UNIVERSITE DE GENEVE
Département de botanique
et de biologie végétale
FACULTE DES SCIENCES
Professeur W. J. Broughton
Dr. W. J. Deakin
Regulation and Effects of the Type-three Secretion System
of Rhizobium species NGR234
THESE
Présentée à la Faculté des Sciences de l’Université de Genève
pour obtenir le grade de Docteur ès sciences, mention biologie
par
Kumiko KAMBARA
de
Toyohashi (Japon)
Thèse N° 3967
Genève
2008
2
Contents
French summary of the thesis – Résumé en français de la thèse 3
Chapter 1: General introduction
1. Symbiosis
Rhizobia
Arbuscular mycorrhizae
8
2. Symbiotic signal transduction within plants
Plant perception of Nod and Myc factors
Common symbiosis pathway
Downstream of the common signalling pathway
– specificity of the symbiosis
Common symbiosis pathway
Nod factor response factors
12
3. Symbiotic signals produced by rhizobia
a) Regulation overview – the role of NodD proteins
How many nod-boxes does a rhizobial strain need?
NodD proteins control Nod-factor synthesis via NB
NodD proteins initiate a signalling cascade
TtsI and tts-boxes
b) The roles of rhizobial surface polysaccharides in symbiosis
c) T3SS and its secretion protein
17
Summary of NGR234 symbiotic signals 29
Chapter 2: Do NodV & NodW regulate symbiotic signal production in NGR234? 31
Chapter 3: Characterisation of NopM and the role in symbiosis of NGR234 effector proteins
66
Chapter 4: Functions of Nops in eukaryotic cells 87
Chapter 5: Perspectives 105
References list 112
Publications list 128
Acknowledgemnts 130
3
Résumé en français de la thèse
L'interaction symbiotique entre les plantes légumineuses et les bactéries du sol a
été étudiée car ces symbioses présentent un avantage agricole. Les Rhizobia envahissent
les racines de la plante légumineuse et forment un organe très spécialisé appelé nodule.
Les bactéries symbiotiques ont une capacité de fixer l'azote atmosphérique et de le
convertir en ammoniac assimilable par la plante. Rhizobium sp. NGR234 a un large
spectre d'hôte, et peut noduler plus de 112 genres de légumineuses aussi bien que la non-
légumineuse (Pueppke and Broughton, 1999). La nodulation commence par un échange
de signaux moléculaires spécifiques entre la plante hôte et la bactérie (Long, 1996; Roche
et al., 1996; Spaink, 2000). La plante produit un cocktail de molécules composé de
flavonoides qui sont liberés des racines de la légumineuse pour attirer le rhizobia à la
racine et induire la cascade de régulation qui comprend des composés tels que les facteurs
du Nod, le système de sécrétion de type III (T3SS) et des polysaccharide de surface
(Figure 1).
Flavonoids
Nops
TtsI
nodA nodB nodC
ttsI
NodCNodA
NodB
nop
NB8
NB18 TB8
TtsI
RhcQ RhcN
NopA
NopX
NopBNopC
ATP ADP
NopJ
NopMNopP
NopTNopL
NopJ
NopP
NopL
Rhizobium sp. NGR234
Determination of symbiotic compatibility
HMW-EPS
KPS LPS
TB2
TtsI
TtsI
Nod-factors
Induction of nodulemorphogenesis
LMW-EPS
Rhamnose rich LPS
rmlB rmlD rmlA wbgA
NodD1
NodD1
NodD1
Figure 1. Modèle pour l'interaction entre les legumineuses et NGR234. Les flavonoid sécrétés par la racine de la légumineuse induisent l'expression de gènes symbiotiques dans la bactérie et la synthèse d'un deuxième signal bactérien tels que les facteurs du Nod via NodD1, le T3SS et les polysaccharides de surface.
4
Vraisemblablement, les flavonoids diffusent dans les bactéries où ils réagissent
réciproquement avec la protéine NodD appartenant à la famille de régulateurs
transcriptionels du type LysR, et déclenche une cascade de transduction du signal qui
contrôle le processus de l'infection (Broughton et al., 2000; Perret et al., 2000). Dans
NGR234, NodD1 est l'activateur principal (Relić et al., 1993), et dirige l'expression de 18
des 19 cis-élément conservés, appelées nod-boxes en liant (Kobayashi et al., 2004). En
plus de la protéine NodD, dans Bradyrhizobium japonicum, NodV et NodW membres de
famille des régulateurs à deux-composants, sont aussi impliqués dans la modulation de
l'expression des gènes de nodulation par des isoflavonoids via une série d’étapes de
phosphorylation (Göttfert et al., 1990; Loh et al., 1997; Sanjuan et al., 1992). En outre,
NodW de B. japonicum active ttsI qui possède en amont un promoteur nod box
dépendant, ainsi que la région du gène nodD1nodD2nolA (Krause et al., 2002). Dans
NGR234, les deux ORFs (ngr159 and ngr160) qui codent pour des membres putatifs de
la famille des régulateurs à deux composants que NodV-NodW ont été localisés sur le
megaplasmid (Streit et al., 2004). Nous avons étudié le rôle que jouent NodVW dans la
cascade régulatrice, basé sur le modèle de NodVW dans B. japonicum.
Un mutant polaire, NGRΩnodVW a été produit, l'effet de NodV et NodW a été
testé sur la cascade de régulation flavonoïde-dépendante tel que le modèle des protéines
de sécrétion, des polysaccharides. Le phénotype symbiotique a été testé sur plusieurs
plantes hôte. Cependant, aucun effet considérable de NodVW n'a put être observé Des
résultats d'EMSA montrant que NodW se lie seulement à NB18, plusieurs activités des
promoteurs ont été testées et comparées. L'analyse initiale a montré que les mutants de
nodVW ont réduit légèrement ou considérablement les activités des promoteurs des NBs
(NB8 et NB18) et TBs (TB2 et TB8) après induction par le flavonoïde. NodVW affectent
la cascade régulatrice, mais ils n'abolissent pas complètement l'expression du promoteur.
D’autres analyses des promoteurs pourraient révéler un effet distinct de NodVW sur la
région des promoteurs de nodD1 et NB19 qui paraissent être la fonction directe de
NodVW. Les effets de NodVW sur ces promoteurs ont déjà été observés sans induction
de flavonoïde. Ils suggèrent que la fonction de NodVW de NGR234 est le plus
probablement la répression de NodD1 et SyrM2 en absence de flavonoïde pour maintenir
5
un niveau d'expression bas de NodD1 et de la cascade régulatrice de la symbiose. Alors
une fois que l'inducteur stimule la cascade de la symbiose, NodVW active NodD2 qui est
le répresseur de NodD1. Par conséquent, l’abscence de NodVW, change la
synchronisation de la cascade régulatrice de la symbiose (Figure 2). En dépit de
l'homologie partagée, NodVW de NGR234 n'a pas montré la même fonction que NodVW
de B. japonicum. NodVW dans NGR234 pourrait être un régulateur plus global qui agit
plutôt sur les autres régulateurs clés que TtsI spécifiquement. Des études supplémentaires
détermineront les fonctions du NodV et NodW.
Flavonoids
Tim
e
NodV
NodW
NB3
NodD1
SyrM2
NodD2
NB19
SB2
Figure 2. Modèle de fonctionnement de NodVW dans la cascade régulatrice de NGR234. NodVW est un répresseur de NodD1 et SyrM2 en absence de flavonoïde pour maintenir un niveau d’expression bas de NodD1 et donc de la cascade régulatrice de la symbiose. Alors une fois que l'inducteur stimule la cascade de la symbiose, NodVW active NodD2 qui est le répresseur de NodD1. Par conséquent, un manque de NodVW change la synchronisation de la cascade régulatrice de la symbiose.
Un système de sécrétion de type III (T3SS) est aussi l’un des composants du
symbiote important qui détermine la gamme d'hôte. Cette machine injecte un cocktail de
protéines, appelées Nops (nodulation outer proteins) dans les cellules de l'hôte, et change
le fonctionnement normal de la cellule de l'eucaryote (Galan and Collmer, 1999).
NGR234 sécrète au moins neuf protéines, qui sont classées en deux groupes, les protéines
de translocation qui sont des composants de la machine de sécrétion et les protéines
effectrices qui sont injectées dans le cytoplasme de l’hôte via le T3SS (Figure 3). Par
exemple, NopA, NopB, NopC et NopX sont nécessaires pour le passage des protéines de
la bactéries vers le cytoplasme cellulaire de la plante (Ausmees et al., 2004; Deakin et al.,
2005; Marie et al., 2003; Saad et al., 2005). NopL et NopP ont été caractérisées comme
6
étant des protéines effectrices du T3SS rhizobia-spécifique et qui peuvent être
phosphorylées par kinases de la plante (Ausmees et al., 2004; Bartsev et al., 2003;
Bartsev et al., 2004; Skorpil et al., 2005).
NopJ
NopM NopP
NopTNopL
RhcQ RhcN
NopA
NopX
NopB
NopC
ATP ADP
Plant cell cytoplasm
Plant plasma membrane
Plant cell wall
Bacterial outer membrane
Bacterial cytoplasm
Bacterial inner membraneRhcT RhcVRhcR
RhcC2RhcC1
RhcU
RhcJ
RhcS
Figure 3. Modèle proposé du Type III sécrétion système de NGR234, adapté et modifié de Viprey et associés (Viprey et al., 1998). Les composants conservés du T3SS (protéines Rhc) constituent le canal à travers les membranes internes et externes bactériennes. Les protéines de translocation, NopA, NopB et NopC composent le pili, NopX forme un pore dans la membrane plasmique de la cellule hôte. Les protéines effectrices : NopJ, NopL, NopM, NopP et NopT sont injectées dans cytoplasme de l’hôte, et perturbent son métabolisme.
Des protéines effectrices supplémentaires, NopM, NopJ, et NopT (autrefois y4fR,
y4lO, et y4zC, respectivement) ont été suggéré à partir de leur homologie avec les
facteurs de la virulence (Freiberg et al., 1997; Marie et al., 2001). Le sérum anti-NopM a
détecté dans le surnageant de NGR234 une protéine d’approximativement 60 kDa mais
pas dans le mutant T3SS ou le mutant de suppression de nopM.
Le mutant de nopM a révélé que NopM peut agir comme un effecteur positif (par
exemple sur L. purpureus) ou comme un effecteur négatif (par exemple sur P. tuberosus)
selon les espèces de la plante. NopM est la première protéine de la sécrétion qui a été
observée ayant un effet positif ou négatif selon la plante hôte. Cependant, le phénotype
du mutant de nopM n'était pas équivalent à celui du mutant T3SS nul, c’est ce qui nous a
mené à construire des mutants multiples et d’émettre alors l'hypothèse que chaque Nop
7
dans le mélange de Nops sécrété par NGR234 est reconnu différemment et la capacité
globale de la nodulation de NGR234 est l'effet net de ceci. Le L. purpureus pourrait
expliquer la différence de phénotype entre NGR234 et NGRΩrhcN qui sont le résultat de
la somme de l’effecteur positif et négatif (Figure 4).
0
5
10
15
20
25
30
35
0
1
2
3
4
5
6
7
8
9
NGR234 NGRΩrhcN NGR∆nopM NGRΩnopJ
Nod
ule
num
ber
NGRΩnopL NGR∆nopP NGR∆nopT
Pla
ntw
eig
ht(g
)
0
5
10
15
20
25
30
35
0
1
2
3
4
5
6
7
8
9
NGR234 NGRΩrhcN NGR∆nopM NGRΩnopJ
Nod
ule
num
ber
NGRΩnopL NGR∆nopP NGR∆nopT
Pla
ntw
eig
ht(g
)
Figure 4. Phénotype symbiotique de Nops sur Lablab purpureus. Les mutants Nops de cinq effecteurs différents ont été inoculés sur L. purpureus et les phénotypes ont été comparés avec NGR234 et NGRΩrhcN. Chaque barre indique le nombre moyen de nodules fixateurs d'azote par plante, et les erreurs types des moyennes sont indiquées sur la barre.
Dans cette étude, le nombre d’effecteurs Rhizobiens du T3SS connus ont été
augmenté et ont montré leur interaction complexe sur plusieurs légumineuses. Nous
suggérons que ces réponses multiples sont selon la reconnaissance des plantes hôte par
rapport à chaque Nops. Peut-être que les effecteurs positifs aident dans le processus de
nodulation en modulant la voie de signalisation de l’hôte. Au contaire, l'effecteur négatif
doit être reconnu comme facteurs de l'avirulence et mène à une réaction de défense. Cela
aidera à comprendre le mécanisme de la symbiose en prouvant la fonction de chaque
protéine effectrice de NGR234.
Pour déterminer la fonction des Nops, nous avons utilisé comme modèle
eucaryote Saccharomyces cerevisiae. La protéine NopM fusionnée à la GFP a été
localisée dans noyau 3 h après induction, cependant cette protéine de fusion était instable.
L’augmentation de NopL est toxique pour la cellule de la levure. NopT est clivable lui-
même après avoir été exprimé dans cellule de la levure, le mutant ponctuel de NopT sur
la C93S a perdu cette activité enzymatique.
8
Chapter 1: General introduction
1. Symbiosis
A symbiotic interaction between two organisms, which are widely separated
phylogenetically, is an intimate association and can be prolonged or temporary. In a
symbiosis, growth, survival and/or reproduction of both the organisms are benefited
(Odum and Smalley, 1959). However, symbiotic interactions also include commensalism,
amensalism and parasitism. For plants, associations between fungi and bacteria are
thought to have been key innovations in the colonization of land and of subsequent
specific habitats. Plant-associated microbes act as metabolic partners accessing limiting
nutrients and also as protectors, producing toxins that ward off herbivores or pathogens.
Similar associations have arisen with animals, allowing colonization of diverse niches,
such as specialized feeding on plant or animal tissues. The organisms involved in a
symbiosis may be sufficiently fused that they cannot live apart or be recognized as
distinct entities without close scrutiny. The symbiotic interactions of legumes and
rhizobia, as well as the widespread mutualistic symbiosis between arbuscular mycorrhizal
fungi and vascular flowering plants, have been extensively studied as these symbioses
contribute a significant agricultural benefit.
Rhizobia
Soil bacteria belonging to Azorhizobium, Bradyrhizobium, Mesorhizobium,
Rhizobium and Sinorhizobium genera of the order Rhizobiales (collectively called
rhizobia) are able to have a symbiotic interaction with the plant family Leguminosae.
Rhizobia invade legume roots (or occasionally shoots) which form a highly specialized
organ, the nodule. Rhizobia have the ability to fix atmospheric nitrogen to ammonia
(Mylona et al., 1995). In nitrogen scarce environments, this is important for biological
productivity and soil fertility and thus for agriculture. Within plant cells of nodules are
bacteroids, a differentiated form of rhizobia able to fix nitrogen and supply it to the host
legume plant. In return, rhizobia obtain photosynthetic products and other nutrients from
their hosts. Infection of legumes by rhizobia and thus nodule development is highly
9
restricted in a process termed host specificity. Host plants only interact with a particular
species or strains of rhizobia (Dénarié et al., 1992). Host specificity is variable and can
depend on the rhizobia strain as well. Some strains have a very narrow host range, such
as Sinorhizobium meliloti or Rhizobium leguminosarum biovar trifolii, which nodulate
only a few legume genera. Whereas, other rhizobia have a broad host range as
exemplified by Rhizobium sp. NGR234 (hereafter NGR234), which can nodulate more
than 112 genera of legume as well as the non-legume Parasponia andersonii (Pueppke
and Broughton, 1999; Trinick, 1980).
OHOOH
OOH
OH
OOH
OOH
H
flavonols flavones
isoflavonesflavanones
OHOH
OH
HO
HOHO
HO O O
OO
Figure 1. Chemical structures of different groups of flavonoid compounds.
Nodulation begins with an exchange of specific molecular signals between the
host plant and rhizobia (Dénarié et al., 1996; Ehrhardt et al., 1996; Spaink, 2000). The
cocktail of plant produced flavonoid (2-phenyl-1,4-benzopyrone derivatives) compounds
(Figure 1) (Reddy et al., 2007) are released from legume roots attracting rhizobia to the
root and induce the expression of rhizobial nodulation-related (nod) genes. Some of the
nod gene products synthesize and secrete specific chitin-like lipochitooligosaccharides,
known as Nod factors, from the bacteria (Figure 2). Nod factors have 3 to 5 N-
acetylglucosamine residues attached to an unsaturated fatty acid at the non-reducing end,
10
and contain various chemical modifications (Lopez-Lara et al., 1995; Schultze et al.,
1992). These modifications are dependent on the rhizobial strain and confer host
specificity (Roche et al., 1996). Recognition of Nod factors by the plant causes a series of
host responses, including the activation of host gene expression, calcium spiking, root
hair deformation and curling, as well as the replication of root cortical cells (Downie and
Walker, 1999; Geurts et al., 2005; Oldroyd and Downie, 2004; Oldroyd and Downie,
2006). These physiological and morphological changes ultimately lead to the formation
of the nodule, in which rhizobia find an ideal environment to fix atmospheric nitrogen.
Thus, Nod factors play a key role during initiation of nodule development and bacterial
invasion (Broughton et al., 2000; Perret et al., 2000).
Figure 2. General structure of Nod factors produced by rhizobia, adapted from D'Haeze and Holsters (D'Haeze and Holsters, 2002). The substitutions (R1–R10) and the oligomerization degree (n) are dependent on bacterial species and strains.
In response to Nod factor secretion, root hairs are stimulated and cell wall growth
reoriented (Smit et al., 1992), resulting in curled root hairs (Figure 3). Nod factors also
promote the formation of infection threads, which are plant-derived tubular structures.
Thus rhizobia enter a pocket within a curled root hair, from which they are taken up into
a developing infection thread and begin to travel towards the root cortex where the
nodule primordium is developing (Cullimore et al., 2001; Parniske, 2000). At the tip of
the infection thread, rhizobia are released into the cytosol of a subset of nodule
primordium cells and enveloped in a plant-derived membrane, to form a symbiosome.
Subsequent cell divisions and rhizobial differentiation into bacteroids leads to the
formation of fully functional nitrogen-fixing root nodules (Oldroyd et al., 2005).
