAssembly1. Ontheribbon,click

Assemblies>Component>Create

Page 846: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

New .2. SelecttheModel

template,typeHeadScrewintheNamebox,andclickOKtwice.

3. IntheAssemblyNavigator,rightclickonHeadScrewandselectMakeWorkPart.

4. StartasketchontheXZPlane.

Page 847: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Ontheribbon,clickHome>DirectSketch>MoreCurve>IntersectionCurve.

6. OntheTopBorderBar,clicktheCreateInterpartLinkicon.

7. OntheTopBorderBar,settheSelectionScopetoEntireAssembly.

Page 848: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. Rotatetheviewandselectthefaces,asshown.

Page 849: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. ClickOK.10. Rightclickandselect

OrientViewtoSketch.

11. Drawtheotherlines,asshown.

Page 850: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. ClickFinishSketch.

Page 851: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. ActivatetheRevolvetoolandrevolvethesketch.

14. ActivatetheChamfer

Page 852: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

toolandchamfertheedges,asshowninfigure.

15. ActivatetheEdge

Blendtoolandroundtheedges,asshownin

Page 853: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

figure.

16. Ontheribbon,clickHome>Assemblies>WorkonAssembly.

EditingtheLinked

Page 854: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Parts1.RightclickontheBaseandselecttheMakeWorkPart.2.SelectthefaceoftheBase,asshown.3.ClickShowDimensionsontheShortcutstoolbar.

Page 855: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4.ChangetheDiameterdimensionto60andLineardimensionto80.5.ActivatetheAssembly

Page 856: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

modeandnoticethatthelinkedpartsarealsomodified.

17. Ontheribbon,clickAssemblies>General

Page 857: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

>InterpartLinkBrowser .TheInterpartLinksBrowserdialoghastwosections:PartsandInterpartLinksinSelectedParts.

YoucaneditalinkbyselectingitandclickingtheEdit icon.YoucanalsousetheBreakLink icontoremovethelink.

Page 858: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. ClosetheInterpart

LinkBrowserdialog.CreatingHoleSeriesAholeseriesiscreatedthroughdifferentpartsoftheassembly.1.Ontheribbon,clickHome>Feature>Hole.2.SelectthetopfaceoftheFlange.

Page 859: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3.SelectType>HoleSeries.4.PositiontheholeusingtheReferenceline,asshown.

Page 860: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5.ClickFinish.UndertheSpecificationsection,noticethethreetabs:

Page 861: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Start,Middle,andEnd.Theyareusedtosettheholeparametersforthethreebodiesthroughwhichtheholepasses.Forthisexample,youarerequiredtoonlysettheStartandEndparameters.6.UndertheSpecificationssection,clicktheStarttabandsettheparameters,asshown.Form:Simple

Page 862: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ScrewType:GeneralScrewClearanceScrewSize:M12Fit:Normal(H13)7.ClicktheEndtabandsettheparameters,asshown.Form:ThreadedDepthType:FullHandedness:RightHandedDepthLimit:ThroughBody

Page 863: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8.ClickOK.9.Likewise,createthreemoreseriesholes.

AddingFastenersto

Page 864: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

theassembly1. Ontheribbon,click

Tools>ReuseLibrary>FastenerAssembly .

2. OntheFastenerAssemblydialog,selectType>Hole.

3. Selectanyoneoftheholes.

4. ClicktheAddFastenerAssembly

icon.

Page 865: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. SettheConfigurationNametoAM-HexBolt/Stacks.

6. UndertheFastenerConfigurationsection,clicktheRemoveiconnexttoPlainWasher,Regular,AMunderTopStacks.

Page 866: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. ClickOK.8. OntheConfiguration

section,clicktheProperties iconnexttoHexBolt,AM.

9. OntheEditReusableComponentdialog,setthe(L)Lengthvalue

Page 867: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

to100.Also,noticetheparametersofthehexboltintheDetailssection.Theyarereadonly.

