+ All Categories
Home > Documents > Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft...

Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft...

Date post: 02-Jan-2016
Category:
Upload: magdalen-hunt
View: 217 times
Download: 0 times
Share this document with a friend
33
Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser
Transcript
Page 1: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Practical Protein Sequence Alignment With Algebraic Dynamic Programming

Lyle Kopnicky

PacSoft Research Group

Tim Sheard, Adviser

Page 2: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Bioinformatics

• DNA, RNA and proteins are strings• Strings contain information• Some problems

• Determine relatedness of strands of DNA• Figure out how RNA folds on itself• Identify proteins in a sample

GTTAGCGTGAATCTGTACTGAG

Page 3: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Tools for bioinformatics• Written in a general-purpose

programming language such as C• Designed to solve a narrow range of

problems• When problem doesn’t fit tool:

• Tweak data to fit tool – awkward, inefficient, may not fully solve problem

• Write new tools – time consuming, error-prone, require maintenance

Page 4: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

The disconnect

#ifndef SS strncpy(pgm_name, "gsw", MAX_FN);#else strncpy(pgm_name, "ssw", MAX_FN);#endif standard_pam("BL50",ppst);

ppst->nsq = naa; ppst->nsqx = naax; for (i=0; i<=ppst->nsqx; i++) { ppst->sq[i]=aa[i]; /* sq = aa */ ppst->hsq[i]=haa[i]; /* hsq = haa */ ppst->sqx[i]=aax[i]; /* sq = aax */ ppst->hsqx[i]=haax[i]; /* hsq = haax */ } ppst->sq[ppst->nsqx+1] = ppst->sqx[ppst->nsqx+1] = '\0'; memcpy(qascii,aascii,sizeof(qascii)); /* set up the c_nt[] mapping */ ppst->c_nt[0]=0; for (i=1; i<=nnt; i++) { ppst->c_nt[i]=gc_nt[i]; ppst->c_nt[i+nnt]=gc_nt[i]+nnt; }}

Page 5: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

The disconnect

• General purpose languages are easily available, efficient, BUT

• Biologists think: amino acids, matching, classification

• General-purpose languages provide characters, procedures, objects

• Domain experts may not be expert programmers

• A lot of design, development and maintenance time

Page 6: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Domains and tools

DomainDomain

Domain

Domain

Bioinformatics

Tool

Tool

Tool

Architecture

Physics

Finance

ChemistryMathematics

General-purpose languages

Page 7: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Libraries

Page 8: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Domain-specific languages• Represent a problem in the way domain

experts think of it• Examples: Excel, HTML, Matlab• General enough to capture a domain, specific

enough to reduce design time• Small change in requirements = small change

in program• Easy to answer “what-if” questions• Can be implemented efficiently using known

techniques

Page 9: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Collaboration with OHSU lab• Dr. Srinivasa Nagalla’s laboratory• Goals

• Gain domain knowledge• Discover goals of biologists• Potential users of DSL

• Began with protein identification problem

Page 10: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Protein identification problem

?

?

?

?

SD gel

breakup into peptideschromatography

Page 11: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Protein identification problem

tandem mass spectrometry

RPRR

AVA

A

AVAQFQFPRR

AVAQFPRR

AV

AQ

FP

RR

AVAQFPRR

de novo sequencing

[Po]QFPVGR

A[AV]QFPVGR

[Po]QFPRR

[241.10]QFPVGR

A[AV]QFPRR

database search

?

…TRSSRAGLQFPVGRVHRLLR…

[241.10]QFPVGR

AVAQFPRR

AVAQFPRR

Page 12: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Database search• Not an exact match• Mutations – substitutions, insertions,

deletions• Modifications – amino acids altered by

another molecule• De novo sequencer outputs a list of

ambiguous queries, e.g.

[229.07]HhNyG[PS][198.1]QHADD[ep]VD[Rz]R

unidentified mass unordered pair

Page 13: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Sequence alignment• Find the best match between query

string and target (database) string• Each match is also called an alignment• Alignments are scored

WTABRRFCWGYPD KWGGSCASPNE F WT PDPYK

Target string

Query string

Page 14: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Alignment tools• Smith-Waterman dynamic programming

algorithm most common• O((n+m)2), where n and m are length of

strings• Run on every query-target pair, and data

sets are large• Requires precise query string

• FASTA, BLAST address speed problem• First look for runs of exact matches• Align on localized area

Page 15: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Fitting queries into FASTA• Generate all possible exact queries• Could be dozens of possibilities

NQQNGGGANGNAGQGGGQAGGG

[241.10]NEM[NP]YR

NP

PN

• Each one must be aligned – takes time• Output must be converted back to

original query string

Page 16: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Algebraic Dynamic Programming• Robert Giegerich, 2000• Generic approach to solving dynamic

programming problems using parsing• Domain-specific embedded language in

Haskell• Ambiguous queries can be represented

directly as a grammar• Searching with an ambiguous query slower,

but only one search instead of dozens• Still takes O((n+m)2) time

Page 17: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Trimming the search space• Filter target strings and localize search• Five-character substring exact match

NEMNPNEMPNEMNPYEMPNYMNPYRMPNYR

[241.10]NEM[NP]YRexact

• Matching techniques• Boyer-Moore on each substring-target pair• Pre-index database