11
Infection thread
C
Cortical cell sionsdivi
D
Root hair curling
B
D
Rhizobia
Root hair
Flavonoids Nod factors
A
D E
Nodule formation
E
Nodule formation
E
Nodule formation
Infection thread
C
Cortical cell sionsdivi
D
Root hair curling
B
D
Rhizobia
Root hair
Flavonoids Nod factors
A
D E
Nodule formation
E
Nodule formation
E
Nodule formation
Figure 3. Invasion of legume root hairs by Rhizobium. A: Rhizobia naturally colonize the rhizosphere metabolizing organic compounds secreted by root cells. Flavonoids released by host legume roots further attract rhizobia leading to their attachment to root hairs. B: Elevated flavonoid concentrations at close proximity trigger the synthesis of Nod factors by rhizobia which induce root hair curling and bacterial penetration at the centre of infection pocket. C: Infection threads develop within the root hair towards the cortical cells of the root. D: A developing infection thread ramifies near the nodule primordia formed by dividing cortical cells and rhizobia are released from the infection thread to form symbiosomes within nodule cells (shown in pink). E: Numerous release events and subsequent cortical cell divisions lead to the development of the new root organ, the nodule.
Arbuscular mycorrhizae
Arbuscular mycorrhizae (AM) form a symbiotic association with the plant roots
supporting vascular plant development under nutrient-limiting and various stress
conditions (Graham and Miller, 2005). The AM-root interaction is an ancient symbiosis,
fossil evidence shows that it has existed in the roots of the earliest land plants for at least
460 million years (Remy et al., 1994) and may have played a key role in facilitating the
movement of plants onto land (Heckman et al., 2001; Redecker et al., 2000; Remy et al.,
1994). Within angiosperms, more than 80 % of species are able to form AM symbioses.
12
To initiate an AM symbiosis, following spore germination the hyphal germ tube
grows through the soil in search of a host root. Once contact between the symbionts has
been established, the fungus forms an appressorium on the root surface through which it
enters the root (Strack et al., 2003). Then, inside the root, fungal hyphae continue
growing until they penetrate the cell wall of an inner cortical cell, where highly ramified
fungal hyphae form tree-like structures, termed arbuscules (Harrison, 1997). At the same
time, AM also develop extensive hyphae outside of plant root, and this extraradical
hyphal development allows the fungus to supply important nutrients, including phosphate
from the a greater area of the soil to the plant, whilst in return AM receive carbohydrates
from the plant (Shachar-Hill et al., 1995; Smith et al., 2001). The AM symbiosis also
confers resistance to the plant against biotic and abiotic stresses.
The molecular signalling mechanisms between AM and host plants is not as well
understood as for the legume/rhizobia symbiosis. Although a recent study discovered that
the strigolactone 5-deoxystrigol is a signal factor in root exudates of Lotus japonicus
responsible for the induction of hyphal branching in germinating mycorrhizal spores
(Akiyama et al., 2005). Prior to this work, strigolactones had only been known as
germination inducers of seeds of the parasitic plants Striga and Orobanche. Whether
plants produce further molecules to trigger AM spore germination, attract hyphae or to
induce AM root colonisation is not known. The identity of any molecular signals
emanating from AM that signal to the host plant have also not been identified to date,
although the presence of a so-called Myc factors has been postulated (Genre et al., 2005;
Harrison, 2005). Myc factors have a function conceptually analogous to those of rhizobial
Nod factors i.e. to be essential symbiotic signals that activate the host plant's symbiotic
program.
2. Symbiotic signal transduction within plants
Genes required for the development of the host plant’s symbiotic program have
been identified by screening mutants of the model legumes L. japonicus and Medicago
truncatula unable to establish an efficient symbiosis. Mutants defective in one type of
symbiosis are subsequently checked for their ability to form the other symbiosis and
13
whether the biochemical signal of calcium spiking (see below) can be observed. This has
led to the establishment of a signalling cascade of legume genes with several genes
required for both types of symbiosis, but the initial detection events and subsequent root
re-development stages branching as specific plant genes are required (Figure 4). Despite
the extensive morphological differences between the rhizobial and AM symbioses, it is
remarkable that they share a number of common signalling components in legumes
(Figure 4). Several host genes are essential for both the rhizobial and AM symbioses, as
shown using several legume mutants which are not only defective for nodulation but also
for the AM interaction (Albrecht et al., 1999; Hirsch et al., 2001; Kistner and Parniske,
2002). These so called common symbiosis (SYM) genes (Kistner et al., 2005) are also
universally conserved in other legumes and in non-legumes (Zhu et al., 2006). These
observations supports the hypothesis that the rhizobial symbiosis in legumes may have
evolved from the more ancient AM symbiosis (Gianinazzi-Pearson, 1996).
Plant perception of Nod and Myc factors
Potential Nod factor receptor mutants should be blocked at all stages of Nod
factor signalling, i.e. Nod factor-induced root hair deformation, calcium influx and
spiking and nodule formation but should potentially still be capable of mycorrhization
(Amor et al., 2003; Miwa et al., 2006). Using these phenotypic criteria in mutant screens,
led to the identification of putative Nod factor receptor mutants and thus genes in L.
japonicus (Lj-NFR1 and Lj-NFR5) (Madsen et al., 2003; Radutoiu et al., 2003), Pisum
sativum (Ps-SYM10) (Geurts et al., 1997; Walker et al., 2000), and M. truncatula (Mt-
NFP) (Amor et al., 2003). Sequence comparisons of Lj-NFR5, Ps-SYM10 and Mt-NFP,
show they are orthologues and encode LysM-type receptor kinases (LysM-RKs), and
could be located in the plasma membrane. Previously LysM domains have been found in
proteins that bind peptidoglycans (Bateman and Bycroft, 2000) which are not structurally
dissimilar to Nod factors. Therefore these LysM-RKs are good candidates to bind to Nod
factors, however direct binding evidence is still lacking. Another potential receptor is Ps-
SYM2 from P. sativum, mutation of which has been shown to be deficient in the
perception of specific chemical modifications to Nod factors (Geurts et al., 1997). There
are other candidate receptor genes in M. truncatula, the two LysM-RKs, Mt-LYK3 and
14
Mt-LYK4, which have homology to Lj-NFR1 and Ps-SYM2, and these mediate Nod
factor-induced infection (Limpens et al., 2003).
For AM symbioses, as for the hypothetical Myc factors no potential host receptors
have been identified as yet. Furthermore to date, no AM mutants have been identified
blocked in the calcium signalling response, which would be indicative of an upstream
function (Figure 4).
Common symbiosis pathway
Genes common to both symbioses have been identified in M. sativa, P. sativum, L.
japonicus, M. truncatula, Phaseolus vulgaris, Vicia faba, and Melilotus alba. Mutants of
these genes are blocked at an early stage of both the rhizobial- and fungal-plant symbiotic
interactions. Examples from L. japonicus include the symbiosis receptor kinase, SYMRK
(Stracke et al., 2002), two transmembrane ion channel-like proteins CASTOR & POLLUX
(Imaizumi-Anraku et al., 2005; Kawaguchi et al., 2002; Schauser et al., 1998;
Szczyglowski et al., 1998), the nucleoporin NUP133 (Kanamori et al., 2006) and SYM24
(Miwa et al., 2006). As well as being incapable of an AM interaction, mutants of these
genes still exhibit root hair deformation in response to Nod factors, but subsequent root
hair curling, infection thread formation and calcium spiking are abolished (Imaizumi-
Anraku et al., 2005). Therefore, these genes act between downstream of NFR1 and NFR5
and upstream of intracellular calcium spiking (Figure 4). Lj-SYMRK orthologues were
found in M. truncatula (DMI2), M. sativa (NORK), and P. sativum (SYM19) (Endre et al.,
2002; Stracke et al., 2002). The M. truncatula DMI1 gene (Ane et al., 2004) is a
POLLUX orthologue, and as expected mutants of Mt-DMI1 and Mt-DMI2 block calcium
spiking but not root hair deformation (Catoira et al., 2000; Miwa et al., 2006; Shaw and
Long, 2003), indicating that they act upstream of calcium spiking, at early stage of both
symbiotic interactions.
Although the M. truncatula Mt-DMI3 mutant is also blocked at early stage of both
symbiotic interactions (Catoira et al., 2000) its phenotype is subtly different as it is still
capable of calcium spiking. Mt-DMI3 encodes a calcium and calmodulin-dependent
15
protein kinase (CCaMK) (Levy et al., 2004; Mitra et al., 2004a), and has been placed
downstream of calcium spiking response (Oldroyd and Downie, 2004). Similarly the Lj-
CCaMK, Lj-SYM6 (Harris et al., 2003; Kistner et al., 2005; Schauser et al., 1998) and Ps-
SYM9 (Levy et al., 2004; Mitra et al., 2004a), are Mt-DMI3 orthologues, and their
mutants cause similar phenotypes as the Mt-DMI3 mutant (Schneider et al., 2002).
Downstream of the common signalling pathway – specificity of the symbiosis
Downstream of the common signalling pathway, there must be a divergence in the
signalling cascade to initiate the transcriptional changes required for the distinct
morphological and developmental changes in each symbiosis. Genes involved at this
stage were identified from screens of legume mutants, still able to perform the early
signalling steps such as root hair deformation and calcium spiking, but unable to form
nodules or induce nodulin expression (Figure 4). In M. truncatula, mutants in two genes,
Mt-NSP1 and Mt-NSP2 (Catoira et al., 2000; Oldroyd and Long, 2003) showed that they
were required for nodule morphogenesis but acted downstream of Mt-DMI3 (Levy et al.,
2004; Mitra et al., 2004a). These mutants, Mt-NSP1 or Mt-NSP2 exhibit root hair
deformation (Catoira et al., 2000; Kalo et al., 2005; Smit et al., 2005) a normal Nod
factor-induced calcium influx and spiking (Oldroyd and Long, 2003), however they
completely lack infection threads, any sign of cortical cell division and there is no
induction of nodulin genes (Catoira et al., 2000; Mitra et al., 2004b; Oldroyd and Long,
2003). NSP1 and NSP2 are predicted to be GRAS-domain transcriptional regulators
(Heckmann et al., 2006). The mutant phenotypes and the similarity to GRAS domain
proteins suggests that they could be Nod factor-activated transcription regulators possibly
controlling key genes in nodule development (Kalo et al., 2005; Smit et al., 2005).
Homologues are also present in L. japonicus, Lj-NSP1 and Lj-NSP2, are also predicted
GRAS domain transcriptional regulators (Heckmann et al., 2006). Another potential
transcriptional regulator has been identified in L. japonicus Lj-NIN (orthologous to Ps-
SYM35) encodes a transmembrane protein with a potential nuclear localization signal and
a predicted DNA-binding domain and may also mediate symbiotic gene expression. Lj-
NIN is thought to act downstream of calcium spiking and is not required for
mycorrhization (Borisov et al., 2003; Schauser et al., 1998).
16
Flavonoids
Nod factor Myc factor?
Nod factor receptorLysM domein protein kinases
(e.g. Lj-NFR1/ Mt-LYK3,4/ Ps-SYM2Lj-NFR5/ Mt-NFP/ Ps-SYM10)
Myc-receptor?
Lj-NSP1, 2/ Mt-NSP1, 2Lj-NIN/ Ps-SYM35
Lj-SYMRK/ / Lj-SYM24Lj-CASTOR/ Lj-POLLUX/ Mt-DMI1/ Lj-NUP133
Mt-DMI2/ Ps-SYM19/ Ms-NORK
Calcium spiking
Lj-CCaMK/ / Mt-DMI3/ Ps-SYM9Lj-SYM6
Cortical cell divisions
Plant component(s)?
MycorrhizationNodulation
?
Gene expressionNodulins ?
Commonsignallingpathway
?
Figure 4. The nodulation and endomycorrhization signalling pathways. Specific components are shown in blue (nodulation) and pink (mycorrhization). Nod factor production is induced by plant produced flavonoids and then perceived by plant LysM receptor kinases. Putative Myc factors are also proposed to be perceived by unknown specific receptors. After the initial recognition events, a common signalling pathway (genes in green) is mediated by at least: seven loci in L. japonicus (SYMRK, CASTOR, POLLUX, NUP133, SYM24, SYM6, and CCaMK); three loci in M. truncatula (DMI1, DMI2, and DMI3); two loci in P. sativum (SYM19 and SYM9) and one loci in M. alba (NORK), these are required for both nodulation and mycorrhization. Downstream of the common signalling pathway are specific regulators and gene expression for each type of symbiosis.
17
3. Symbiotic signals produced by rhizobia
The majority of the experimental work in this thesis concerns the molecular
signals produced by rhizobia to enable nodule formation; particularly their regulation and
actions. Thus the next three sections (a-c) will give an introduction to these signals and
what is known of their functions, particularly focusing on NGR234. The first two
sections on regulation and the diversity of symbiotic signals will be discussed further in
chapter 2 in light of new results, and the final section on rhizobial type III secretion
systems will be expanded upon in chapters 3 & 4.
a) Regulation overview – the role of NodD proteins
The rhizobial regulation cascade which is induced by plant-produced flavonoids is
intricate and many factors participate (Broughton et al., 2000; Perret et al., 2000). The
initial signals of nodulation, flavonoids, accumulate in the cytoplasmic membrane of
rhizobia (Hubac et al., 1993) and interact with NodD proteins, members of the LysR
family of transcriptional regulators. NodD binds to highly conserved DNA sequences,
cis-regulatory elements, called nod-boxes (NB) found in the promoter regions of most
(nodulation) nod-genes, inducing a bend in the DNA at the binding site (Fisher and Long,
1993). The chaperonins GroESL modulate the binding activity of NodD and are known to
be necessary for the correct folding of NodD in S. meliloti (Fisher and Long, 1989; Yeh
et al., 2002). There is no direct evidence for a direct interaction between NodD proteins
and flavonoid yet, however it has been suggested that a NodD-flavonoid complex is
formed at the NB (Peck et al., 2006). Even in the absence of flavonoids, binding of NodD
to NB can occur (Feng et al., 2003) regardless of whether the actual flavonoid can
actually activate the downstream nod-loci (Fisher and Long, 1993). Interactions between
flavonoids and NodD proteins do not always lead to transcription, several flavonoids can
bind to NodD1 from S. meliloti, but only luteolin was capable of activating nod gene
expression (Peck et al., 2006). NodD proteins from different rhizobia respond to different
classes of flavonoids, and the spectrum of flavonoids secreted by a legume is considered
a determinant of host specificity. Conversely at the rhizobial level, although broad-host-
range rhizobia, such as NGR234 can be responsive to a wide range of flavonoid inducers,
18
other rhizobia with limited host ranges, such as R. leguminosarum bv. viciae, can still
respond to many flavonoids.
Rhizobia usually possess between one and five nodD homologues depending on
the species, for example: R. leguminosarum bv. viciae has one copy; Bradyrhizobium
japonicum USDA110 (hereafter USDA110) and NGR234 have two nodD genes, nodD1
and nodD2 (Fellay et al., 1998; Garcia et al., 1996; Göttfert et al., 1992); whilst S.
meliloti contains three, nodD1, nodD2 and nodD3 (Honma et al., 1990). In addition to
activation of genes preceded by NB, some NodD proteins repress the expression of
promoters containing NB (see below). In USDA110 and NGR234, NodD2 is known as a
repressor of nod-genes (Fellay et al., 1998; Garcia et al., 1996; Göttfert et al., 1992).
Whereas the single nodD gene from R. leguminosarum bv. viciae is auto-repressed by its
own product (Hu et al., 2000). Besides the NodD transcriptional regulators, USDA110
also possesses a two-component sensor-regulator system, NodV and NodW, responsive
to plant-produced isoflavone signals which functions as an independent regulator of nod
genes (Göttfert et al., 1990; Sanjuan et al., 1994) (see chapter 2).
How many nod-boxes does a rhizobial strain need?
Genomic sequence has revealed that rhizobia have multiple NB: S. meliloti 1021
has seven; M. loti MAFF303099 nine and USDA110 seven (Galibert et al., 2001; Kaneko
et al., 2000a; Kaneko et al., 2002). On the symbiotic plasmid of Rhizobium etli CFN42,
fifteen putative NBs were identified (Gonzalez et al., 2003). The symbiotic plasmid
pNGR234a of NGR234 carries nineteen NBs (Freiberg et al., 1997; Perret et al., 1999).
NBs do not only control Nod-factor synthesis (see below) as they are found in the
promoter regions of a variety of genes. For example, in B. japonicum only two NBs
regulate Nod factor production, upstream of nodY (Wang and Stacey, 1991) and nolYZ
(Dockendorff et al., 1994). In NGR234, although fourteen genes are specifically required
for Nod factor synthesis (Freiberg et al., 1997) they are distributed in five operons with
each controlled by a NB (Kobayashi et al., 2004). The other fourteen NBs are located in
promoter regions of genes/operons unconnected to Nod factor synthesis, such as a type
19
III protein secretion system (T3SS), modification of extracellular polysaccharides and
synthesis of indole acetic acid (IAA) (Kobayashi et al., 2004).
NodD proteins control Nod-factor synthesis via NB
As described earlier, Nod-factors are the first rhizobial signal molecule produced
and essential for nodule formation (Downie, 1998; Lerouge et al., 1990; Smit et al., 2005).
Nod factors consist of a β-1,4-linked N-acetyl-d-glucosamine backbone of three to five
residues of which the non-reducing terminal residue is substituted at the C2 position with
an acyl chain. The structure of acyl chain can vary depending on the rhizobial species.
The structural variation of a given rhizobial Nod factor determines its host specificity.
Nod factors are synthesized and exported from the bacteria by the products of nod genes.