10. ClickOK.11. ExpandtheSettings

sectionandchecktheCreateConstraintsAutomaticallyoption.

12. IntheConfigurationsection,rightclickonAM-HexBoltStacksandselectSave

Page 868: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Configuration.13. TypeFastener1inthe

NameboxandclickOK.

14. ClickOKtoaddthefastenerassembly.

Page 869: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. Likewise,createaddfastenerstootherholes.

Page 870: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. Savetheassemblyand

allitsparts.

Page 871: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

TUTORIAL2Inthistutorial,youcreateasequenceoftheassembly.1. DownloadtheTutorial

2filesofChapter9.2. OpentheTutorial_2

assemblyfile.

Page 872: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. Ontheribbon,clickAssemblies>General>Sequence .

4. Ontheribbon,clickHome>Assembly

Page 873: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Sequence>New .5. OntheResourceBar,

clicktheSequenceNavigator tabandselectSequence_1.

6. ExpandtheDetailssectionoftheSequenceNavigatorandchangetheNametoHubPuller.

7. IntheDetailssection,double-clickintheValuecolumnofthe

Page 874: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DisplaySplitScreenrow.Thegraphicswindowissplitintotwoparts.

8. Dragaselectionboxaroundtheassemblydisplayedontherightside.

9. Ontheribbon,clickHome>SequenceSteps>Disassemble

.Thedisassembleeventsaredisplayed

Page 875: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

underthePreassembledfolderoftheSequenceNavigator.

10. Ontheribbon,clickHome>Playback>PlayBackwards .Noticethatthepartsareassembledbackina

Page 876: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

randomsequence.11. IntheSequence

Navigator,presstheCtrlkeyandselectalltheeventsunderthePreassembledfolder.

12. RightclickandselectDelete.

13. SelectthetwoinstancesofPart_4andclicktheDisassembleTogether

iconontheribbon.14. SelecttheSequence

Page 877: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Group1fromtheSequenceNavigatorandchangeitsNametoPins.

15. SelectthePart_3andclicktheDisassembleiconontheribbon.

16. Likewise,disassembletheotherinstanceofPart_3,Part_2,andParte_1.

17. Ontheribbon,clicktheRecordCamera

Page 878: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Position icon.18. IntheSequence

Navigator,selectthePinseventandchangetheTotalDurationvalueintheDetailssectionto2.

19. Likewise,changetheTotalDurationvaluesofothereventsto2.

20. OnthePlaybackgroupofribbon,changethePlaybackSpeedto10.

Page 879: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

21. OnthePlaybackgroup,clicktheExporttoMovie icon.

22. TypeHuPullerassemblyintheFilenameboxandOK.Themovieoftheassemblysequenceisrecorded.

23. ClickOKontheExporttoMoviemessage.

24. ClickFinish.25. Openandplaythe

Page 880: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

video.26. Closealltheparts.TUTORIAL3Inthistutorial,youcreateadeformablepartandaddittoanassembly.CreatingtheDeformablePart1. DownloadtheTutorial

3filesofChapter9.2. Openthe

Page 881: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Deformable_part.prtfile.

3. OntheTopBorderBar,clickMenu>

Page 882: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Tools>DefineDeformablePart.

4. LeavethedefaultNamevalueandclickNext.

5. SelectallfeaturesfromtheFeaturesinPartlistandclickAddFeature .

6. ClickNext.7. SelectPitch=15from

theAvailableExpressionslistandclickAddExpression

Page 883: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

.8. TypePitchinthebox

belowtheDeformableInputExpressionslist.

9. SettheExpressionRulestoByNumberRange.

10. Type8and15intheMinimumandMaximumboxes.

11. ClickNextandFinish.12. Saveandclosethefile.

Page 884: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

AddingtheDeformableparttoanAssembly1. OpentheTutorial3

assemblyfile.

Page 885: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Ontheribbon,clickAssemblies>Component>Add.

3. ClicktheOpeniconontheAddComponent

Page 886: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialog.4. Gotothelocationof

theDeformable_part.prtfileanddouble-clickonit.