Page 18: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Boyer-Moore• Finds an exact occurrence of one string

inside another• Doesn’t check every position – knows

when to skip ahead• Can run in sublinear time

SYNSNTLNNDIMLIKLKSAASLN xSAASL

SYNSNTLNNDIMLIKLKSAASLN x SAASL

Page 19: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Pre-indexing the database• Build a tree in which to look up

substrings, find positions in database• Substring tree: A substring at each node• Suffix tree: Path along labeled edges

describes substring

substring tree suffix tree

TADTA

ATD AD

TA

TAD, 2ADT, 2

DTA, 3

32

1

Page 20: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Sample output

Query string:[229.07]HhNyG[PS][198.1]QHADD[EP]VD[Rz]R:{21}

Target string:>MK14_HUMAN (Q16539) Mitogen-activated protein kinase 14MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES:{360}

Target range: 290-326LDSDKRITAAQALAHA YFAQYHDPDDEPVADPYDQSF :|XvvvXX:|^|X^||//|^|XXX -HhNyGPS-Q HA DDEPV DRzR Score: 31Time: 0.045 secs

Page 21: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Time and space usage

Small set Full set

Number of queries 5 4800

Query length 7–17 up to 21

Number of target strings 179 8500

Target string length up to 700 up to 7000

Small set Full set

time time space

No heuristic 2m35s — —

Boyer-Moore 3s — —

Substring tree pre-indexing 1s 5m 750MB

lookup 1s 1h49m 1GB

Page 22: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Smith-Waterman (1981)

• Local alignment problem• Dynamic programming algorithm• Pathways through table represent

alignments• Entry represents best score of an

alignment starting here, ending anywhere

Page 23: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

S.-W. alignment scoring

WTABRRFCWTYPDG WKGGSCASPNE

GE F WT PDPYDAW QAPT

match/substitution: s(a1,a2)

gap: -w x length

start/end = 0

Page 24: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Smith-Waterman Phase 1R F C W T Y P D W K

F

W

T

P

D 1 2 1 1 0 1 0 0

P 0 0 0 1 2 1 1 0 0 0

Y 1 0 0 0 1 2 1 0 0 0

D 0 1 0 0 0 0 1 1 0 0

A 0 0 1 0 0 0 0 1 0 0

W 0 0 0 1 0 0 0 0 1 0

Insertion, deletion or substitution

Page 25: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Smith-Waterman Phase 2R F C W T Y P D W K

F 2 3 3 2 1 0 0 1 0 0

W 2 1 2 3 2 1 0 0 1 0

T 1 2 1 1 2 2 1 0 0 0

P 0 1 2 1 1 1 2 0 0 0

D 0 0 1 2 1 1 0 1 0 0

P 0 0 0 1 2 1 1 0 0 0

Y 1 0 0 0 1 2 1 0 0 0

D 0 1 0 0 0 0 1 1 0 0

A 0 0 1 0 0 0 0 1 0 0

W 0 0 0 1 0 0 0 0 1 0

a

Trace back maximal pathways CWTYPD FWT PD

a

Page 26: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Today’s problems

transpositions

AN NA

one-to-many

W NAC

endpoint scoring

FGAK +5 AGNCF... 85 116 39 85 100...

dual representations

We need a way to model new problems quickly

Trying to fit new data into old tools…

Page 27: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Recurrence relations• Basis of traditional DP• Hard to design and

understand• Mixes together search space,

scoring, and order of evaluation

• Subscript errors are common in implementation

}0,,)),(),((max{ ,11,211,1, wHwHjSiSsHH jijijiji

Smith-Waterman recurrence relation

Page 28: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Algebraic Dynamic Programming• Giegerich, 2000• Grammars describe search space• Set of functions (evaluation algebra)

specifies scoring• Solution space is pared down by an

objective function

first string $ gnirts dnoces

Page 29: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Grammar & eval. algebra

localign = start <<< string ~~~ internal ~~~ string

... h

internal = subst <<< aa ~~~ internal ~~~ aa |||delete <<< aa ~~~ internal |||insert <<< internal ~~~ aa |||end <<< string ~~~ ’$’ ~~~ string... h

subst(a1,score,a2) = score + s(a1,a2)insert(score,a) = score – wdelete(a,score) = score – wend(str1,$,str2) = 0h[score1,...,scorek] = max[score1,...,scorek]

Page 30: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Traditional DP vs. ADP

Traditional DP solutions ADPTricky to design & implement recurrence relations

Grammar and algebra like you think, no subscripts

Difficult to extend to alternate problem descriptions

Just change grammar and evaluation algebra

Careful about order of evaluation

Order of evaluation automatic

Time complexity depends on recurrence relation

Time complexity depends on form of grammar

Very fast in C Haskell can be slow

Page 31: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Design of a DSL• Implement sample applications

• Use a flexible, higher-order language• Abstract out common themes

• Data structures• Operations

• Decide how to handle errors• Run-time errors• Type system

• Speed up implementation by generating C• From embedded language, like PAN• Using standalone compiler

Page 32: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

The next steps• Compare our alignments with biologists’• Accumulate protein scores• Try 2-3 character statistical matches• Pre-index using suffix trees• Reduce memory usage• Look for runs of exact matches as in

FASTA

Page 33: Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser.

Our contributions• Built a working relationship with bio lab

to understand domain• Demonstrated feasibility of aligning

large data sets in Haskell• Constructed a framework for

experimenting with representations for alignments, and heuristics for filtering target strings, localizing searches


Recommended