The common nodulation genes nodABC are found in all bacteria that form nitrogen-fixing
nodule (Moulin et al., 2001), and they are required for basic Nod factor synthesis. The
only known exception was recently reported in two group II photosynthetic
Bradyrhizobium strains, BTAi1 and ORS278, which lacked any nod gene homologues
(Giraud et al., 2007). These enzymes are encoded by the nodABC genes link the
individual N-acetylglucosamine together, and attach an acyl group to them (Atkinson et
al., 1994; Geremia et al., 1994; John et al., 1993; Kafetzopoulos et al., 1993; Rohrig et al.,
1994; Spaink et al., 1994). In addition, a given rhizobial species will possess species-
specific nod genes, which modify the basic Nod factor. These host-specific modifications
include the addition of sulphuryl, methyl, carbamoyl, acetyl, fucosyl, arabinosyl and
other groups to different positions on the backbone, as well as modifications to the
structure of the acyl chain. As an example, the nodSU genes control the ability of
NGR234 to nodulate Leucaena leucocephala through N-methylation and 6-O-
carbamoylation of the non-reducing terminus of its Nod factors (Jabbouri et al., 1995).
NodD proteins initiate a signalling cascade
NBs are also found upstream of genes encoding other transcriptional regulators.
Some rhizobial strains possess one or two copies of another LysR-type regulator syrM
(for symbiotic regulator) (Fellay et al., 1998; Hanin et al., 1998; Michiels et al., 1993;
20
Mulligan and Long, 1989; Swanson et al., 1993). SyrM proteins are NodD homologues
and can also act as activators of nod and nif genes. SyrM from S. meliloti which is
regulated by a NB, binds to the promoter regions of nodD3 and syrA (encoding another
regulatory protein) to activate their transcription (Barnett et al., 1996; Maillet et al., 1990).
Interestingly, NodD3 can then activate transcription of syrM forming a self-amplifying
loop that does not require flavonoids (Swanson et al., 1993). In NGR234, there are two
copies of syrM, syrM1 and syrM2, found on pNGR234a (Freiberg et al., 1997). SyrM1 is
involved in activation of a number of genes and controls the level of sulphated Nod
factors (Hanin et al., 1998). Transcription of syrM2 (unlike syrM1) is under the control of
a NB and is necessary for the expression of nodD2 (Kobayashi et al., 2004). In S. meliloti
SyrM proteins are thought to activate genes by binding to another cis-element, the SyrM-
motif (syr-box or SB), found upstream of nodD3 and syrA (Barnett et al., 1996; Barnett et
al., 1998; Perret et al., 1999; Xiao et al., 1998). A putative syr-box was found in the
promoter region of nodD2 (and another hypothetical gene, y4xD) of pNGR234a
suggesting a similar regulatory mechanism may exist (Kobayashi et al., 2004).
Certain rhizobia possess another, NB controlled transcriptional activator, ttsI. TtsI
has homology to the regulator proteins of the two-component sensor-regulator family
(Krause et al., 2002; Marie et al., 2004; Marie et al., 2003; Viprey et al., 1998). TtsI
activates genes by binding to conserved cis-elements, termed tts-boxes (TB) (Krause et
al., 2002; Marie et al., 2004; Wassem et al., 2008). TtsI controls a number of host specific
symbiotic signals thought to be required for nodule formation later than Nod factors, in
NGR234 examples include the T3SS and modifications to lipopolysaccharide structure
(see below).
Undoubtedly the flavonoid-induced and NodD-dependent regulation of symbiotic
signal synthesis has to be carefully controlled. In NGR234 NodD1 heads a signalling
pathway composed of several regulators to ensure a temporal gradation in symbiotic
signal production and also its own down regulation (Figure 5). In this way the expression
of a symbiotic gene can be coincided with the requirement of its product at a particular
stage of root infection or nodule development (Kobayashi et al., 2004).
21
NodD1
SyrM2
NodD2
TtsI
NB8
NB6
NB18NB19
NB3
Nod-factors
Type III secretion
Rhamnose-rich LPS
Flavonoids
Tim
e
TB8
TB2SB2
Figure 5. Proposed model for the flavonoid- and NodD1-dependent regulatory cascade in NGR234, modified from Kobayashi and associates (Kobayashi et al., 2004). In this model, flavonoids interact with NodD1 and trigger the regulatory cascade. Activation is shown with solid black arrows, whereas repression by NodD2 of NodD1-expression is marked with a dashed line. Following flavonoid induction, NodD1 rapidly activates the transcription of operons responsible for the synthesis of Nod-factors. NodD1 also activates synthesis of TtsI and SyrM2 via NB18 and NB19 respectively. This triggers additional functions that are probably required when more intimate contact between the bacteria and their hosts has occurred. In turn, SyrM2 activates transcription of nodD2. At this third regulatory level, NodD2 triggers late flavonoid-inducible loci such as fixF (controlled by NB6), which is involved in the synthesis of a rhamnose-rich LPS. TtsI also activates the synthesis of rhamnose-rich LPS as well as T3SS via TB. Concomitantly, NodD2 also represses the expression of nodD1.
TtsI and tts-boxes
Although TtsI has homology to transcriptional activators of the two component
sensor-regulator family, such regulatory systems usually consist of a sensor histidine
protein kinase and a response regulator protein (TtsI). The sensor kinase auto-
phosphorylates at a histidine residue upon detection of an external stimuli and
subsequently the phosphate group is transferred to an aspartate residue in the response
regulator leading to its activation (Stock et al., 2000). No partner sensor has been found
for TtsI, however, which poses the question as to how TtsI is activated. Notably, all he
TtsI homologues so far identified contain a glutamate residue instead of the conserved
aspartate residue (Marie et al., 2004). In other bacteria such an exchange from aspartate
to glutamate leads to the constitutive activation in the response regulator (Klose et al.,
22
1993; Lan and Igo, 1998), thus TtsI may not require phosphorylation step and thus a
sensor kinase partner to be functional. Instead only the expression of TtsI is required,
which is known to be dependent on flavonoids and NodD (Kobayashi et al., 2004; Marie
et al., 2004).
TtsI homologues have been found in several bacteria, such as USDA110 (Göttfert
et al., 2001; Krause et al., 2002), M. loti MAFF303099 (Hubber et al., 2004; Kaneko et
al., 2000a), S. fredii USDA257 (Krishnan et al., 2003) and NGR234 (Freiberg et al.,
1997; Viprey et al., 1998) which also all possess a T3SS. The rhizobial T3SS machine is
composed of the Rhc proteins, secretes a number of proteins called Nops (nodulation
outer proteins) and is an important host range determinant (see below). The promoter
regions of the nop and rhc genes, all contain the specific cis-element, the tts-box or TB.
Bioinformatic searches have revealed that numerous TB are present in T3SS-possessing
rhizobial genomes, for example in USDA110, up to 30 TB were found, suggesting the
TtsI-regulon encompasses more than just activation of the T3SS (Suss et al., 2006).
USDA110 is also noteworthy as ttsI is under the control of the NodV & NodW regulatory
proteins, as well as NodD1 (see chapter 2).
In NGR234, sequence analysis revealed the presence of 11 TB elements on
pNGR234a (Marie et al., 2004). The majority of the TBs were found upstream of genes
encoding the T3SS machine or possible secreted proteins (Figure 6). Two TBs were
located in a cluster of genes involved in rhamnose synthesis, one of which, TB2 activates
genes essential for the production of a rhamnose-rich lipopolysaccharide (LPS) known to
be important for successful nodulation (Broughton et al., 2006; Marie et al., 2004; Reuhs
et al., 2005). Thus, TtsI regulates not only T3SS but also other symbiosis factors.
Recently, transcriptional assays have shown that the expression of 10 of the 11 TBs was
flavonoid- and TtsI-dependent and that TtsI can bind to TB-containing promoters in vitro
(Wassem et al., 2008).
23
no
pT
nopM
nopJ
wbgATB1
TB4 TB5
TB6
TB2 TB3
TB8TB7 TB9 TB10
TB11
rmlB
rmlD
rmlA
gJ
mE
mF
fl5
xK xM xN xO xP yA yB yJ yQ ySnopL
nopX
nopP
nopB
nopC
nopA
rhcC
2tt
sI
rhcC
1
rhcJ
nolU
rhcN
rhcQ
rhcR
rhcS
rhcT
nolV
rhcU
rhcV
2 kb
Figure 6. Genetic organization of loci controlled by tts-boxes in pNGR234a, adapted and modified from Marie and associates (Marie et al., 2004). Genes and gene-fragments are represented by arrows showing the direction of transcription. The position of ttsI (preceded by a NB) is shown in red. Eleven TBs were identified in the promoter regions of genes encoding proteins with the following functions: green, the type III secretion machine (rhc); yellow, nop genes; blue, synthesis of rhamnose-rich LPS; and open other or unknown function. The positions and orientations of the TBs (labelled TB1 to TB11) are marked with black arrows.
b) The roles of rhizobial surface polysaccharides in symbiosis
Surface polysaccharides or SPS which include extracellular polysaccharides
(EPS), lipopolysaccharides (LPS), capsular polysaccharides (K-antigens and KPS) and
cyclic glucans are important bacterial extracellular components usually produced to
protect the cells from environmental stress. Studies with rhizobial SPS mutants have
shown they can be very important for a successful symbiosis (Fraysse et al., 2003). SPS
contribute to various stages of symbiotic development such as root colonization, host
recognition, infection thread formation, nodule invasion and host specificity although
they are not normally under the control of NodD proteins as for other symbiotic
signalling molecules (Becker et al., 2005; Spaink, 2000).
EPS has a role for the early stage of symbiosis, in establishing and extending the
infection thread. The major symbiotically active form of EPS in S. meliloti is
24
succinoglycan, mutations in genes required for its synthesis cannot fully invade the root
to establish infection threads, and lead to the formation of empty nodules (Finan et al.,
1985; Leigh et al., 1985). Succinoglycan is produced in two major forms reflecting
different degrees of subunit polymerization: the HMW (High Molecular Weight)
succinoglycan (consisting of hundreds to thousands of repeating units) which is
representative of typical bacterial EPS and also a symbiotically active form of LMW
(Low Molecular Weight) succinoglycan of monomers, dimers and trimers produced by
digestion of the HMW form by extracellular glycanases (Gonzalez et al., 1996; Wang et
al., 1999). NGR234 synthesises a HMW form of EPS similar in structure to that of S.
meliloti and is a known host range determinant. An EPS mutant cannot induce the
nitrogen-fixing nodules on Leucaena leucocephala. A number of genes involved in
synthesis of EPS have been identified in an exo cluster on the pNGR234b megaplasmid
(Streit et al., 2004). Although it was clearly shown that it was the (HMW EPS derived)
LMW EPS produced after glycanase action that were the actual critical factors (Staehelin
et al., 2006).
KPS are tightly associated with the rhizobial outer membrane, and often play a
role in the early stage of symbiosis. Rhizobial KPSs are strain-specific antigens, with
structures analogous to the group II K-antigens found in Escherichia coli. S. meliloti
Rm41 produces form of K antigen that is symbiotically active but only when EPS is
absent (Reuhs et al., 1993). In NGR234, by identifying and deleting the genes responsible
for the synthesis of KPS, the resulting mutant had a reduced ability to initiate symbiotic
infection (Le Quéré et al., 2006). However, the precise role of KPS in symbiotic infection
and the regulation of KPS expression remain unclear.
LPS are major components of the outer membrane of Gram negative bacteria and
are generally thought of as protective molecules. Rhizobial LPS can also play various
roles at different stages of the symbiosis such as in the initial recognition, infection thread
development, root tissue invasion, bacterial release into plant cells and even formation of
symbiosomes. LPS molecules consist of a lipid A anchor which maintains the molecule
in the hydrophobic outer membrane. Lipid A is associated with a core polysaccharide,
which can be substituted by an O-antigen domain. LPS are attached to the membrane by
25
the lipidic part being inserted into the bacterial phospholipid monolayer and thus the
saccharidic part is oriented to the exterior of the cell (Carlson et al., 1999; Noel and
Duelli, 2000; Price, 1999). Two forms of LPS are often synthesized, rough LPS (R-LPS)
and smooth LPS (S-LPS). The low molecular weight form of LPS (R-LPS) contains only
the lipid A and core oligosaccharide, whereas high molecular weight form of LPS (S-
LPS) includes an additional O antigen (Reuhs et al., 1998). LPS core oligosaccharides
were isolated and partially or fully characterized in R. leguminosarum bv. phaseoli (Bhat
et al., 1994; Bhat et al., 1991; Carlson et al., 1989), R. trifolii ANU843 (Carlson et al.,
1988), R. etli (Forsberg and Carlson, 1998), S. fredii and NGR234 (Reuhs et al., 1998).
Additionally, several metabolic steps in the biosynthesis of these molecules have been
elucidated, although mutant analysis can be complicated by either pleiotropic or lethal
phenotypes. In NGR234 a symbiotic form of S-LPS is produced in presence of flavonoids,
and its absence adversely affected nodulation of several host legume species (Marie et al.,
2004). This S-LPS molecule is noteworthy as it is predominantly composed of rhamnose
residues, and the biosynthetic enzymes required are under the control of TtsI (Broughton
et al., 2006).
c) T3SS and its secretion protein
T3SS are highly conserved multi-protein complexes, and important virulence
factors in pathogen-eukaryote interactions. T3SS were found in many Gram-negative
bacteria infecting humans, animals, and plants (Hueck, 1998). Thus T3SS had previously
been thought to be unique to pathogenic bacteria, however, these systems have now been
identified in rhizobia (Marie et al., 2001) such as: NGR234 (Freiberg et al., 1997), M. loti
MAFF303099 (Kaneko et al., 2000b), B. japonicum USDA110 (Göttfert et al., 2001), S.
fredii USDA257 (Meinhardt et al., 1993), USDA191 (Bellato et al., 1997), and HH103
(Bellato et al., 1997; Marie et al., 2001). In contrast, S. meliloti 1021 (Galibert et al.,
2001) and M. loti R7A (Sullivan et al., 2002) do not contain T3SSs. In these strains, a
type IV secretion system may serve a similar function (Hubber et al., 2004). Thus, T3SS
are present in some but not in all rhizobia.
26
The T3SS injects a cocktail of proteins (called effectors) into eukaryotic cells, to
change normal functioning of eukaryotic cell (Galan and Collmer, 1999). Understanding
the specific functions of these effectors has become a top priority for the rhizobial-plant
interaction. Rhizobial T3SS secrete nodulation outer proteins (Nops), some of which may
be transported into host plant cells via a pili structure and thus be considered as effectors
(Marie et al., 2001).
NGR234 secretes at least nine Nops, which are classified into two groups,
translocatory proteins that are external components of the secretion machine and effector
proteins injected into host cytoplasm through the T3SS (Figure 6). For example, NopA,
NopB, NopC and NopX are required for the transit of proteins from bacteria to the plant
cell cytoplasm (Ausmees et al., 2004; Deakin et al., 2005; Marie et al., 2003; Saad et al.,
2005). In NGR234, NopL and NopP have been characterized as rhizobial-specific
effector proteins which can be phosphorylated by plant kinases (Ausmees et al., 2004;
Bartsev et al., 2003; Bartsev et al., 2004; Skorpil et al., 2005). A double mutant of
NGRΩnopL∆nopP was shown to have a more pronounced phenotype than either single
mutant, suggesting that the effector Nops may also function cooperatively (Skorpil et al.,
2005). Additional effector proteins on pNGR234a were identified from homology
searches (Freiberg et al., 1997; Marie et al., 2001) nopM, nopJ, and nopT (formerly y4fR,
y4lO, and y4zC, respectively) that also containing TBs in their promoter regions (see
chapter 3 for more detail) (Kambara et al., 2008).
27
NopJ
NopM NopP
NopTNopL
RhcQ RhcN
NopA
NopX
NopB
NopC
ATP ADP
Plant cell cytoplasm
Plant plasma membrane
Plant cell wall
Bacterial outer membrane
Bacterial cytoplasm
Bacterial inner membraneRhcT RhcVRhcR
RhcC2RhcC1
RhcU
RhcJ
RhcS
Figure 6. Proposed model for the type III secretion system of NGR234, adapted and modified from Viprey and associates (Viprey et al., 1998). The conserved components of the T3SS (Rhc proteins) form a channel through the bacterial inner and outer membranes. The translocatory proteins, NopA, NopB and NopC are components of pili and required for the transit of Nops from bacteria to plant cell cytoplasm. NopX forms a pore in the plant cell plasma membrane. The effector proteins, NopJ, NopL, NopM, NopP and NopT are injected into the plant cell cytoplasm, and are thought to interfere with host metabolism.
Mutations in the T3SS machinery that abolish Nop secretion cause symbiotic
phenotypes dependent on the host plant (Ausmees et al., 2004; Krause et al., 2002;
Krishnan et al., 2003; Lorio et al., 2004; Marie et al., 2003; Viprey et al., 1998). For
instance, in NGR234 a functional T3SS is required for efficient nodulation of some plant
species, such as Tephrosia vogelii, Flemingia congesta and Lablab purpureus, however
for Pachyrhizus tuberosus and Crotalaria juncea the T3SS appear to be extremely
deleterious (Ausmees et al., 2004; Marie et al., 2003). Mutations within genes that encode
for effector Nops cause different symbiotic phenotypes depending on the host plants, see
28
chapter 3 (Ausmees et al., 2004; Bartsev et al., 2003; Kambara et al., 2008; Skorpil et al.,
2005).
S. fredii strains USDA257 and HH103 possess very similar T3SS to NGR234,
which have been shown to secrete Nops. In USDA257, NopX, NopB, Nop38, and Nop7
were revealed as Nops, they associated with the pili (Krishnan, 2002; Krishnan et al.,
2003; Lorio et al., 2004). In HH103, NopA, NopC, NopL, NopP, and NopX were
confirmed to be T3SS secreted proteins (Rodrigues et al., 2007). Furthermore, NopM and
NopD were also identified as putative secreted effector proteins (Rodrigues et al., 2007),
these Nops are homologous to NopM of NGR234 and XopD of X. campestris pv.
vesicatoria, respectively (Hotson et al., 2003). XopD in X. campestris pv. vesicatoria
targets SUMO (small ubiquitin-like modifier) conjugated proteins in planta, suggesting
that the XopD protease mimics a host protease that removes SUMO modifications. This
proteolysis could alter host cell signalling events for the pathogen.