5. SetPositioningtoByConstraints.

6. SelectReferenceset>EntirePart.

7. ClickOK.8. OntheAdd

Constraintsdialog,selectType>Touch

Page 887: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Align.9. SelectOrientation>

Touch.10. Selectthebottomflat

faceofthedeformablepart.

Page 888: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

11. Selecttheflatfaceof

theplate,asshown.

Page 889: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Selectthetopflatfaceofthedeformablepart.

Page 890: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. Selecttheflatfaceof

theupperplate,asshown.

Page 891: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. SelectOrientation>

InferCenter/Axis.15. SelecttheZ-axisofthe

deformablepart.

Page 892: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. Selecttheselect

circularedgeoftheplate.

Page 893: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

17. ClickOK.18. ChangethePitchvalue

ontheDeformable_partdialogto10by

Page 894: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

draggingtheslider.19. ClickOK.

20. OntheResourceBar,clickthePartNavigatortab.

21. Rightclickonthe

Page 895: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Deformable_partfeatureandselectEditParameters.

22. Dragtheslidertochangethepitchvalueto15.

23. ClickOK.Theassemblyisupdated.

Page 896: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

24. Saveandclosethefiles.

Page 897: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 898: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter10:Dimensions

andAnnotations

Inthischapter,youwilllearnto

Page 899: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CreateCenterlinesandCenterMarksEditHatchPatternApplyDimensionsPlaceDatumFeaturePlaceFeaturecontrolframePlaceSurfaceFinishsymbol

TUTORIAL1

Page 900: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Inthistutorial,youcreatethedrawingshownbelow.

Page 901: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 902: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Download

theAdapterPlatefileofChapter10.

2. StartNX10andclicktheNewiconontheribbon.

3. ClicktheDrawingtab,selectRelationship>Reference

Page 903: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ExistingPart.

4. SelecttheA4template.

5. ClicktheBrowseiconundertheParttocreateadrawingof.

6. ClickOpenontheSelectmasterpart.

7. Gotothe

Page 904: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

locationoftheAdapterPlatefileanddouble-clickonit.

8. ClickOKontheSelectmasterpartandNewdialogs.

9. TypevaluesonthePopulateTitleBlock

Page 905: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialogandclickClose.

CreatingaViewwithCenterMarks1. ClicktheResetbutton

ontheViewCreationWizard.

Page 906: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. ClicktheNextbuttonontheViewCreationWizard.

3. OntheOptionspage,leavetheShowCenterlinesoptionselected.

4. ClickNext.5. SelectFrontviewand

clickFinish.

Page 907: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. SelecttheviewandpressDelete.

7. Ontheribbon,clickHome>View>BaseView.

8. OntheBaseView

Page 908: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialog,expandtheSettingssectionandclicktheSettingsicon.

9. OntheSettingsdialog,clickGeneralfromthetree.

10. OntheGeneralpage,unchecktheCreatewithCenterlinesoptionandclickOK.

11. SelectModelViewtoUse>Front.

Page 909: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. SettheScalevalueto2:1.

13. Clickonthedrawingpage,asshown.

Page 910: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. ClosetheProjected

Viewdialog.15. ClickHome>View>

SectionViewontheRibbon.

16. Selectthecenterpointofthefrontview.

17. Placethesectionviewontherightside.

18. ClickClose.

Page 911: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

CreatingCenterlinesandCenterMarks1. ClickHome>

Annotation>CenterMark>BoltCircle

Page 912: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Centerline ontheRibbon.

2. OntheBoltCircleCenterlinedialog,selectType>Through3orMorePoints.

3. LeavetheFullCircleoptionchecked.

4. Selectthecounterboreholepattern.

5. Dragthearrowthatappearsonthe

Page 913: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

centerlinetochangeitsExtensionlength.

6. ClickOK.7. ClickHome>

Annotation>Centerlinedrop-

Page 914: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

down>CircularCenterline ontheRibbon.

8. OntheCircularCenterlinedialog,unchecktheFullCircleoption.

9. Selectthecenterpointsofthearcs,asshown.

Page 915: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. ClickOK.11. ClickHome>

Annotation>Centerlinedrop-down>2DCenterline

Page 916: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ontheRibbon.12. Onthe2DCenterline

dialog,selectType>ByPoints.

13. OntheTopBorderBar,activatetheControlPointandIntersectionicons,anddeactivatetheArcCentericon.

Page 917: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. Selectthepointsontheslot,asshown.

15. Dragthearrowto

reducethelengthofthe

Page 918: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

centerline.

16. ClickApply.17. Likewise,create

centerlinesonotherslots,asshown.

Page 919: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. ClickHome>Annotation>Centerlinedrop-down>AutomaticCenterline onthe

Page 920: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Ribbon.19. Selectthefrontview

andclickOK.

EditingtheHatch

Page 921: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Pattern1. Double-clickonthe

hatchpatternofthesectionview.TheCrosshatchdialogappears.

2. OntheCrosshatchdialog,expandtheSettingssectionandnoticeoptionstomodifythehatchpattern.

Page 922: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

YoucanselecttherequiredhatchpatternfromthePatterndrop-down.Youcanadjustthedistance,angle,color,width,boundarycurvetolerance.YoucanalsoselectadifferentsetofhatchpatternsfromtheCrosshatchDefinitiondrop-down.3. ClickOK.

Page 923: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ApplyingDimensions1. OntheTopBorder

Bar,clickMenu>Tools>DraftingStandard.

2. OntheLoadDraftingStandarddialog,selectStandard>ASME.

3. ClickOK.4. ClickHome>

Dimension>RapidDimensiononthe

Page 924: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Ribbon.5. OntheRapid

Dimensiondialog,undertheMeasurementsection,selectMethod>Vertical.

6. Selectthehorizontaledgeandtheouterarcofthefrontview.

7. Movethepointertowardleftandclick.

Page 925: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

8. OntheRapid

Dimensiondialog,selectMethod>

Page 926: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Radial.9. Createradial

dimensionsbyselectingthecircularcenterlines,outerarc,andslotarc.

Page 927: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. OntheRapidDimensiondialog,selectMethod>

Page 928: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Diametral.11. Selectthecounterbore

holeandpositionthediameterdimension,asshown.

Page 929: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. OntheRapid

Dimensiondialog,selectMethod>Angular.

Page 930: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. Selectthe2Dcenterlinesoftheslotandpositiontheangulardimension,asshown.

Page 931: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. Likewise,createanotherangulardimension,asshown.

Page 932: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

15. OntheRapidDimensiondialog,undertheMeasurementsection,selectMethod>Cylindrical.

16. Zoomtothesectionviewandselecttheendpoints,asshown.

17. Movethepointerrightandpositionthedimension.

Page 933: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. Selectthehorizontaledgesoftheholeandpositionthedimension,asshown.

Page 934: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

19. Createanothercylindricaldimensionforthecounterborehole.

Page 935: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

20. ClickHome>Dimension>LinearDimension ontheRibbon.

21. Selecttheverticesofthesectionview,asshown.

Page 936: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

22. Movethepointerup

andplacethepointer.23. OntheLinear

Dimensiondialog,expandtheDimension

Page 937: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

SetsectionandselectMethod>Chain.

24. Selectthevertexofthesectionview,asshown.

25. ClickCloseonthe

dialog.26. Dragthedimension6

Page 938: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

towardleft.

AttachTexttoDimensions1. Zoomtothefrontview

Page 939: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

anddouble-clickondiameter3.

2. ClicktheArrowOutDiameter onthepalette.

3. ClicktheEditAppendedTexticon.

4. OntheAppendedTextdialog,selectTextLocation>Above.

5. Typethetextinthe

Page 940: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

boxavailableonthedialog.Also,usethediametersymbolavailableintheSymbolsection.