In B. japonicum USDA110, genes with homology to nopA, nopB, nopL and nopP
were found in the tts gene cluster (Krause et al., 2002). However, nopX is not present in
the genome. A conserved TB motif was found in the putative promoter region of six other
genes encoding possible secreted proteins (Suss et al., 2006). Using mass spectrometry
techniques, eight different genistein-inducible secreted protein spots were identified. One
of the proteins, Blr1752, has similarity to NopP from NGR234 (Suss et al., 2006).
Mutation of the S. fredii and B. japonicum T3SS also leads to host plant specific
phenotypes and a similar result was observed after mutation of the T3SS of M. loti
MAFF303099. Although protein secretion was not observed by the T3SS of
MAFF303099, its mutation enabled nodulation of Leucaena leucocephala (Hubber et al.,
2004). Fascinatingly mutation of the T4SS of M. loti R7A, the genes (virB1 to B11 and
virD4) had a similar phenotype. This T4SS is very similar to the Agrobacterium
tumefaciens vir T4SS that transfers T-DNA and several proteins to plants (Christie and
Cascales, 2005; Sullivan et al., 2002). The expression of the M. loti T4SS depends on
flavonoids, which activate NodD1 and subsequently activate the VirA/VirG two-
component regulatory system (Leroux et al., 1987; Winans et al., 1986). A putative NB
29
was found 851 bp upstream of virA (Hubber et al., 2004; Sullivan et al., 2002),
suggesting that the vir genes are under the control of NodD (Hubber et al., 2007).
Previously, it was reported the presence of two vir-boxes consensus nucleotide repeats in
the M. loti R7A symbiosis island, one in the promoter region of the msi061 gene which
encodes effector proteins and the other in the intergenic region between the divergently
transcribed virB1 and virG genes (Hubber et al., 2004). Most probably, VirG binds at vir
boxes to induce their transcription (Gao et al., 2006; Jin et al., 1990; Pazour and Das,
1990; Powell et al., 1989). Mutations of the M. loti vir genes have host-dependent
phenotype (Hubber et al., 2004). It was suggested that the host-dependent symbiotic
phenotypes are due to the same effector proteins, after secretion by either a T3SS or a
T4SS.
Summary of NGR234 symbiotic signals
As described above, in response to the presence of flavonoids released by
potential host-plants, rhizobia have evolved a complex regulatory network for successful
symbiosis. Recent studies have focused not only on the effects of Nod factors but also on
the numerous other (secondary) symbiotic signals, such as surface polysaccharides or
secreted proteins. In the case of NGR234 there appear to be numerous secondary
symbiotic signalling systems (Figure 7), the regulation and function of which will be
investigated in chapters 2-4.
30
Flavonoids
Nops
TtsI
nodA nodB nodC
ttsI
NodCNodA
NodB
nop
NB8
NB18 TB8
TtsI
RhcQ RhcN
NopA
NopX
NopBNopC
ATP ADP
NopJ
NopMNopP
NopTNopL
NopJ
NopP
NopL
Rhizobium sp. NGR234
Determination of symbiotic compatibility
HMW-EPS
KPS LPS
TB2
TtsI
TtsI
Nod-factors
Induction of nodulemorphogenesis
LMW-EPS
Rhamnose rich LPS
rmlB rmlD rmlA wbgA
NodD1
NodD1
NodD1
Figure 7. Summary of the symbiotic signal molecules produced by NGR234. Flavonoid compounds from legume roots trigger gene expression and synthesis of signals by NodD1 binding to NBs. The primary symbiotic signals, the Nod factors are secreted and allow bacterial entry into root hairs and initiate plant programs for rhizobial infection and root nodule development. NodD1 consequently activates TtsI which activates T3SS and synthesis of rhamnose rich LPS by binding to TBs. LMW EPS, KPS, rhamnose-rich LPS and Nops can all be considered as secondary symbiotic signals, although not essential, they can be extremely important for the nodulation of certain legumes.
31
Chapter 2: Do NodV & NodW regulate symbiotic signal production in NGR234?
Introduction
NodD proteins are undoubtedly the main transcriptional regulators of symbiotic
signals in rhizobia (Göttfert et al., 1992; Schlaman et al., 1992). In Bradyrhizobium
japonicum, however, other regulators (NodV&W and NolA) also have critical roles in
modulating expression of nodulation genes. NodV and NodW belong to the two-
component regulatory family and activate expression of the nodulation genes by
isoflavonoids via a series of phosphorylation steps (Göttfert et al., 1990; Loh et al., 1997;
Sanjuan et al., 1992). As described earlier, members of this family can be grouped into
two subclasses, the sensor class and the regulator class. As result of conserved domain
searches, NodV was shown to be the sensor and to have a histidine kinase-like ATPases
domain auto-phosphorylation so that could occur. NodW is the regulator, activated by
phosphorylation from the NodV sensor partner, it possesses a helix-turn-helix domain to
bind to DNA and initiate transcription. Phosphorylation of NodW is known to be required
for efficient nod gene expression (Sanjuan et al., 1994) and a nodW mutant showed
reduced levels of nod gene expression (Loh et al., 1997). NodVW, however, are required
for nodulation of certain host plants of B. japonicum, i.e. for cowpea (Vigna unguiculata),
mung bean (Vigna radiata), and siratro (Macroptilium atropurpureum), but not for
soybean (Glycine max) (Göttfert et al., 1990). Instead NodD1 is absolutely required for B.
japonicum nodulation of soybean. The host-specific requirement of NodVW suggests that
soybean plants produce a cocktail of isoflavones that interact with NodD1 but are not
sensed by NodVW. In contrust cowpea, siratro and mung bean plants produce inducers
which interact specifically with NodVW and not NodD1. The NodVW flavonoid sensing
system has also been shown in previous studies to be required for expression of ttsI and
thus regulates the T3SS of USDA110 (Figure 1) (Krause et al., 2002).
32
Figure 1. Model of the regulatory cascade controlling expression of the T3SS gene cluster, adapted from Krause and associates (Krause et al., 2002). Open reading frames (ORFs) unique to Bradyrhizobium japonicum are in black, and nod genes are shown in white. ORFs with homologues in T3SS gene clusters of other rhizobia are gray. The gray arrowhead indicates the position of the nod box. Positions of tts boxes are marked by black arrowheads.
In NGR234, two ORFs (ngr159 and ngr160) encoding homologues of NodV &
NodW were found on the megaplasmid (Streit et al., 2004). Downstream of nodVW and
possibly co-transcribed are two further ORFs (ngr158 and ngr157) with homology to
nodW (Table 1) (Figure 2).
Table 1. Characteristics of the NGR234 NodV and NodW homologues. Homology (similarity and identity) was identified by BLAST-P search. The number of amino acids in a parenthesis indicates identity and similarity over what number of amino acids to NGR234.
Amino acid Size Similarity to
NGR234 Identity to NGR234
NodV Rhizobium sp. NGR234 1333 aa 148.8 kDa - -
NodV Bradyrhizobium japonicum 889 aa 99 kDa 44 % (760 aa) 27 %
NodW Rhizobium sp. NGR234 216 aa 23.6 kDa - -
ngr158 Rhizobium sp. NGR234 120 aa 12.9 kDa 55 % (114 aa) 37 %
ngr157 Rhizobium sp. NGR234 217 aa 23.5 kDa 53 % (198 aa) 67 %
NodW Bradyrhizobium japonicum 227 aa 25.2 kDa 72 % (208 aa) 49 %
NwsB Bradyrhizobium japonicum 221 aa 23.9 kDa 71 % (203aa) 53 %
33
Figure 2. The nodVW region of pNGR234b, adapted from Streit and associates (Streit et al., 2004). ORFs were named genes when BLAST-P searches of the National Center for Biotechnology Information database indicated an identity of <E−80.
The potential presence of multiple forms of NodW in NGR234 is interesting as
B. japonicum in addition to NodW, possesses a second response regulator NwsB, which
shares 65 % amino acid with NodW. Although NwsB was shown to control expression of
nodulation genes, an nwsB mutant could still nodulate cowpea, siratro, and mungbean
(Grob et al., 1993). A more detailed analysis of NGR157 and NGR158 (Figure 3) showed
that NGR157 has homology over its entire length to NodW, possessing both the signal
receiver domain where phosphorylation occurs and also the DNA binding helix-turn-
helix domain. NGR158 however lacked the DNA binding domain (Figure 3). The
observation that NodW of NGR234 contains the conserved aspartate residue, suggests
that phosphorylation is necessary for functional NodW. Unlike TtsI of NGR234 (which is
also homologous to response regulator proteins) but contains a glutamate residue instead
of the conserved aspartate residue possibly rendering TtsI constitutively active (as
discussed earlier).
....|....| ....|....| ....|....| ....| ....| ....|....| ....|....| ....|....| ....|....| 10 20 30 40 50 60 70 80
MT------SD DHVVFIVDDD ERIREALSDL LDSHGIRAIA FGSA GEYVSA DKPDVPACLI LDVELPDING LDLQRQIADV MSPQLGSEED EPLVIIVDDD ASVRAALSEL ILSAGFRPVS FAST RELLDA DTLDAPGCLI LDVRMPGESG LHLQRHLADN MN------KT RHVVAIVDDD ARLLESVSDL LESAGYVARS FPSA GSLLAS G-LSDLDVLI TDIGMPGMDG LELRDRVKKS
....|....| ....|....| ....|....| ....| ....| ....|....| ....|....| ....|....| ....|....| 90 100 110 120 130 140 150 160
DHP-PIVFIT GHGDIPSSVR AIKHGAVDFL TKPFSDADLM AAIG AAIAED RVKRAARAEL SMLGQRYREL TPREREVLPL GNPKPIIFLT GHGDIPMTVE AMKAGAVDFL TKPVRDQTLL DAVTAGIAMD AERRAEAAIS RLNIERLETL TQREREVLYE RPELPVFLIT GRHEIADQGR AQ--GNSGFF RKPFDAQALL AAIA NALDK- ---------- ---------- ----------
....|....| ....|....| ....|....| ....| ....| ....|....| ....|....| ... 170 180 190 200 210 220
VVSGLLNKQA AAELGISEVT LQIHRRNVMH KMAADSLADL VRIAERLEIP ITHSRRVGGN DHE VARGRLNKQI AFDLGISEVT VKAHRSSVMH KMGAASVGEL IRAFETLP-- -AQMRQAGAR --- ---------- ---------- ---------- ---------- ---- ------ ---------- —
NodW ngr157 ngr158
NodW ngr157 ngr158
NodW ngr157 ngr158
: signal receiver domain
: helix-turn-helix
: conserved Asp residuce
Figure 3. Amino acid alignment of NodW and the two proteins encoded by downstream ORFs in the nodVW cluster. The predicted amino acid sequences were shown to have conserved domains by CD-BLAST searches and then aligned. Pink and blue highlighting indicates the signal receiver domain and helix-turn-helix DNA binding domain, respectively. The green highlight indicates the conserved aspartate residue phosphorylated by the sensor histidine protein kinase.
34
In NGR234, it is known that NodD1 is the main activator of loci whose
expression is flavonoid-dependent (Relić et al., 1993), and a nodD1 mutant is unable to
nodulate any host plant. Despite this genes on the symbiotic plasmid were shown to be
induced in a nodD1 mutant after flavonoid treatment (Fellay et al., 1995). This
observation suggests the presence of other flavonoid-sensing regulators, and NodVW are
possible candidates. Furthermore the role of NodVW in the regulation of the USDA110
T3SS prompted the question of whether a similar regulation might occur in NGR234. If
NodVW did control other flavonoid-inducible genes in NGR234 would this influence
nodulation of certain host plants as seen in B. japonicum? Thus initially as a model to test
we applied the known role of NodVW in B. japonicum in the induction of its T3SS, to the
regulatory cascade of NGR234 (Figure 4).
TtsI Type III secretion
Rhamnose-rich LPS
Flavonoids
Tim
e
NodV
NodW
TB8
TB2
NB18
Figure 4. Model of the regulatory cascade of NGR234, adapted from Kobayashi and associates (Kobayashi et al., 2004). Based upon NodVW function in B. japonicum, a potential role for NodVW from NGR234 was added to this model. Red arrows indicate the hypothetical target of NodVW.
35
Materials and methods
Microbiological techniques
Escherichia coli strains were grown in Luria-Bertani (LB) media at 37 °C
(Sambrook et al., 1989). Rhizobium strains were grown at 27 °C in either complete (TY)
(Beringer, 1974) media or minimal media containing succinate as the carbon source
(RMS) (Broughton et al., 1986). Antibiotics were added to the media at the following
final concentrations; ampicillin (Ap), 50 µg ml-1; gentamycin (Gm), 10 µg ml-1 (for E.
coli), 20 µg ml-1 (for Rhizobium); kanamycin (Kn), 50 µg ml-1; rifampicin (Rif), 50 µg
ml-1; spectinomycin (Sp), 50 µg ml-1; tetracycline (Tet), 15 µg ml-1; and chloramphenicol
(Cm), 15 µg ml-1. Flavonoids were added to the media at 2 × 10-7 M final concentrations.
Mutagenesis of nodV
To obtain NGRΩnodVW, nodV was amplified by PCR from genomic DNA of
NGR234 using the following primer pairs: A (5’-AGCGGCCGGTTTACGAAGTG-3’)
and B (5’-CCATGTCGACGAGTTGCGAG-3’). The 1.7 kb fragment containing nodV
was first cloned into the EcoRV site of pBluescript KS+ and fidelity of the PCR verified
by sequencing. An omega interposon conferring resistance to spectinomycin (Fellay et al.,
1987) was inserted into an internal EcoRV site located 1520 bp from the ATG of nodV.
ApaI and SacI were used to excise a 3690 bp fragment of this mutated nodV which was
then subcloned into the suicide vector pJQ200SK (Quandt and Hynes, 1993). Triparental
matings were used to transfer the resulting plasmid into NGR234. Double recombination
was selected by plating bacteria onto TY plates containing 5 % sucrose and appropriate
antibiotics. Putative mutants were confirmed by PCR and Southern blots of restricted
genomic DNA using standard procedures (Chen and Kuo, 1993; Sambrook et al., 1989).
The double mutant NGRΩnodD1ΩnodVW and NGRΩnodD2ΩnodVW were generated
using a similar approach, but an omega interposon conferring resistance to Kanamycin
(Fellay et al., 1987) was substituted for spectinomycin resistance. Triparental matings
were used to transfer the resulting plasmid into NGRΩnodD1 (Relić et al., 1993). To
36
create NGRΩnodD2ΩnodVW, pJQΩnodVW with resistance to spectinomycin was
transferred into NGRΩnodD2 (Fellay et al., 1995).
Analysis of secreted proteins and polysaccharides
Secreted proteins were purified and analyzed as described in (Marie et al., 2003).
Rhizobium strains were grown in 100 ml of RMS for 40 h in the presence of daidzein or
genistein. Secreted proteins present in the supernatants of cultures were precipitated using
ammonium sulphate (60 %, wt/vol) and subsequently desalted using Sephadex G25-
containing columns (Amersham Biosciences, Uppsala, Sweden). Then proteins were
separated by 15 % SDS-polyacrylamide gel electrophoresis, followed by silver nitrate
staining or transfer to PVDF membranes for immunoblotting.
To extract polysaccharides, rhizobial cells obtained by centrifuging 1.5 ml liquid
cultures of RMS were lysed using 100 µl of lysis buffer as described previously
(Hitchcock and Brown, 1983). Two volumes of sample buffer (120 mM Tris, pH 6.8, 3 %
(w/v) SDS, 9 % (v/v) β-mercaptoethanol, 30 % (v/v) glycerol, 0.03 % (w/v) bromphenol
blue) were then added. The final mixtures were separated by DOC (deoxycholic acid
sodium salt) - PAGE (18 % acrylamide) using 0.375 M Tris (pH 8.8) and 0.5 % DOC. As
the anode buffer comprised 0.1 M Tris, 0.1 M gricine, and 0.25 % (w/v) DOC, at 20 mA.
Gels were stained specifically for LPS using periodate oxidation-silver (Tsai and Frasch,
1982), and KPS were visualized by sequential staining with alcian blue-silver (Corzo et
al., 1991; Reuhs et al., 1998), with omission of the periodate treatment so that LPS was
not detected. These procedures readily distinguish the KPS from LPS; the alcian blue
pretreatment is required for KPS visualization, and periodate oxidation is required for
LPS staining.
β-Galactosidase assay
Flavonoid induction and assays for β-Galactosidase activity were performed as
described in Kobayashi and associates (Kobayashi et al., 2004). Rhizobial cultures grown
to a density of 1cmOD600 of 0.5-0.6 were diluted to 1cmOD600 of 0.1 in RMS medium and
induced with daidzein and genistein. β-Galactosidase activity was assayed according to
37
Miller (Miller, 1972). The results reported represent the means of at least three
independent experiments.
Promoter activity assay with GFP
Promoter region of nopB, nopJ, fixF, rkpL, rkpY and exoK were cloned into pGT-
GFP (Le Quéré et al., 2008). Triparental matings were used to transfer the resulting
plasmids into NGR234 and NGRΩnodVW. Rhizobial cultures were inoculated to RMS
liquid media from RMS plates then induced with apigenin, daidzein, genistein,
kaempfenrol or naringenin. The GFP fluorescence was measured by Plate
CHAMELEON (HIDEX) every 24 h during up to 96 h after flavonoid induction. The
promoter activities were calculated as below: for each sample the GFP fluorescence level
and the density of OD600 were measured and corrected with the GFP fluorescence level
and density of OD600 of free media respectively. Then the corrected OD600 was
normalized by dividing with the average of each time point OD600. Final GFP
fluorescence levels were computed from the average of normalized GFP fluorescence at
least five independent experiments.