6. SelectTextLocation

>Before.

Page 941: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

7. ClicktheInsertCounterbore iconintheSymbolssection.

8. SelectTextLocation>After.

9. ClicktheInsertDepthiconintheSymbolssectionandtype1.

10. ClickCloseonthedialog.

11. Dragthedimension,asshown.

Page 942: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

12. Likewise,attachtextto

theradiusdimensionoftheslot.

Page 943: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. Double-clickontheradiusdimension.

14. Clickonthesquaredotattachedtothearrow.

15. SelecttheOutoptionfromthehandle.

Page 944: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

16. Likewise,changethe

arrowdirectionoftheotherradialdimensions.

Page 945: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

17. Doublethecounterboredimension.

18. Onthepalette,selectBilateralTolerance

Page 946: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

fromtheTolerancedrop-down.

19. Type+0.1and-0.1inthetolerancesboxes.

20. ClickClose.

Page 947: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PlacingtheDatum

Page 948: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

FeatureSymbol1. ClickHome>

Annotation>DatumFeatureSymbol ontheRibbon.

2. OntheDatumFeatureSymboldialog,expandtheLeadersectionandclickSelectTerminatingObject.

3. Selecttheextensionlineofthedimension,asshownbelow.

Page 949: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Movethecursor

downwardandclick.

Page 950: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. OntheDatumFeatureSymboldialog,typeBintheLetterboxundertheDatumIdentifiersection.

6. ClickSelectTerminatingObjectandselecttheverticaledgeofthesectionview,asshown.

7. Movethepointertowardsrightandclick.

8. ClickClose.

Page 951: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PlacingtheFeatureControlFrame1. ClickHome>

Annotation>FeatureControlFrameontheRibbon.

Page 952: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Onthedialog,selectCircularRunoutfromtheCharacteristicdrop-down.

3. Type-in0.02intheTolerancebox.

4. SelectAfromthePrimaryDatumReferencedrop-down.

Page 953: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

5. Placethepointeronthe

counterborediameterdimension.

6. Clickwhenadashed

Page 954: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

rectangleappears.

7. Onthedialog,selectParallelismfromtheCharacteristicdrop-down.

8. Type-in0.02intheTolerancebox.

9. SelectBfromthePrimaryDatum

Page 955: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Referencedrop-down.9. ExpandtheLeader

section,andclickSelectTerminatingObject.

10. SelectanedgeparalleltotheDatumB.

11. ClickSelectTerminatingObjectandselectanotheredgewhichisparalleltotheDatumB.

Page 956: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. ClickClose.

Page 957: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PlacingtheSurfaceTextureSymbols1. ClickHome>

Annotation>SurfaceFinishSymbol ontheRibbon.

2. SettheRoughness(a)valueto63onthedialog.

3. Clickontheinnercylindricalfaceofthehole,asshownbelow.

Page 958: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. ClickClose.5. Saveandclosethefile.

Page 959: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Chapter11:SimulationHandsonTutorialTUTORIAL1Inthistutorial,youperformFiniteElementAnalysisona

Page 960: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

part.1. DownloadtheTutorial

1partfileofChapter11,andopenit.

Page 961: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

2. Ontheribbon,clickApplication>SimulationAdvanced

Page 962: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

.3. OntheSimulation

Navigator,selectTutorial1.prt.

4. Ontheribbon,clickHome>Context>NewFEMandSimulation .

5. LeavetheCreateIdealizedPartoptionchecked.Noticethethreefiletypes(FEM,Simulation,and

Page 963: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Idealized):Tutorial1_fem1.fem,Tutorial1_sim1.sim,Tutorial1_fem1_i.prtdisplayedonthedialog.Notethatthreefilesarecreatedinadditiontothemainpartfile.

6. UndertheSolverEnvironmentsectionselectSolver>NXNASTRAN.

7. SelectAnalysisType

Page 964: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

>Structural.8. ClickOK.9. Leavethedefault

optionsontheSolutiondialogandclickOK.