NodW overexpression
To obtain pETBlue-nodW, nodW was amplified by PCR from genomic DNA of
NGR234 using the following primer pairs: A (5’-CATGACGAGCGATGATCATG-3’)
and B (5’-TTCATGGTCATTCCCTCCCAC-3’). The 653 bp fragment containing full-
length of nodW was cloned into the EcoRV and PvuII site of pETBlue-2 (Novagen) and
sequenced. To overexpress nodW in E. coli Tuner (DE3) pLacI (Novagen) derivative
strain was used as a host. Cells contain the in-frame six-histidine tag fusion at amino-
terminal of nodW, pETBlue-nodW were grown in LB containing Ap and Cm. Protein
expression was induced at 1cmOD600 of 0.5 by adding 100 µM isopropyl-β-D-
thiogalactopyranoside (IPTG), and incubation was continued for an additional 6 h at
37 °C. Cells were harvested and resuspended in buffer A (50 mM NaPO4 pH 7.7, 10 %
glycerol, 0.5 M NaCl, 0.1 % Triton). The cell lysate was sonicated for 40 min on ice and
then centrifuged at 10,000 x g for 30 min at 4 °C to pellet the cellular debris. On 12 %
38
SDS-PAGE, the supernatant contained a major polypeptide of approximately 27 kDa that
was not present in the un-induced sample.
NodW purification
Immobilized metal affinity chromatography (IMAC) columns were used for
purification of His-tagged NodW. To remove non-specific binding peptides, the column
was washed with 0.1 M EDTA. Excess EDTA was removed by rinsing with water. The
column was then activated with ammonium acetate pH 4.0. His-tagged NodW
supernatant was loaded onto the IMAC column at a rate of 1 ml/min. Then, buffer A (50
mM NaPO4 pH 7.4, 500 mM NaCl, 0.5 % Triton and 10 % glycerol) which was mixed
with different concentration of imidazole (20 to 500 mM) were added to the IMAC
column continually. Eluted samples were collected and separated by 15 % SDS-PAGE
gel and stained with coomassie blue. Imidazole was removed by dialysis in 50 mM Tris
(pH 8.0), 150 mM NaCl, 0.1 mM EDTA, 0.1 mM DTT, 50 % glycerol for 15 to 20 h at
4 °C. To obtain pure NodW protein, the sample were washed and eluted with a Heparin
column with different concentrations of NaCl (0.1 mM to 1.2 mM) in the heparin buffer
(10 mM Tris-Cl pH 8.0, 0.1 mM EDTA, 0.1 mM DTT, 10 mM MgCl2 and 5 % glycerol).
Total protein concentration of the purified NodW containing was determined to be 16
mM using a protein assay (BIO-RAD).
Electrophoresis mobility shift assay and DNase I footprinting
The DNA fragments (NB and TB) used for gel mobility shift assays were
amplified by PCR using the following primer pairs: NB3 (5’-ACAAAGCCTGTTCTTCA
GGA-3’ and 5’-GCCGTGAGTTTGCGTTCGGT-3’), NB6 (5’-GTTTGAACGGGTCTC
GGGA-3’ and 5’-TATGGATTATCCTGAGAGCGA-3’), NB8 (5’-ACCTTCCCGTATC
ACTCGCA-3’ and 5’-CCAACTTCCTTGTTTTCGAGAG-3’), NB18 (5’-TAACGGCA
AAGCAGTGTGCGA-3’ and 5’-CACCTGAGATTTCTCTGCGCA-3’), TB2 (5’-AAGC
ACCCCGAAAACTACCT-3’ and 5’-GCATTGCGAAATTTGGATGGA-3’), TB8 (5’-
CTCGTCTTGATAAACCAAATCTGAA-3’ and 5’-GGACTCGATTACTTAACTCTTT
GAC-3’). The DNA fragments were 32P-labelled at the 5′ end using T4 polynucleotide
39
kinase. Binding reaction mixtures contained the labelled DNA fragments, 5 µg/ml
competitor oligonucleotide, and different concentrations of NodW in Gel Shift Binding
Buffer (50 mM Tris-HCl [pH 7.6], 8 mM Mg acetate, 27 mM NH4 acetate, 100 mM K
acetate, 1 mM DTT). The reaction mixtures were incubated for 30 min at room
temperature and reaction were stopped by the addition of 1 µl of loading buffer (0.1 %
bromophenol, 0.5 mM DTT and 50 % glycerol). The samples were loaded on a 4 %
native Tris–glycine Gel and dried on a Gel Dryer (Miliam). The gels were scanned using
a CycloneTM phosphoimager (Packard), and the intensities of the bands were determined
using OptiQuant software.
DNase I footprinting reactions were also performed using NodW. NB18 PCR
product was 32P-labelled at the 5’ and 3’ends using T4 polynucleotide kinase. The
radiolabelled NB18 DNA fragment and difference concentrations of NodW were mixed
and incubated at room temperature for 30 min in a 20 µl volume, then 1 µl of DNase I
(0.1 units/µl; Invitrogen) was added to digest for 2 min. The reaction was terminated, and
then extracted with phenol–chloroform. The aqueous phase was precipitated with ethanol,
and the samples were analyzed on 6 % denaturing polyacrylamide gel. The gels were
dried on a Gel Dryer (Miliam) and scanned using a cycloneTM phosphoimager (Packard),
and the intensities of the bands were determined using OptiQuant software.
RNA extraction and Quantification RT-PCR
NGR234 and NGRΩnodVW strains were grown in RMS medium in the presence
of daidzein or genistein. The 5 x 1010 cells were collected at 1, 6 and 24 h after flavonoid
induction then frozen at -70 °C. RNA was extracted from the pellets via modified phenol-
chloroform extraction (SIGMA). Isolated total RNA were treated with DNase I
(QIAGENE) then used for templates for the synthesis of cDNA (iScript Select cDNA
Synthesis Kit; Bio-Rad). One microgram of total RNA were reverse transcribed to cDNA.
Quantification real-time RT-PCR was carried out as described by Pfaffl (Pfaffl,
2001). Oligonucleotide primers specific for nodV (5’-AATGGTACGCGGTTGCT
ATCGAA-3’ and 5-CCTACGTCCAGACCGAAGAA-3’), rpsL (5’-GCTTCGAAGTGA
40
TCGGCTAC-3’ and 5’-ACACCCTGCGTATCGAGAAC- 3’) and 16S (5’-AGCCACAT
TGGGACTGAGAC-3’ and 5’-ACCCTAGGGCCTTCATCACT-3’) were generated
(SIGMA-GENOSYS) and optimized to equal annealing temperatures of 60 °C. For RT-
PCR reaction a mastermix of the following reaction components was prepared to the
indicated end-concentration: 3 µl water, 1 µl forward primer (10 µM), 1 µl reverse primer
(10 µM) and 10 µl SYBR Green (iQ SYBR Green Supermix; Bio-Rad). Mastermix (15
µl) was filled in 96 wells plate and mixed with 5 µl cDNA (100 ng). The thermal cycler
program was as follows; denaturation program (95 °C for 3 min), amplification and
quantification program repeated 40 times (95 °C for 30 sec, 60 °C for 1 min), melting
curve program (60–95 °C with a heating rate of 0.1 °C per second and a continuous
fluorescence measurement) and finally a cooling step to 40 °C.
Plant material and nodulation assays
Seed source are listed in Pueppke and Broughton (Pueppke and Broughton, 1999).
Plant seeds were sterilized as described below; Vigna unguiculata and Vigna radiate:
concentrated sulphuric acid 10 minutes, 5 % (v/v) H2O2 5 minutes and 70 % (v/v) ethanol
5 minutes; Lenceana leucocephala: concentrated sulphuric acid 20 minutes and 70 %
(v/v) ethanol 5 minutes; Crotalaria juncea and Macroptilium atropurpureum:
concentrated sulphuric acid 10 minutes, 0.1 % (v/v) Tween 20 5 minuites and 5 % (v/v)
H2O2 5 minutes; Lablab purpureus and Tephrosia vogelii: concentrated sulphuric acid 10
minutes, 0.1 % (v/v) Tween 20 10 minuites and 5 % (v/v) H2O2 5 minutes; Pachyrhizus
tuberosus: concentrated sulphuric acid 25 minutes, 0.1 % (v/v) Tween 20 10 minuites and
5 % (v/v) H2O2 5 minutes. Nodulation tests were performed in Magenta jars as described
by Vipray and associates (Viprey et al., 1998). All plants were grown at a day
temperature of 28 °C, a night temperature of 18 °C, and a photoperiod of 16 h. Each plant
was inoculated with 107 bacteria and harvested five to seven weeks after inoculation.
41
Table 2. Strains and plasmids used in this study
Strain Relevant characteristics Reference
Escherichia coli DH5α supE44 ∆lacY169 ( 80lacZ∆M15) hsdR17 recA1 endA1 gyrA96 thi-1
relA1 BRL, Bethesdda, MD, U.S.A.
Tuner (DE3) pLacI F−ompT hsdSB (rB−mB
−) gal dcm lacY1 (DE3) Novagen
Rhizobium strains
NGR234 Broad host-range bacterium isolated from nodules of Lablab purpureus, Rifr
(Lewin et al., 1990)
NGRΩnodD1 NGR234 derivative containing an Ω insertion in the BamHI site of nodD1, Rifr Spr
(Relić et al., 1993)
NGRΩnodD2 NGR234 derivative containing an Ω insertion in the BamHI site of nodD2, Rifr Knr
(Fellay et al., 1995)
NGR∆ttsI NGR234 derivative with ttsI deleted, Rifr (Wassem et al., 2008)
NGR∆rmlB-wbgA NGR234 derivative in which 3.7 kb EcoRV fragment containing rmlB-wbgA was replaced by an Ω cassette, Rifr Knr
(Broughton et al., 2006)
NGRΩnodVW NGR234 derivative containing an Ω insertion in nodVW, Rifr Spr This work
NGRΩnodD1ΩnodVW NGRΩnodD1 derivative containing an Ω insertion in nodVW , Rifr Spr
Knr This work
NGRΩnodD2ΩnodVW NGRΩnodD2 derivative containing an Ω insertion in nodVW , Rifr Spr Knr
This work
Plasmids
pBluescript II KS+ High copy number ColE1-based phagemid, Apr Straragene, La Jolla,CA
pJQ200SK Suicide vector used for directed mutagenesis, Gmr (Quandt and Hynes, 1993)
pJQ-ΩnodVW pJQ200SK derivative construct in which 3.7 kb fragment containing an Ω insertion in nodVW was inserted into the ApaI and SacI site, Spr Gmr
This work
pJQ-ΩnodVW pJQ200SK derivative construct in which 3.7 kb fragment containing an Ω insertion in nodVW was inserted into the ApaI and SacI site, Knr Gmr
This work
pttsI pLAFR-6 derivative containing a 1.5 kb fragment with the ttsI gene under the control of nod-box 18
(Marie et al., 2004)
pRK2013 Tra+ helper plasmid (Figurski and Helinski, 1979)
pMP220 IncP expression vector containing a promoterless lacZ gene, Tetr (Spaink et al., 1987)
pMP-NB8 NB8 cloned as a 0.3 kb KpnI-XbaI fragment in pMP220. (Fellay et al., 1998)
pMP-NB18 NB18 cloned in pMP220 as a 0.7 kb SacI-XhoI fragment. (Kobayashi et al., 2004)
pMP-NB19 NB19 cloned in pMP220 as a 0.6 kb XbaI-PstI fragment. (Kobayashi et al., 2004)
pMP-TB2 pMP220 derivative containing the TB2 upstream of lacZ. (Marie et al., 2004)
pMP-TB8 pMP220 derivative containing the TB8 upstream of lacZ. (Marie et al., 2004)
pMP-nodD1p Promoter of nodD1 cloned in pMP220 as a 0.7 kb PstI fragment. (Kobayashi et al., 2004)
pRAF115 Promoter of nodD2 cloned in pMP220 as a 1.3 kb PstI-BamHI fragment. (Fellay et al., 1998)
pGT-GFP Vector containing a promoter-less GFP reporter gene. (Miller et al., 2000)
pGT-nopB nopB cloned into pGT-GFP. (Le Quéré et al., 2008)
pGT-nopJ nopJ cloned into pGT-GFP. (Le Quéré et al., 2008)
pGT-fixF fixF cloned into pGT-GFP. (Le Quéré et al., 2008)
pGT-rkpL rkpL cloned into pGT-GFP. (Le Quéré et al., 2008)
pGT-rkpY rkpY cloned into pGT-GFP. (Le Quéré et al., 2008)
pGT-exoK exoK cloned into pGT-GFP. (Le Quéré et al., 2008)
pETBlue-2 E. coli expression vector, Apr Novagen
pETBlue-nodW nodW cloned into pETBlue-2, Apr (Maniatis, 1982)
42
Results and Discussion
Mutation of nodVW
To assess the function of nodV and nodW, a polar mutant was generated. Omega
interposons conferring resistance to spectinomycin or kanamycin were inserted into an
internal EcoRV site, 1520 bp downstream of the nodV start codon (Figure 5). Mutation of
nodVW was also introduced into the nodD1 (Relić et al., 1993) and nodD2 (Fellay et al.,
1995) mutant backgrounds to elucidate any effects of NodVW in the absence of the main
regulator NodD proteins.
EcoRV
1 kbnodVnodWngr156 ngr157 158
nodVnodWngr156 ngr157 158 Ω (spec )r
nodVnodWngr156 ngr157 158 Ω (kan )rNGR 1Ω ΩnodD nodVW
NGRΩnodVW
NGR 2Ω ΩnodD nodVW
NGR234
Figure 5. Mutagenesis of nodV – suicide plasmids containing an omega interposon conferring resistance to spectinomycin or kanamycin inserted into an internal EcoRV site of nodV were created. Triparental matings were used to transfer the resulting plasmid into NGR234, NGRΩnodD1 and NGRΩnodD2.
In the analysis of these mutants, initially genistein and daidzein were used as
flavonoid inducers. These flavonoids are known to induce NGR234 genes (Kobayashi et
al., 2004) and genistein is known to be a strong inducer of nodVW in B. japonicum.
43
Effects the nodVW mutant on Nop secretion
To test the requirement of NodVW for Nop secretion, secreted proteins were
purified from wild type strain and various mutants after 40 hours induction. Western blots
were performed on intracellular and extracellular proteins and probed with antibodies to
specific Nops (Figure 6). T3SS-dependent protein secretion was not abolished in
NGRΩnodVW. Unsurprisingly as Nop secretion is regulated by NodD1 (Marie et al.,
2003), both NGRΩnodD1 and NGRΩnodD1ΩnodVW did not show any Nop secretion.
Nop secretion still occurs in a nodD2 mutant and no significant differences were
observed using NGRΩnodD2ΩnodVW. Thus unlike B. japonicum, where a nodW mutant
blocks expression of ttsI and thus presumably the T3SS (Krause et al., 2002), NGR234
nodVW mutants did not effect secretion of either the T3SS pili subunit NopA or the
effector proteins, NopM, NopL and NopT. Thus NodVW in NGR234 do not have same
effects as their B. japonicum homologues on T3SS function.
NG
R23
4
NG
RΩ
nodV
W
NG
R1
ΩΩ
nodD
nodV
W
NG
R1
Ωno
dD
NG
R2
Ωno
dD
NG
R2
ΩΩ
nodD
nodV
W
D G D G D G D G D G D G
Intracellularprotein
Extracellularprotein
Anti-NopL
Anti-NopM
Anti-NopL
Anti-NopA
Figure 6. Nop secretion by various strains. All strains were grown in the presence of daidzein (D) or genistein (G). Secreted proteins were separated on 15 % SDS-PAGE, transferred to polyvinylideve difluoride (PVDF) membranes, and immuno-blotted using Nop antibodies.
44
Do NodVW of NGR234 affect surface polysaccharides?
In non-inducing conditions NGR234 produces abundant rough-LPS (rLPS,
lacking the O-chain), with only trace amounts of smooth-LPS (sLPS, containing O-chain)
(Gudlavalleti and Forsberg, 2003; Reuhs et al., 1998). Addition of flavonoid to wild-type
NGR234 cultures, however, results in the production of an unique rhamnose-rich O-
antigen containing LPS (Fraysse et al., 2002; Reuhs et al., 2005). Thus NGRΩnodVW
was also tested for the production of rhamnose-rich LPS, as in NGR234 TtsI also controls
rhamnose synthesis (Marie et al., 2004). Figure 7A demonstrates the requirement of TtsI
for the production of rhamnose-rich LPS. NGR234 and derivatives were grown in the
presence of daidzein, polysaccharides were isolated and separated by DOC-PAGE before
staining for LPS. The ttsI mutant does not produce the smeary band indicative of
rhamnose-rich LPS. Complementation of NGR∆ttsI restored synthesis of the rhamnan-
LPS after flavonoid induction. As a further control, it was shown that deletion of rmlB -
wbgA operon, which is under the control of TtsI and encodes enzymes responsible for the
production of rhamnose, also abolished rhamnan synthesis (Broughton et al., 2006).
The nodVW mutants were next tested with strains grown in the presence of
daidzein or genistein. DOC-PAGE revealed that the extracted LPS of the nodVW mutant
has no discernable differences to the wild-type strain LPS (Figure 7B). As expected since
NGRΩnodD1 cannot produce this symbiotically active form of sLPS, neither could
NGRΩnodD1ΩnodVW. NGRΩnodD2 still produces low quantities of rhamnose-rich LPS
(Broughton et al., 2006) but the amount is dramatically reduced compare to the wild-type
strain. In this study, it was difficult to see if NGRΩnodD2 produced the rhamnose-rich
LPS probably due to the amount of sample which were loaded. Regardless of this, there
was no difference observed between NGRΩnodD2 and NGRΩnodD2ΩnodVW. Thus
NodVW do not obviously alter the production of rhamnose-rich LPS in NGR234.
45
NG
R23
4
NG
RΩ
nodV
W
NG
R1
ΩΩ
nodD
nodV
W
NG
R1
Ωno
dD
NG
R2
Ωno
dD
NG
R2
ΩΩ
nodD
nodV
W
D G D G D G D G D G D G
A BA B
NG
R23
4
NG
R∆ t
tsI
NG
R∆ t
tsI
ttsI
p
NG
R∆ r
mlB
-wbg
A
Figure 7. DOC-PAGE of polysaccharides. Polysaccharides synthesized by NGR234 and various mutants after growth in the presence of flavonoid were extracted then separated on DOC-PAGE gel. The gels were specifically stained for LPS. A: Daidzein was used as inducer. The synthesis of the rhamnan components (indicated with black vertical line) were blocked in the ttsI and rmlB-wbgA mutants. Complementation of NGR∆ttsI was obtained by the introduction of pttsI into NGR∆ttsI which restored rhamnan synthesis. B: For inducer, daidzein (D) and genistein (G) were used. NGRΩnodVW did not change the polysaccharides profile of the wild-type strain NGR234. Rhamnan component of lipopolysaccharides is also NodD1-dependent, nodD1 and nodVW double mutant did not show any effect of NodVW compare to NGRΩnodD1. NGRΩnodD2 and NGRΩnodD2ΩnodVW showed similar polysaccharides profile of the wild-type strain NGR234.
Symbiotic phenotype of NGRΩΩΩΩnodVW
In B. japonicum, it was shown that NodVW is required for nodulation of V.
unguiculata, V. radiata and M. atropurpureum, which are all hosts of NGR234 as well.
To evaluate the effect of NodVW from NGR234 on symbiosis, the nodulation abilities of
strains NGR234, NGRΩnodVW, NGRΩnodD2 and NGRΩnodD2ΩnodVW were
inoculated onto differences legume species (Table 3). Besides these three legume plants,
legumes that respond negatively/positively to the NGR234 T3SS were also used; Lablab
purpureus, Pachyrhizus tuberosus and Crotalaria juncea. Leucaena leucocephala was
also tested as a ttsI mutant has an improved symbiotic efficiency (Viprey et al., 1998) and
46
thus if NodVW affects ttsI there might be a phenotype. NGRΩnodD1 and
NGRΩnodD1ΩnodVW were not tested as NGRΩnodD1 is unable to nodulate any plant
(Relić et al., 1993).
On all the plants tested, nodulation by NGR234 and NGRΩnodVW was similar,
suggestive that NodVW in NGR234 does not affect symbiosis with these plants. As
expected, NGRΩnodD2 had dramatic effects on the nodulation of many of the tested
legumes - nodulation was completely abolished on M. atropurpureum and L. purpureus.
On L. leucocephala, V. unguiculata and V. radiata, nodule numbers were increased,
decreased or similar compare to NGR234 respectively. NGRΩnodD2ΩnodVW showed
very similar phenotypes to NGRΩnodD2, however, suggesting that the
NGRΩnodD2ΩnodVW phenotypes were due to the absence of NodD2 and not NodVW.
Table 3. Symbiotic phenotype of NodVW on various legume plants.
NGR234 NGRΩnodVW NGRΩnodD2 NGRΩnodD2ΩnodVW
V. unguiculata 60 (+12.7; 4) 58.2 (+11.1; 6) 23.8 (+4.7; 4) 17.8 (+4.6; 6)
V. radiata 33 (+3.8; 4) 38 (+8.3; 5) 43 (+12; 4) 37.4 (+6.4; 5)
M. atropurpureum 20.1 (+4.8; 4) 17.2 (+5.8; 5) 0 (+0; 4) 0 (+0; 5)
L. purpureus 9.4 (+2; 6) 9.4 (+1.7; 9) 0 (+0; 4) 0 (+0; 6)
L. leucocephala 16.8 (+2.7; 3) 22 (+1.8; 5) 29.1 (+7.3; 4) 30.6 (+6.7; 5)
P. tuberosus 0.5 (+0.7; 4) 0.25 (+0.35; 4) - -
C. juncea Fix- Fix- - -
The mean numbers of nitrogen-fixing nodules per plant are listed. For each test, the standard error of mean and the total number of plants are shown in brackets. As a control, sterile water was used as inoculum. Independent experiments were performed at least two times.
47
Electrophoretic Mobility Shift Assays and DNase I footprinting
NodW contains a characteristic DNA-binding domain, and although NodW of B.
japonicum has not been shown to bind to any promoters, it is required for efficient nod-
gene expression. I investigated whether NodW of NGR234 could bind to promoters
containing nod-boxes and tts-boxes. A hexa-histidine tagged NodW protein was
overexpressed and purified from E. coli, see materials and methods. After IMAC-based
purification NodW eluted as the major polypeptide of approximately 27 kDa, which not
present in the un-induced sample (Figure 8A lane 10 and 11) but there were also some
contaminating proteins. Taking use of its presumed DNA-binding ability a subsequent
purification step using a heparin column was performed. This resulted in homogeneous
NodW protein (Figure 8 B lane 4) at 16 mM which was used in all the DNA binding
assays.
1 14131211109765432 801 14131211109765432 80
A B
Figure 8. Overexpression and purification of NodW. Individual fractions at different stages of the overexpression and IMAC purification were eluted and collected, then separated by 15 % SDS-PAGE gel and stained with Coomassie blue. The red arrow indicates a 27 kDa band whichis the predicted size of NodW. A: Eluted sample with IMAC column. Lane 0 indicates Molecular marker. Lane 1 to 14 samples indicates as bellow: 1, non-induction; 2, crude extract; 3, supernatant; 4, pellet; 5, non-eluted induction; 6 to 14 contained different concentrations of imidazole (0.2 mM to 500mM) in elution buffer. B: Washed and eluted sample with Heparin column. Lane 0 indicates Molecular marker. Lane 1 to 14 samples indicates as bellow: 1, NodW from figure A lane 10 and 11; 2, crude extruct; 3 to 11 contained different concentrations of NaCl (0 mM to 1.2 mM) in heparin buffer.
48
The ability of the purified NodW protein to bind to NB3, NB6, NB8, NB18, TB2
and TB8 was tested in electrophoretic mobility shift assays (EMSA). These regulatory
elements act at key stages of the flavonoid dependent regulatory cascade (Freiberg et al.,
1997; Kobayashi et al., 2004; Marie et al., 2004; Perret et al., 1999). In B. japonicum, it
was shown that NodW phosphorylation is essential for nod gene expression (Loh et al.,
1997). By purifying NodW from E. coli, i.e. in the absence of the NodV sensor, NodW is
probably not phosphorylated when used in these EMSA experiments. Thus carbonyl
phosphate was added in reaction mixture to phosphorylate NodW. Except NB18, NodW
bound only to a fragment of DNA containing NB18 (Figure 9, lanes 1-5) and did not bind
to NB3, NB6, NB8, TB2 or TB8 (data not shown). NB18 is in the promoter region of ttsI.
NodW bound to the NB18 fragment even in presence of an unlabeled nonspecific mixture
of oligonucleotide showing that NodW binds to NB18 specifically (Figure 9, lanes 6-10).
NodW bound to NB18 even in the absence of carbamoyl phosphate (Figure 9, compare
lanes 10 and 11). NodD1 and NodD2 purified proteins were used as positive controls, as
both proteins are known to bind to NB18 (R. Wassem, unpublished data).
DNase I footprinting experiments were performed to determine the binding region
of NodW to the NB18-containing fragment of DNA precisely. Although purified NodW
protein was used at different concentrations no obvious footprint could be seen (Figure
10 lane 3 to 6). This contrasts with the positive controls where; NodD1 (lanes 7 and 8)
and NodD2 (lanes 9 and 10) footprinted the NB18 region. NodD1 bound over the entire
fragment whereas NodD2 bound to NB18 specifically – as shown in the laboratory earlier
(R. Wassem, unpublished data). The results of the EMSA suggest that NodW binding to
the NB18 DNA fragment was relatively weak compared to the positive controls, possibly
it is too weak to see distinct footprinting.
49
NodW- + D1 D2
1 2 3 4 5 6 7 8 9 10
NodW NodW+dIdc
-ca
p
No
dD
1
No
dD2
No
dD
1+N
odD
21 2 3 4 5 6 7 8 9 10 11 12 13 14
Figure 9. Electrophoretic mobility shift assay of a DNA fragment containing NB18 with NodW. Lanes 1 to 11 contained different concentrations of the NodW protein (lane 1 to 5 and 6 to 10; 0, 3.2, 8, 16 and 32 nM: lane 11; 16 nM). NodW proteins were incubated with carbonyl phosphate (lane 1 to 10) and competitor oligonucleotide (lane 6 to 10). NodD1 and NodD2 were tested for positive control.
Figure 10. DNase I footprinting to determine the binding site on the NB18 DNA sequence with NodW. Lane 3 and 6 is contained different concentrations of the NodW protein (16, 32, 80 and 160 nM). NodD1 (lanes 7 and 8) and NodD2 (lanes 9 and 10) were tested for positive control. Lane 1 and 2 contain the free radiolabeled DNA without DNase I or with DNase I, respectively. Red bar indicates NB18 region.
50
Preliminary conclusions
A polar mutant of nodVW was constructed and its effects on protein secretion and
synthesis of the rhamnose-rich LPS assessed, however no effects were seen. Thus unlike
the situation in B. japonicum where NodVW are required for ttsI transcription, nodVW
seem dispensable for this role in NGR234. Furthermore nodulation tests did not show any
obvious effect of NodVW on host plants known to be effected by similar mutations in B.
japonicum.
It has not been shown that NodW of B. japonicum binds to DNA. Surprisingly,
EMSA showed that NodW of NGR234 appeared to specifically bind to the NB18-
containing ttsI promoter - although the exact binding site could not be determined. NodW
bound only to NB18, and not other NBs and TBs.
These two results seem to contradict each other, as although NodW appears to
bind to the ttsI promoter region, there does not appear to be any regulatory effect. It
should be noted, however, that quantification of Nop secretion or rhamnose-rich LPS
production is difficult. Thus I attempted transcriptional assays with the nodVW mutant of
NGR234 using reporter gene fusions to various NBs and TBs, to see if there were subtle
alterations in transcription patterns.
51
Transcriptional effects in the nodVW mutant
The EMSA data suggested that NodW might influence the transcription of the
NB18 containing promoter. Previous data has shown that NB18 is only slightly induced
after flavonoid induction (Kobayashi et al., 2004) and so TB2 and TB8 were also tested
as effects on NB18 might be amplified on these promoters, NB8 which controls nodABC
transcription was also included. For each regulatory element pre-exisiting β-galactosidase
fusions (Kobayashi et al., 2004; Wassem et al., 2008) were mobilized into the nodVW
mutant of NGR234. Using daidzein and genistein for the inducer, β-galactosidase
activities were measured at 1 h and 24 h after induction (Figure 11). Comparing these two
inducers, daidzein activated transcription of all the promoters more strongly than
genistein, but there were no major changes in the patterns of activation. Results of
Student T-tests (P ≤ 0.01) that compared induced activities at 1 h and 24 h in NGR234
and NGRΩnodVW transconjugants, confirmed that optimal activation of two tts-box-lacZ
fusions (TB2 and TB8) had significant differences (P ≤ 0.01, t-test) when using genistein
as inducer. β-galactosidase assays also showed that NB18 had a slightly decreased
promoter activity in nodVW mutant but there were no significant differences when
compared statistically with wild-type. It had been shown that 18 of the 19 nod-boxes
promoter activities were abolished completely in absence of nodD1 (Kobayashi et al.,
2004). In this study, NGRΩnodD1ΩnodVW was also tested the transcriptional activity of
nod-boxes (NB8 and NB18) and tts-boxes (TB2 and TB8). There was no induction of
these promoters in NGRΩnodD1ΩnodVW, nor NGRΩnodD1 (data did not show).
52
TB2 TB8
0
1
2
3
4
5
6
7
NGR234 NGRΩnodVW NGR234 NGRΩ nodVW
1h 24h
NB8
0
1
2
3
4
NGR234 NGRΩ nodVW NGR234 NGRΩ nodVW
1h 24h
pMP220 NB18
0
1
2
3
4
NGR234 NGRΩnodVW NGR234 NGRΩnodVW
1h 24h
0
1
2
3
4
5
6
NGR234 NGRΩ nodVW NGR234 NGRΩ nodVW
1h 24h
0
1
2
3
4
5
6
NGR234 NGRΩ nodVW NGR234 NGRΩnodVW
1h 24h
daidzein
genistein
non-induced
TB2 TB8
Figure 11. Activity of promoters in NGR234 and NGRΩnodVW. β-galactosidase assays were used to assess the effect of NodVW on nod-boxes (NB8 and NB18) and tts-boxes (TB2 and TB8) promoter. Activity of the vector pMP220 devoid of an insert is reported. Assays were performed 1 h and 24 h in presence of inducer daidzein, genistein or absence of inducer. The values (x 10-3 Miller’s units) reported represent the means of three independent experiments and errors bars are shown on each time points.
These β-galactosidase assays showed that NodVW from NGR234 are possibly
required for optimal induction of NB18 and thus tts-boxes. At 24 h of induction, NB18,
TB2 and TB8 had slightly reduced the β-galactosidase activity levels in the nodVW
mutant. This result links with the earlier EMSA experiments indicating NodW might
effect ttsI (via NB18) expression and with the known NodVW function from B.
japonicum. Furthermore, these results also indicate why Nop secretion and rhamnose-rich
LPS synthesis was still observed, as promoter activities are reduced but not abolished.
Surprisingly, NodVW also had a significant effect on NB8 expression, after 24
hours of genistein induction the activity of NB8 was reduced in the nodVW mutant. This
unexpected data suggests that NodVW is not only acting on NB18 but on other promoters,
however NodW did not bind to NB8. Thus NodVW activation of NB8 may not be direct,
and instead is a result of NodVW affecting other parts of the regulatory cascade. EMSA
showed that NodW bound to the promoter region of ttsI, containing NB18, but the exact
site could not be determined. Also in this region, is the promoter region of nodD2,
53
containing a syr-box (Figure 12A). It is possibly that NodW binds elsewhere in this
region, explaining why NodW binding with NB18 was weak, and thus could affect
nodD2 promoter activity (Figure 12B). NodD2 is known to be involved in the repression
of Nod-factor synthesis, which would lead to a decrease in NB8 expression (Fellay et al.,
1998). If NodW was a repressor of nodD2, in the nodVW mutant, nodD2 expression
would be increased causing a stronger repression of nodD1. As a consequence of the
subsequent lower levels of NodD1, the activity nod-boxes (NB8 and NB18) and hence
the tts-boxes (TB2 and TB8) would be decreased, as seen in the previous β-galactosidase
assays (Figure 11).
NodV
NodW
TtsINB18NodD2 SB2
A B
nodD2 ttsI
NB18syr-box
1 kb
NodD1SyrM2
Figure 12. A: Region of ttsI and nodD2. The triangles indicate conserved promoter NB18 and syr-box for ttsI and nodD2, respectively. B: Model of the action of NodVW at the nodD2-ttsI promoter region. NodW has been shown that bind to NB18 using EMSA. If NodW bind to NB18 promoter region, is there any effect on nodD2 promoter activity?
To confirm this hypothesis, the expression of nodD2 should be assayed in the
nodVW mutant. Furthermore activities should be measured at longer time points, as both
NodD2 and TtsI act later time points after induction and thus the exact regulatory effects
may only be clear after 24 hours of induction. β-galactosidase activities of the nodD2
promoter (Fellay et al., 1998) and NB8, NB18, TB2 & TB8 were tested every 24 h up to
96 h using genistein for inducer in NGR234 and the nodVW mutant (Figure 13).
Expression of nodD2 promoter peaked at 48 h, agreeing with a previously study (Fellay
54
et al., 1998). In the nodVW mutant the nodD2 expression pattern was the same as wild-
type, however the expression levels were constantly halved. Thus in contradiction to our
earlier model, lack of NodVW actually led reduction of nodD2 promoter transcription
level and thus NodVW apparently activates NodD2.
NGR234 induced NGR inducedΩnodVW
NGR234 non-induced NGR non-inducedΩnodVW
pMP220
0
400
800
1200
1600
1h 24h 48h 72h 96h
pnodD2
0
400
800
1200
1600
2000
1h 24h 48h 72h 96h
NB18
0
400
800
1200
1600
1h 24h 48h 72h 96h
TB2
0
1000
2000
3000
4000
5000
6000
1h 24h 48h 72h 96h
TB8
0
2000
4000
6000
8000
10000
12000
1h 24h 48h 72h 96h
NB8
0
2000
4000
6000
8000
10000
12000
1h 24h 48h 72h 96h
Figure 13. Activity of the NB, TB and nodD2 promoter in NGR234 and NGRΩnodVW. β-galactosidase assays were used to assess the effects of nodVW on various promoters. Activity of the vector pMP220 devoid of an insert is reported. Assays were performed 1 h to 96 h in presence of inducer genistein or in absence of inducer. The values reported represent the means of three independent experiments and errors bars are shown on each time points.
NB18 promoter activity was repressed after peaking at 24 h in NGR234.
Expression of NB18 was variable in the nodVW mutant, initially lower than wild-type
levels, but after 40 hours (and all subsequent time points) it was higher than wild type.
Both expression patterns show that NB18 is initially induced until 24 h and then
repressed, possibly due to NodD2, as normally NodD2 should start to repress NodD1
(and thus NB18/TtsI) at later time points. In the nodVW mutant, the expression level of
nodD2 is lower than wild type, thus with less NodD2 NB18 would not be suppressed as
much as in the wild type strain – agreeing with the data obtained.
55
NB8, TB2 and (except at 96 hr) TB8 showed similar expression patterns - lower
in the nodVW mutant relative to wild-type at all time points after induction. Based upon
the expression of NB18 (and thus TtsI levels) after 48 h the expression levels of the TBs
should be higher than wild-type. Additionally, a transcriptional effect of NodVW on TBs
could be observed at early time point (24 h) suggesting that NodW may also activate ttsI
directly.
Although NB8 expression was unchanged in the nodVW mutant or wild-type at 24
h, at later time points its expression was consistently lower in the nodVW mutant. NB8 is
thought to be under the direct NodD1 mutant (Kobayashi et al., 2004). The differences of
activity of NB8 between wild type and nodVW mutant were clear and suggested that the
NodW regulation could be at the NodD1 level. Does NodVW effect nodD1 expression?
To answer to this question, the expression levels of the promoter region of NodD1 were
determined in the nodVW mutant. Additionally, the promoter region of syrM2 (NB19)
was also tested as SyrM2 is another regulator in the cascade. Testing NB19 will also
determine whether NodW acts on nodD2 expression directly, or through alterations to
syrM2 expression. Although EMSAs will be necessary to see whether NodW actually
binds at the promoter region of nodD2. A model of the latest NodW sites of action to be
tested is shown in Figure 14.