OntheSimulationNavigator,noticetheStatusoftheSimulationandFEMfiles.

Page 965: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. ExpandtheSimulation

FileViewsection,rightclickonTutorial1_sim1,andclickSave.Thesimulationtoolsaredisplayedontheribbon.

Page 966: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PreparingtheIdealizedPart1. HidetheSimulation

FileViewsection.2. OntheSimulation

Navigator,expandthe

Page 967: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Tutorial1_fem1.femnode,rightclickonTutorial1_fem1_i.prt,andclickMakeDisplayedPart(or)clickView>Window>Tutorial1_fem1_i.prtontheribbon.

3. ClickOKontheIdealizedPartWarningmessagebox.NoticetheStatusoftheidealizedpart.

Page 968: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

4. Ontheribbon,click

Home>Start>Promote .

5. SelectthegeometryfromthegraphicswindowandclickOK.Theprogramestablishesan

Page 969: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

associativelinkbetweentheidealizedpartandthemainpartfile.

Now,youneedtopreparetheidealizedpartbyremovingsomefeaturessuchasholesandblends.6. Ontheribbon,click

Home>SynchronousModeling>Delete

Page 970: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Face .7. OntheDeleteFace

dialog,selectType>Hole,andunchecktheSelectHolesbySizeoption.

8. Selectthecylindricalfaceofthecounterbore,asshown.

Page 971: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

9. Selecttheother

counterboreholes,asshown.

Page 972: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

10. ClickApplytodelete

thecounterboreholes.11. OntheDeleteFace

Page 973: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialog,selectType>Blend.

12. SelecttheedgeblendsofthegeometryandclickOK.

13. ClickSaveontheQuickAccessToolbar.Now,youneedto

Page 974: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

switchtoFEMfile.MeshingtheFEMfile1. Ontheribbon,click

Home>Context>ChangeDisplayedPart .

2. SelectTutorial1_fem1.femandclickOK.TheInformationwindowappearsshowingtheCAEPolygonUpdateLog.

Page 975: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

3. ClosetheInformationwindow.Also,noticetheStatusoftheTutorial1_fem1.femfileontheSimulationNavigator.

4. Ontheribbon,clickHome>Properties>MeshCollector .

5. OntheMeshCollectordialog,selectElementFamily>3D.

6. ClicktheCreate

Page 976: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

PhysicalPropertiesicon.

7. OnthePSOLIDdialog,typeCantileverintheNamebox.

8. ClicktheChooseMaterial icon.

9. OntheMaterialListdialog,selectSteelfromtheMaterialsectionandclickOK.

10. ClickOKonthePSOLIDandMesh

Page 977: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Collectordialogs.11. Ontheribbon,click

Home>Mesh>3DTetrahedral .

12. Selectthegeometryfromthegraphicswindow.

13. Onthe3DTetrahedralMeshdialog,selectType>CETRA(10).YoucanalsosettheelementtypetoCETRA(4).

Page 978: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

14. SettheElementSizeto3.

15. ExpandtheDestinationCollectorsection,unchecktheAutomaticCreationoption,andmakesurethattheMeshCollectorissettoSolid(1).

16. ClickOKtogeneratethemesh.

Page 979: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

YoucaneditorremovethemeshfromtheSimulation

Page 980: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Navigator.17. Expandthe3D

CollectornodeintheSimulationNavigatorandnoticethemeshproperties.

Page 981: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

18. ClickSaveonthe

QuickAccessToolbar.ApplyingLoadsandConstraintstotheSimulationfile1. Ontheribbon,click

Home>Context>ChangeDisplayedPart .

2. SelectTutorial1

Page 982: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

_sim1.simandclickOK.

3. OntheSimulationNavigator,expandtheTutorial1_fem1nodeanduncheckthe3DCollectorsnode.ThemeshisturnedOFF.

4. Ontheribbon,clickHome>LoadsandConstraints>LoadType>Force .

5. Selecttheholes,asshown.

Page 983: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

6. UndertheMagnitudesection,type2000intheForcebox.

7. UndertheDirectionsection,clickSpecify

Page 984: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

VectorandselecttheZ-axisfromthetriad.