56
Flavonoids
Tim
e
NodV
NodW
NB3
NodD1
SyrM2
NodD2
NB19
SB2
Figure 14. Model of the hypothesis regulatory cascade of NodVW. nodVW mutants have a reduced activity of the nodD2 promoter. But at what point in the cascade does NodW function to alter expression of the nodD2 promoter?
NB19 and nodD1 promoter activities were tested every 24 h up to 96 h using
genistein for inducer in the nodVW mutant (Figure 15). Formerly, the nodD1 promoter
was shown to be expressed at a very low level, even in absence of flavonoid condition
(Kobayashi et al., 2004). In this study, the promoter region of nodD1 showed that
promoter activity was further repressed after flavonoid induction and this repression
pattern occurred in both, wild-type and NGRΩnodVW. Strikingly however in the nodVW
mutant, the nodD1 promoter at the earliest time point assayed had very high expression
levels. The presence of flavonoids led to a reduction in nodD1 expression in the nodVW
mutant, although in the absence of flavonoid expression remained relatively high. NodD1
is main regulator which controls many symbiosis factors. Therefore its expression is most
likely preserved carefully at a low level in the absence of flavonoids, even in the presence
of flavonoids the activity of nodD1 promoter is quickly repressed by NodD2 by feedback
inhibition (Fellay et al., 1998). The lack of NodVW leads to a higher level of expression
of NodD1 which after flavonoid induction may over-stimulate the regulatory cascade
57
leading to confusing transcriptional data observed. Thus NodVW is mostly likely a
repressor system for NodD1 in the absence of flavonoids.
NGRΩnodVW also had a strong effect on the expression of NB19. Compared to
NGR234, NB19 expression level is much higher, for example 12 times, 6 times at 24h,
48h respectively. Without flavonoid induction, NGRΩnodVW also had a remarkable
effect, in wild-type strain, NB19 strongly is repressed in the absence of flavonoids,
however NB19 in NGRΩnodVW was expressed at levels 20 times higher than wild-type.
It was shown that NodD protein binds to conserved 49 bp motifs (nod-boxes) even in the
absence of flavonoid (Feng et al., 2003) nevertheless flavonoids are required for the
activation of nod-loci (Fisher and Long, 1993). As the effects of NodVW were also
observed non-induced condition, this suggests that NodW is also a suppressor of NB19
in the absence of flavonoids.
pnodD1
0
400
800
1200
1h 24h 48h 72h 96h
NB19
0
400
800
1200
1600
2000
1h 24h 48h 72h 96h
NGR234 induced
NGR inducedΩnodVW
NGR234 non-induced
NGR non-inducedΩnodVW
Figure 15. Activity of the NB19 and nodD1 promoters in NGR234 and NGRΩnodVW. β-galactosidase assays were used to assess the effect of nodVW on various promoter. Assays were performed 1 h to 96 h in presence of inducer genistein or in absence of inducer. The values reported represent the means of three independent experiments and errors bars are shown on each time points.
The NodVW system may thus act to maintain low expression of the main
activators NodD1 and SyrM2 of the flavonoid inducible cascade. NodV is most likely
capable of sensing environmental stimuli, quite possibly as a sensor of the amount or
structure of flavonoids present. Thus at sub-optimal concentrations of flavonoid, NodVW
may repress the main regulators to restrain the symbiosis system. In nature, plant-
produced flavonoids are the first signals for symbiosis between NGR234 and legume host
58
plants. It is known that is NGR234 induced by flavonoids upto 10-8 M and the expression
levels of symbiotic factor increases up to a flavonoid concentration of 10-5 M (Kobayashi,
unpublished). In the laboratory we use the optimal concentration for NGR234 which is at
10-7 M. In the rhizosphere flavonoid concentrations could be low until NGR234 is in
close proximity to the plant root. To prevent premature release of symbiotic signals
(energetically wasteful) NodVW might repress symbiosis regulator cascade until precise
condition to activate. To examine this possibility, the expression levels of various
symbiotic factors will be compared in NGRΩnodVW and wild-type strain with various
concentrations of flavonoids.
Promoter activity level with GFP
For the β-galactosidase transcriptional assays, only daidzein and genistein were
used for inducer, and a few promoters were tested. As the effects of NodVW might be at
the global level of symbiotic signal expression and might depend on the nature of the
flavonoid used as the inducer. The study of promoter activities was expanded, using high-
throughput techniques developed in our laboratory (Le Quéré et al., 2008). Promoters
were fused to GFP and expression levels tested in 96 wells plate by measuring GFP
fluorescence levels (see materials and methods). This technique enables to test many
promoter activity as well as difference inducer relatively quickly with few manipulative
steps.
The effect of the nodVW mutant on seven differences promoters were tested by
comparing the fluorescence level of GFP (Figure 16). Various inducers; apigenin,
daidzein, genistein, kaempfenrol and naringenin were selected for the experiment known
to trigger activation of nod-boxes (Kobayashi et al., 2004). The final fluorescence levels
of GFP were calculated as described in materials and methods to compare each
independent experiment. Promoters of nopB, nopJ and rmlB are part of the TtsI-
dependent regulon (shown in chapter 1: named TB2, TB4 and TB8 respectively), are
inducible with all five flavonoids (Figure 16 A to C). All the flavonoids showed a
statistically significant difference on nopB promoter expression between wild-type strain
and NGRΩnodVW at 42 h to 72 h. The expression of nopB promoter in NGRΩnodVW
59
was decreased about 40 % to NGR234 with four different flavonoids. The reduction of
nopJ promoter expression in NGRΩnodVW was remarkable with all inducers. The
expression level of nopJ promoter in NGRΩnodVW were about 26 % (e.g. with
naringenin at 42 h) to 65 % (e.g. with daidzein at 96 h) of nopJ promoter in NGR234 and
these were showed a statistically significant difference. The nopB promoter (TB8) was
also analyzed its activity with β-galactosidase assay and its expression patterns were in
agreement using both methods with genistein for inducer.
The promoter of fixF (NB6) has been shown to be inducible by daidzein and
highly dependent on NodD2 (Kobayashi et al., 2004). fixF (NB6) promoter is involved in
rhamnan synthesis. The induction of NB6 was delayed and only observed at 24 h after
induction. In this study, promoter of fixF was inducible by all five flavonoids (Figure 16
C). No major effect of NodVW was observed.
The expression of exoK, rkpL and rkpY promoters were not induced by flavonoids,
and were often reduced in comparison to absence of inducer (Figure 16 D to F). Activity
of exoK promoter in NGRΩnodVW was slightly decreased in presence or absence of
inducer compare to NGR234, but there were no significant differences between two
strains. Any effect of NodVW on rkpL and rkpY promoter expressions were not revealed
clearly, only in absence of inducer at 72 h and 96 h, rkpL promoter activity was reduced
in NGRΩnodVW.
Using GFP to measure promoter activity had many advantages; assay time was
brief as GFP is measured directly, using a 96 well plate many samples can be tested at the
same time or in different condition (e.g. inducer, promoter). The major drawback of this
method is that each well is too small for cell growth (the medium is 2 ml maximum), the
cell lysis had probably started at longer time points after induction.
60
Non-induced
0
10
20
30
40
50
60Apigenin
GenisteinDaidzein
0
10
20
30
40
50
60
Kaempferol
0
10
20
30
40
50
60
T0 T24 T42 T48 T72 T96
Naringenin
T0 T24 T42 T48 T72 T96
Non-induced
0
10
20
30
40
50
60
70
80
Genistein
Apigenin
Kaempferol
0
10
20
30
40
50
60
70
80
T0 T24 T42 T48 T72 T96
Daidzein
0
10
20
30
40
50
60
70
80
Naringenin
T0 T24 T42 T48 T72 T96
A. promoternopB B. promoternopJ
Non-induced
0
10
20
30
40
50
60
Genistein
Apigenin
Kaempferol
0
10
20
30
40
50
60
T0 T24 T42 T48 T72 T96
Daidzein
0
10
20
30
40
50
60
Naringenin
T0 T24 T42 T48 T72 T96
C. promoterfixF D. promoter exoK
Non-induced
0
2
4
6
8
Genistein
Apigenin
Kaempferol
0
2
4
6
8
T0 T24 T42 T48 T72 T96
Daidzein
0
2
4
6
8
Naringenin
T0 T24 T42 T48 T72 T96
61
Non-induced
0
2
4
6
8
Genistein
Apigenin
Kaempferol
0
2
4
6
8
T0 T24 T42 T48 T72 T96
Daidzein
0
2
4
6
8
Naringenin
T0 T24 T42 T48 T72 T96
ApigeninNon-induced
0
2
4
6
8
GenisteinDaidzein
0
2
4
6
8
Kaempferol
0
2
4
6
8
T0 T24 T42 T48 T72 T96
Naringenin
T0 T24 T42 T48 T72 T96
E. promoter rkpL F. promoter rkpY
NGR234 NGRΩ nodVW
Figure 16. Activity of the 6 difference promoters in NGR234 and NGRΩnodVW. A to F represent the level of GFP fluorescence (x 10-3) which were measured every 24 h up to 96h. Each promoter was assessed in presence of inducer apigenin, daidzein, genistein, kaempferol or naringenin or in absence of inducer. The values reported represent the means of five independent experiments and errors bars are shown on each time points. The activities of promoters were calculated as described in materials and methods.
RT-PCR
Quantitative RT-PCR was used to measure the mRNA expression levels of nodV
in NGR234 as well as NGRΩnodVW in the presence of genistein. For the relative
expression ratio (R) of targets genes were resulted in comparison to the 16S ribosomal
RNA reference gene. Furthermore, two genes rpsL which encodes house keeping gene
and nopB which encodes secretion protein depend on flavonoid and T3SS were used for
controls. RT-PCR showed that nodV expression was low and not induced by genistein
and as expected were completely missing in the mutant. nodV expression levels were
62
similar after 6 h and 24 h flavonoid induction in NGR234 whereas nopB expression
increased after 24 h (Figure 17). Surprisingly nopB expression levels were not lower in
the nodVW mutant relative to wild-type, which is inconsistent with the β-galactosidase
and GFP transcriptional data described before, which showed significant difference on
nopB promoter activity between NGR234 and NGRΩnodVW at 24 h. This is most likely
due to the different experimental techniques used, i.e. measuring exact RNA levels here
compared to the activity of reporter enzymes earlier. Further RT-PCR will be performed
at different time points to verify these results.
0.10
1.00
10.00
100.00
1000.00
NGR234 NGR234
6h 24h
rpsL nopB nodV
NGRΩnodVW NGRΩnodVW
6h 24h
rpsL nopB nodV
log1
0
log1
0
Figure 17. Quantitative RT-PCR analysis of gene expression at different time points. Expression of rpsL, nopB, and nodV were analyzed at 6 h and 24 h after flavonoid induction. To calculate relative transcript level, 16S ribosomal RNA reference gene was used.
63
Conclusions
To investigate the function of NodV and NodW in NGR234, a nodV polar mutant
was generated, which had no effect on Nop secretion, rhamnose-rich LPS production, or
any phenotype on various host plants. NodW was shown to bind to a DNA fragment
containing NB18, suggesting it might influence ttsI transcription. The transcriptional
activity of several promoters were tested and compared. The nodVW mutants had slightly
or significantly reduced expression levels of NBs (NB8 and NB18) and TBs (TB2 and
TB8) promoter activity after flavonoid induction. This observation coincides with the
profile of secretion protein, polysaccharides and nodulation phenotype. NodVW effects
but does not abolish completely, the expression of these promoters. Further promoter
assays could not reveal the exact regulatory mechanism of NodVW but there was a
distinct effect of NodVW on the promoter regions of nodD1 and syrM2. The strongest
effects of NodVW on these promoters were observed without flavonoid induction. It
suggests that the function of NodVW from NGR234 is most probably as repressors of
nodD1 and syrM2 in absence of flavonoids to maintain low expression level of NodD1
and the symbiosis regulatory cascade. Then once sufficient levels of inducer are found,
repression is lost as nodD1 is activated, leading to symbiotic signal production. As well
as the NodD1 activation of nodD2 leading to NodD2 negative feedback of nodD1
expression, NodVW also appears to enhance activation of nodD2 in the presence of
flavonoids to further repress nodD1, although the mechanism for this is unknown. A
working hypothesis for NodVW functions is summarised in figure 18.
64
Flavonoids
Tim
e
NodV
NodW
NB3
NodD1
SyrM2
NodD2
NB19
SB2
Figure 18. Model of the function of NodVW in the regulatory cascade of NGR234. NodVW is repressor of nodD1 and syrM2 in the absence of flavonoids to maintain low levels of NodD1 and thus the symbiosis regulatory cascade. Then once flavonoids stimulate and promotes symbiosis cascade, NodVW also activates NodD2 which is repressor of nodD1.
Consequently, in the absence of NodVW the timing and induction levels of
symbiosis regulatory cascade was altered. Particularly the high levels of nodD1
expression most likely led to some of the unexplainable β-galactosidase assay data when
trying to determine the mechanism of NodVW function.
Further studies will determine whether NodW functions directly or indirectly on
the promoters of nodD1, syrM2 and nodD2. It will be interesting to test the ability of
NodW to bind to these promoter regions. Despite not having any clear symbiotic
phenotype, the nodVW mutant does have major effects on the induction of various
symbiotic signals. Most probably all the necessary signals can be synthesised but their
temporal regulation could be affected. It is possible that as a consequence the nodVW
mutant is less competitive than the wild-type strains and nodulation ability could be
tested accordingly.
65
For the transcriptional assay, two reporter genes (lacZ and gfp) were used in this
study. β-galactosidase is frequently used as a reporter for studying gene expression. The
enzymatic assays (lacZ) offer more robust analysis of gene activity than GFP. They are
very sensitive but they provide limited temporal or quantitative information due to the
perdurance of beta-galactosidase (Hand and Silhavy, 2000). GFP is particularly useful for
rapid quantification of gene expression in real time and in single cells (Bongaerts et al.,
2002). Quantification of GFP requires more technological investment (e.g. a flow
cytometer, fluorometer, or a fluorescence microscope) and the sensitivity can be a
problem, particularly for weak promoters, the low expression levels of GFP are more
difficult to detect. On the other hand, when the GFP fluorescence signal is detectable, it
can be measured rapidly and accurately in bulk cultures or individual cells in real time.
Initial comparisons on a few NGR234 promoters suggested both reporter genes gave
corresponding expression patterns. The use of GFP in a high-throughput strategy will
offer advantages in the number of promoters that can be assayed in a single experiment.
66
Chapter 3: Characterisation of NopM and the role in symbiosis of NGR234 effector
proteins
Introduction
On pNGR234a, there are three ORFs, nopJ, nopM and nopT (formerly y4lO, y4fR
and y4zC respectively) which have homology to virulence factors secreted in a T3SS-
dependent manner by plant and animal pathogens (Freiberg et al., 1997; Marie et al.,
2001). Thus NopJ, NopM, and NopT are good candidates to be effector proteins secreted
by the T3SS of NGR234 into legumes. As discussed in the previous chapter, each gene
encoding these putative effectors has a tts-box in their promoter (Figure 1). Furthermore
nopJ, nopM and nopT were all shown to be inducible after flavonoid induction, in a TtsI-
dependent manner (Wassem et al., 2008).
y4fR - nopM
TB1
y4fR
y4lO - nopJ
y4lO
fl5
TB4
y4zC - nopT
y4zC
TB112 kb
Figure 1. Genes encoding putative Nops controlled by tts-boxes. Three tts-boxes (TB) TB1, TB4 and TB11 were identified in the promoter regions of genes encoding the putative effector proteins; NopM, NopJ and NopT respectively. tts-boxes are represented by black arrows.
NopJ has homology to the YopJ (Yersinia outer protein J) family of effectors
found in both animal and plant pathogenic bacteria (Table 1). Members of this family
possess a conserved C55 peptidase domain of the CE clan of cysteine proteases (Hotson
et al., 2003; Hotson and Mudgett, 2004) and some have been shown to act on small-
ubiquitin-like modifier (SUMO)-conjugated proteins (Orth, 2002; Roden et al., 2004).
Site-specific mutation of conserved catalytic residues in the protease domain blocks this
activity. Within host cells YopJ interferes with mitogen-activated protein kinase (MAPK)
and nuclear factor kappa B (NF-κB) signalling pathways, and the conserved catalytic
residues are required for this function, although no evidence of any proteolytic activity on
members of these signalling pathways has been obtained (Aepfelbacher et al., 1999; Orth,
2002; Ruckdeschel and Richter, 2002). Recent studies now show that YopJ acts as an
67
acetyltransferase, acetylating serine and threonine residues of MAPKs that are normally
sites of phosphorylation (Mittal et al., 2006; Mukherjee et al., 2006), consequently
inactivating their function. The phytopathogen, Xanthomonas campestris pv. vesicatoria
is known to possess four YopJ-like proteins, AvrXv4, AvrBsT, AvrRxv, and XopJ.
AvrXv4 has been shown to function as a SUMO protease in planta during Xanthomonas-
plant interaction (Roden et al., 2004).
Table 1. Number of amino acids and predicted size of the representative member of YopJ family. Homology to NopJ (similarity and identity) was identified by BLAST-P search. The number of amino acids in a parenthesis indicates over how many amino acids homology existed to NopJ.
Amino acid Size Similarity to NopJ Identity to NopJ
NopJ Rhizobium sp. NGR234
260 aa 29.1 kDa - -
XopJ Xanthomonas campestris pv. vesicatoria
373 aa 40.6 kDa 67 % (215 aa) 47 %
AvrRxv Xanthomonas campestris pv. vesicatoria
373 aa 42 kDa 50 % (205 aa) 37 %
AvrXv4 Xanthomonas campestris pv. vesicatoria
359 aa 39.7 kDa 51 % (253 aa) 36 %
PopP1 Ralstonia solanacearum
368 aa 41 kDa 48 % (252 aa) 35 %
PopP2 Ralstonia solanacearum
488 aa 53 kDa 44 % (170 aa) 28 %
PopP3 Ralstonia solanacearum
378 aa 41.4 kDa 40 % (184 aa) 28 %
YopJ Yersinia pestis biovar Microtus
288 aa 32.5 kDa 45 % (146 aa) 21 %
YopP Yersinia enterocolitica
288 aa 32.3 kDa 45 % (145 aa) 20 %
The YopT family of effectors which include NopT are found in animal and plant
pathogens, as well as two rhizobia (Table 2). Members of the YopT family are also
cysteine (C58) proteases (Shao et al., 2002). They all possess an invariant C/H/D
catalytic core thought to be absolutely required for enzymatic activity. In host cells,
YopT cleaves Rho family GTPases at a specific site in the amino-terminal, releasing it
from the plasma membrane and inactivating it (Shao et al., 2003).