8. ClicktheReverseDirection button.

9. ClickOKtoapplytheForceload.

10. OntheSimulationNavigator,expandtheLoadContainernode,rightclickonForce1,andselectEditDisplay.

11. OntheBoundaryConditionDisplay

Page 985: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialog,dragtheScaleslidertoreducethesizeoftheloadarrows.

12. ClickOK.

13. Ontheribbon,click

Home>LoadsandConstraints>ConstraintType>Fixed .

14. Selectthebackfaceofthegeometryandclick

Page 986: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OK.

SimulatingtheModelNow,youneedtocheckwhetherthesimulationmodelissetupproperly.

Page 987: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

1. Ontheribbon,click

Home>ChecksandInformation>More

>ModelSetup .2. Leavealltheoptions

checksontheModelSetupdialogandclickOK.

Theprogramchecksforanyerrorsduringthemodelsetupanddisplaystheminthe

Page 988: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Informationwindow.Also,theSolution-BasedErrorsSummarydisplaysthefollowinginformation.Solution-BasedErrorsSummary-----------------------------IterativeSolverOptionMorethan80percentoftheelementsinthismodelare3Delements.Itisthereforerecommended

Page 989: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

thatyouturnONtheElementIterativeSolverinthe"EditSolution"dialog.3. ClosetheInformation

window.4. OntheSimulation

Navigator,rightclickonSolution1nodeandselectEdit.

5. OntheSolutiondialog,checktheElementIterativeSolveroption,and

Page 990: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

clickOK.6. ClickSaveonthe

QuickAccessToolbar.7. Ontheribbon,click

Home>Solution>Solve .

8. ClickOKontheSolvedialog.

9. ClosetheInformationwindow,SolutionMonitor,andclickCancelontheAnalysisJobMonitor

Page 991: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

dialog.10. Ontheribbon,click

Home>Context>ChangeDisplayPart>OpenResults .

11. OnthePostProcessingNavigator,gotoSolution1>Structural>Stress-Element-Nodal.

12. Double-clickonVon-Mises.Theresultwillappear.

Page 992: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 993: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 994: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

13. Ontheribbon,click

Results>Animation>Play .Themodelissimulatedinthegraphicswindow.

14. ClickStop ontheAnimationgroup.

15. OnthePostProcessingNavigator,expandSolution1>Structural>Displacement–Nodal.

16. Double-clickonZ.The

Page 995: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

resultwillappear.

Page 996: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

17. Ontheribbon,click

Results>Context>ReturntoHome .

18. ClickFile>Close>AllParts.

19. ClickYesSaveandClose.

20. ClickYes.

Page 997: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 998: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,
Page 999: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Index2DCenterline,1143DTetrahedral,121Add,25AddComponent,110AddFastenerAssembly,108Align,26Align/Lock,26Angle,26

Page 1000: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Arc,47ArrowOutDiameter,117Assembly,25AssemblyConstraints,27AssignMaterials,77AutoBalloon,42AutomaticCenterline,114BaseView,36,42Bead,100Block,22BoltCircleCenterline,113Bond,26Boolean,20,62BordersandZones,40

Page 1001: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Boss,80Bottom-UpApproach,25BreakLink,107BuildFamily,92Center,26Chain,116Chamfer,54,72Circle,13,48Circleby3Points,45Circular,66CircularCenterline,114ClosedCorner,98ComponentPosition,27Concentric,26,30

Page 1002: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Conic,52ContourFlange,97ConverttoReference,51CreateInterpartLink,105CreateNew,104CreatePhysicalProperties,121CreateSnapshotData,41Customizedialog,5Cylinder,64Cylindrical,38DatumFeatureSymbol,118DatumPlane,58

Page 1003: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

DefineDeformablePart,109DefineExprRng,91DefineFmlyRng,92DefineTitleBlock,41DeleteBody,82DeleteFace,120DeleteThirdCurve,54Detailssection,88DisassembleTogether,109DisplayedPart,121,122Distance,26DivideFace,85Draft,22

Page 1004: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Drafting,39DraftingPreferences,37DraftingStandard,115DrawnCutout,100EdgeBlend,20,63,78EditAppendedText,117EditBackground,11EditExplosion,31EditParameters,72EditSheet,35Ellipse,50,60Emboss,63EqualLength,49EqualRadius,49

Page 1005: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ExportExpressionstoFile,93Expression,88ExtractExpr,90ExtractGeometry,82Extrude,14FastenerAssembly,108FeatureBased,1FeatureControlFrame,118FeatureGroup,87FEMandSimulation,120FileMenu,3Fillet,54Fit,14,26

Page 1006: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

FitViewtoSelection,15Fix,26,27Flange,96FlatPattern,102Force,122FromPlaneorSurface,86FullyConstrained,14GeometricConstraints,18,51Groove,59Gusset,101Helix,57Hole,70HoleSeries,107

Page 1007: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Import,84ImportExpressionsfromFile,93InferCenter/Axis,26InsertCounterbore,117InterpartLinkBrowser,107Intersect,69IntersectionCurve,106Line,16,51Linear,66LinearDimension,116Louver,99MakeCorner,53MakeCurrentFeature,84

Page 1008: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

MakeSymmetric,16MarkasTemplate,41MeasureBodies,76MeasureDistance,92Menu,7MeshCollector,121Midpoint,49MirrorCurve,55,61MirrorFeature,101ModelSetup,122MoreGallery,6New,18NewExplosion,31NewLayout,102

Page 1009: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

OffsetCurve,53,75OffsetFace,81OpenResults,123OrientViewDrop-down,14OrientViewtoSketch,106OverConstrained,14Pan,18Parallel,26,51parametric,1PartList,42PartNavigator,7PatternAlongcurve,99PatternFeature,66

Page 1010: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

Perpendicular,26,51Polygon,45,52,75Profile,18,47ProjectCurve,16,105Projectiontype,36Promote,120QuickExtend,52,53QuickTrim,52,53,74RapidDimension,19RasterImage,45Rectangle,21,44Refresh,27ReplaceFeature,84ResourceBar,7

Page 1011: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ReturntoHome,123Revolve,19,21Rib,70Ribbon,3RolesNavigator,8Rotate,18Save,18ScaleBody,82SectionView,36Sequence,108ShadedwithEdges,18SheetMetalPreferences,96Shell,64Shortcutstoolbar,17

Page 1012: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ShowAll,28ShowandHide,17ShowCenterlines,113ShowDegreesofFreedom,27ShowDimensions,73SimulationAdvanced,120Sketch,13Slot,65SnapHandlestoWCS,31SolidDensity,77Solve,122SplitBody,81Spreadsheet,90

Page 1013: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

StaticWireframe,16Statusbar,7Structural,120StudioSpline,46,60Subtract,69Suppress,73SuppressbyExpression,74SurfaceFinishSymbol,119SweepalongGuide,58Swept,61Tab,96TabularNote,40Thread,64ThroughPoint,58

Page 1014: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

ToPartingEdges,85TopBorderBar,7Top-DownApproach,25TouchAlign,26TouchPanel,8TouchTablet,8Tracelines,32TrimBody,78TrimRecipeCurve,17Tube,68UnderConstrained,14Unite,69UpdateNXPart,91UseFixedUpdateRange,

Page 1015: NX 10 Tutorial - DropPDF1.droppdf.com/files/X4VTB/nx-10-tutorial-sketching-feature-modelin... · NX 10 Tutorial Online Instructor ... starting a NX 10 session to constructing parts,

91View,15ViewCreationWizard,41WireframewithHiddenEdges,33WithinActiveSketchOnly,45Zoom,15ZoomIn/Out,15


Recommended