AvrPphB of the phytopathogen Pseudomonas syringae belongs to YopT family,
and AvrPphB is also an auto-protease (Puri et al., 1997; Shao et al., 2002). This cleavage
reveals a myristoylation site at its amino-terminus, leading to this modification within
plant cells causing it to be trafficked to the plant plasma membrane (Nimchuk et al.,
68
2000). The catalytic triad C/H/D in AvrPphB is required for autoproteolytic cleavage and
AvrPphB-induced hypersensitive response (HR) in Arabidopsis plants (Shao et al., 2002;
Warren et al., 1999).
Table 2. Number of amino acids and predicted size of the representative member of YopT family. Homology to NopT (similarity and identity) was identified by BLAST-P search. The number of amino acids in a parenthesis indicates over how many amino acids homology existed to NopT. ns: not significant. At primary amino acids sequence, the homology between NopT and YopT is low as described by Shao et al. (Shao et al., 2002). However NopT and YopT share invariant C/H/D catalytic core as described in chapter 4 Figure 2.
Amino acid size Similarity to
NopT Identity to NopT
NopT Rhizobium sp. NGR234
261aa 28.3 kDa - -
blr2140 Bradyrhizobium japonicum USDA 110
271 aa 29.2 kDa 71 % (270 aa) 58 %
blr2058 Bradyrhizobium japonicum USDA 110
298 aa 32.3 kDa 56 % (205 aa) 39 %
AvrPphB Pseudomonas syringae pv. phaseolicola
267 aa 28.7 kDa 41 % (166 aa) 27 %
YopT Yersinia pestis biovar Microtus
322 aa 36.3 kDa ns ns
Conserved domain searches show that NopM homologues have Leucine-Rich-
Repeats (LRR) (Table 3 and Figure 2). LRRs have been found in the primary structures
of a large number of proteins with diverse functions and cellular locations in a variety of
organisms and are mainly found in cell adhesion factors, hormone receptors, and enzyme
inhibitors (Kobe and Deisenhofer, 1994; Kobe and Kajava, 2001). Most of these proteins
are involved in protein-protein interactions.
Table 3. Number of amino acids and predicted size of the representative member of Leucine-Rich-Repeat family. Homology to NopM (similarity and identity) was identified by BLAST-P search. The number of amino acids in a parenthesis indicates over how many amino acids homology existed to NopM.
Amino acid size Similarity to
NopM Identity to
NopM NopM Rhizobium sp. NGR234
546 aa 60.5 kDa - -
blr1904 Bradyrhizobium japonicum USDA 110
585 aa 64.2 kDa 65 % (484 aa) 53 %
IpaH9.8 Shigella flexneri
545 aa 62 kDa 53 % (510 aa) 36 %
SspH1 Salmonella typhimurium
700 aa 28 kDa 54 % (440 aa) 39 %
SspH2 Salmonella typhimurium
788 aa 87.2 kDa 55 % (434 aa) 41 %
YopM Yersinia pestis biovar Microtus
409 aa 46.2 kDa 50 % (136 aa) 38 %
69
LRR6
LRR6
LRR15
LRR8
LRR12
YopM
NopM
IpaH9.8
SspH1
SspH2
Figure 2. Graphical representation of NopM and its homologues, the gray shaded boxes are the LRR domains (with the number of repeats indicated).
NopM homologues from animal pathogens are often detectable in the host cell
nuclei. SspH1 and SspH2 from S. typhimurium are both translocated into host cells (Miao
et al., 1999) and SspH1 is detectable in the nucleus (Haraga and Miller, 2003). The IpaH
(IpaH9.8, IpaH7.8, and IpaH4.5) proteins can be secreted by Shigella flexneri 2a (YSH6000)
via the T3SS, and immunofluorescence microscopy showed that IpaH9.8 is transported
into the nucleus in the host cells (Toyotome et al., 2001). Finally although YopM
function in host cells is not understood, it is necessary for full virulence of Y. pestis and
Y. enterocolitica as demonstrated by its mutagenesis (Leung et al., 1990; Mulder et al.,
1989). YopM is transported to the nuclei of mammalian cells after T3SS-injection, where
it is thought to modulate host defence responses via a vesicle-associated pathway
(Skrzypek et al., 2003). Thus these proteins all possess LRR, are secreted via T3SS and
are localized into host nucleus although they all lack classical nuclear localization signals
(NLS). Systematic deletions identified that the first three LRRs of YopM and the 32 C-
terminal residues of YopM (YopMC-ter) act as NLSs to target YopM to yeast nuclei
(Benabdillah et al., 2004).
Recently two other studies have shown alternative biochemical functions of two
members of this family of proteins. YopM interacts with mammalian kinases, forming a
complex with protein kinases C-like 2 (PRK2) and a ribosomal protein S6 kinase (RSK1).
The YopM-kinase complexes results in the activation of both PRK2 and RSK1, but the
consequence of their activation by YopM is not clear (McDonald et al., 2003). IpaH9.8
70
acts as an ubiqutin ligase, and a critical residue was identified that is conserved in all
family members, including NopM (Rohde et al., 2007).
Recently a proteomics-based study identified fragments of a NopM-like protein
secreted in a T3SS-dependent fashion by Sinorhizobium fredii HH103 after induction by
plant-derived flavonoids (Rodrigues et al., 2007). Peptides sequenced from this NopM-
like protein show excellent homology to NopM from NGR234. However the role of
NopM in the HH103 symbiotic interaction still remains to be determined. The genomic
sequence of B. japonicum USDA110 shows that it also possesses ORFs encoding
homologues of NopM. It is not known whether they also influence the USDA110
symbiosis. Interestingly no homologues are found in any of the sequenced
phytopathogens, implying that to date the only plant-interacting bacteria with such
putative effector proteins are rhizobia. The work in this chapter describes the
investigation of the T3SS-secretion of NopM, its role in the NGR234 symbiosis and then
the interaction of NopM and other effector Nops in NGR234.
71
Materials and methods
Microbiological techniques
Strains used in his work are listed in table 4. Escherichia coli strains were grown
in Luria-Bertani (LB) media at 37 °C (Sambrook et al., 1989). Rhizobium strains were
grown at 27 °C in either complete (TY) (Beringer, 1974) media or minimal media
containing succinate as the carbon source (RMS) (Broughton et al., 1986). Antibiotics
were added to the media at the following final concentrations; ampicillin (Ap), 50 µg ml-
1; gentamycin (Gm), 10 µg ml-1 (for E. coli), 20 µg ml-1 (for Rhizobium); kanamycin (Kn),
50 µg ml-1; rifampicin (Rif), 50 µg ml-1 and spectinomycin (Sp), 50 µg ml-1.
Mutagenesis of nopM
To obtain NGR∆nopM, cosmid pXBS23 (Perret et al., 1991) was digested with
PstI, and the 3.1 kb fragment containing nopM purified and sub-cloned into pBluescript
KS+. Then, part of insert was excised using BamHI and HindIII and cloned into pUC18
(Maniatis, 1982). This plasmid was then digested with NheI and ClaI to excise a 1-kb
fragment of nopM. The rest of plasmid was treated with the Klenow fragment and self-
ligated. This plasmid was restricted by digestion with PstI and BamHI, and the 1.7 kb
fragment containing deletion nopM were purified and cloned into the rhizobial suicide
vector pJQ-mp18 (Quandt and Hynes, 1993). Triparental mating was used to transfer the
resulting plasmid into NGR234. Double recombination was selected by plating bacteria
onto TY plates containing 5 % sucrose and appropriate antibiotics. Putative mutants were
confirmed by PCR and Southern blots of restricted genomic DNA using standard
procedures (Chen and Kuo, 1993; Sambrook et al., 1989).
The double mutants NGRΩnopJ∆nopM, NGRΩnopL∆nopM, NGR∆nopM∆nopP
and NGR∆nopM∆nopT were obtained by introducing the mutated nopJ (Deakin,
unpublished), nopL (Marie et al., 2003), nopP (Skorpil et al., 2005) and nopT (Saad,
unpublished) genes into NGR∆nopM respectively. The triple mutant
72
NGRΩnopL∆nopM∆nopP was obtained by introducing the mutated nopM gene into
NGRΩnopL∆nopP (Skorpil et al., 2005).
Production of the NopM antibody and over-expression of NopM
Anti-NopM antiserum was conducted using two peptides designed from the
sequence of NopM, N-TAEERPWEGRPQEAV and N-GETMEKVLRGRGLEL.
Immunisation of two rabbits with the coupled peptide mixture was performed to
established protocols (Eurogentec, Herstal, Belgium). To raise anti-NopM antiserum,
NopM was expressed in E. coil with a 6x His-tag at amino-terminal end. nopM DNA
sequence was amplified by PCR, using the primer pair 5’-CGGATATCATGAATGTAC
AACGGCCCGG-3’ and 5’-TCACAGCTCAAGACCGCGACC-3’. The PCR product
was cloned into the SmaI site of pBluescript KS+ and sequenced. Then the fragment of
EcoRV and XbaI site of nopM was subcloned into expression vector pPROEX-1 (BRL,
Bethesda, MD, U.S.A.) to construct pPROEX-nopM. The fusion protein NopM 6x His-
tag was over expressed in E. coil and purified using Ni-NTA resin (QIAGEN). The
presence of the fusion protein was verified by 15 % SDS-polyacryamide gel
electrophoresis.
Analysis of secreted proteins
Secreted proteins were purified and analyzed as described in Marie and associated
(Marie et al., 2003). Rhizobium strains were grown in 100 ml of RMS for 40 h in the
presence of apigenin to a final optical density at 600 nm of approximately 1.0. Secreted
proteins present in the supernatants of cultures were precipitated using ammonium
sulphate (60 %, wt/vol) and subsequently desalted using Sephadex G25-containing
columns (Amersham Biosciences, Uppsala, Sweden). Then proteins were separated by
15 % SDS-polyacryamide gel electrophoresis before staining with silver nitrate. For
immunostaining, proteins were transformed from SDS-PAGE onto Millipore immobilon
PVDF membranes by electroblotting, as described by Ausubel and associates (Ausubel et
al., 1991). Protein-primary NopM antibody complexes and anti-His x4 were visualized
using horseradish peroxidase-labeled anti-rabbit or anti-mouse antibodies respectively.
73
Then these were detected with ECL regent (Amersham). Antisera against NopA, NopB,
NopC, NopL, NopP and NopX has been described previously studies (Ausmees et al.,
2004; Deakin et al., 2005; Marie et al., 2003; Saad et al., 2005).
Plant material and assay
Seed source are listed in Pueppke and Broughton (Pueppke and Broughton, 1999).
Plant seeds were sterilized as described below: Crotalaria juncea; concentrated sulphuric
acid 10 minutes, 0.1 % (v/v) Tween 20 5 minuites and 5 % (v/v) H2O2 5 minutes.
Flemingia congesta; concentrated sulphuric acid 10 minutes, 0.1 % (v/v) Tween 20 10
minuites, 70 % (v/v) ethanol 10 minutes and 5 % (v/v) H2O2 5 minutes. Lablab
purpureus and Tephrosia vogelii; concentrated sulphuric acid 10 minutes, 0.1 % (v/v)
Tween 20 10 minuites and 5 % (v/v) H2O2 5 minutes. Pachyrhizus tuberosus;
concentrated sulphuric acid 25 minutes, 0.1 % (v/v) Tween 20 10 minuites and 5 % (v/v)
H2O2 5 minutes. Vigna unguiculata; concentrated sulphuric acid 10 minutes and 70 %
(v/v) ethanol 5 minutes. Nodulation tests were performed in Magenta jars as described by
Viprey and associates (Viprey et al., 1998). All plants were grown at a day temperature of
28 °C, a night temperature of 18 °C, and a photoperiod of 16 h. Each plant was
inoculated with 107 bacteria and harvested five to seven weeks after inoculation.
74
Table 4. Strains and plasmids used in this study
Strain Relevant characteristics Reference
Escherichia coli
DH5α supE44 ∆lacY169 ( 80lacZ∆M15) hsdR17 recA1 endA1 gyrA96 thi-1 relA1 BRL, Bethesdda, MD, U.S.A.
Rhizobium strains
NGR234 Broad host-range bacterium isolated from nodules of Lablab purpureus, Rifr (Lewin et al., 1990)
NGRΩrhcN NGR234 derivative containing an Ω insertion in rhcN, Rifr Spr (Viprey et al., 1998)
NGR∆nopA NGR234 derivative with nopA deleted, Rifr (Saad et al., 2005)
NGRnopB::uidA NGR234 derivative containing a uidA insertion in nopB, Rifr (Saad et al., 2005)
NGRΩnopJ NGR234 derivative containing an Ω insertion in nopJ, Rifr Spr W. Deakin, unpublished
NGR∆nopM NGR234 derivative with nopM deleted, Rifr This work
NGRΩnopL NGR234 derivative containing an Ω insertion in nopL, Rifr Kn (Marie et al., 2003)
NGR∆nopPtotal NGR234 derivative in which 0.5 kb of nopP was replaced by an Ω insertion, Rifr Spr
(Skorpil et al., 2005)
NGR∆nopT NGR234 derivative with nopT deleted, Rifr M. Saad, unpublished
NGR∆nopX NGR234 derivative in which the 552-bp BamHI internal fragment of nopX was replaced by an Ω insertion, Rifr Spr
(Marie et al., 2003)
NGR∆ttsI NGR234 derivative with ttsI deleted, Rifr (Wassem et al., 2008)
NGRΩnopL∆nopPtotal NGR∆nopPtotal derivative containing an Ω insertion in nopL, Rifr Knr Spr (Skorpil et al., 2005)
NGRΩnopJ∆nopM NGRΩnopJ derivative with nopM deleted, Rifr Spr This work
NGRΩnopL∆nopM NGRΩnopL derivative with nopM deleted, Rifr Knr This work
NGR∆nopM∆nopPtotal NGR∆nopPtotal derivative with nopM deleted, Rifr Spr This work
NGR∆nopM∆nopT NGR∆nopT derivative with nopM deleted, Rifr This work
NGRΩnopL∆nopM∆nopP NGRΩnopL∆nopPtotal derivative with nopM deleted, Rifr Knr Spr This work
USDA257 Broad host-range strain isolated from Glycine soja, Knr (Keyser et al., 1982)
Plasmids
pBluescript II KS+ High copy number ColE1-based phagemid, Apr Straragene, La Jolla, CA
pBDG98 pBluescript KS+ derivative carrying a nopM in EcoRV and XbaI site, Apr W. Deakin, unpublished
pXBS23 Lorist 2 derivative containing the y4eF to y4gD region of pNGR234a, Knr (Perret et al., 1991)
pUC18 Cloning vector with lacZ reporter gene containing multiple cloning site, Apr (Maniatis, 1982)
pJQ-mp18 Suicide vector used for directed mutagenesis, Gmr (Quandt and Hynes, 1993)
pJQ-nopM pJQ-mp18 derivative construct in which 1.7 kb fragment containing a deletion of nopM was inserted into the PstI and BamHI site, Gmr
This work
pJQ-nopJ pJQ-200SK derivative carrying construct in which an Ω cassette was inserted into the MluI site of nopJ, Gmr Spr
W. Deakin, unpublished
pJQ-nopL pJQ-200SK derivative carrying construct in which an Ω cassette was inserted into the EcoRV site of nopL, Gmr Knr
(Marie et al., 2003)
pJQ-nopP pJQ-200SK derivative carrying a construct in which nopP was replaced by an Ω cassette, Gmr Spr
(Skorpil et al., 2005)
pK18-nopT pK18mobsacB derivative construct containing a deletion of nopT, Gmr Knr M. Saad, unpublished
pRK2013 Tra+ helper plasmid (Figurski and Helinski, 1979)
pPROEX-1 E. coli expression vector with six-His tag, Apr Invitrogen, Carlsbad, CA
pPROEX-nopL pPROEX-1 derivative with EheI and XbaI site of full-length of nopL gene, Apr
(Bartsev et al., 2003)
pPROEX-nopM pPROEX-1 derivative with EcoRV and XbaI site of full-length of nopM gene, Apr
This work
75
Results and Discussion
Identification of NopM and production of antibody
To facilitate detection of NopM from NGR234, polyclonal antibodies were raised
using synthetic peptides designed from NopM. NopM was over-expressed and purified
from E. coli to allow testing of the antisera. A NopM-hexa-histidine tagged fusion protein
was expressed in E. coli and verified using a anti-His monoclonal antibody (Figure 1A).
Anti-His sera detected NopM 6x His-tag fusion protein (carrying a 6x-His tag; apparent
size of ≈63 kDa). For control, pPROEX-1 and pPROEX-nopL (carrying a 6x-His tag;
apparent size of ≈40 kDa) (Bartsev et al., 2004) were also used. The NopM-hexa-
histidine tagged fusion protein was used as a positive control for the polyclonal anti-
NopM antisera in all subsequent experiments.
83
62
47.5
32.5
25
175
kDa
83
62
47.5
32.5
25
175
kDa
A B
pPR
OE
X-n
opL
pPR
OE
X-n
opM
pPR
OE
X- n
opM
pPR
OE
X-0
1
NG
R234
NG
RΩrh
cN
Figure 1. A: Anti-His sera detection of 6x His-tagged Nop fusion proteins. Extracts were used from E. coli containing pPROEX-nopM and as controls, pPROEX-1 and pPROEX-nopL (carrying a 6x His tag; apparent size of ≈40 kDa) (Bartsev et al., 2004). B: Comparison of extracellular proteins from NGR234 and NGRΩrhcN. Secreted proteins from NGR234, NGRΩrhcN and the NopM 6x His-tag fusion protein were separated by SDS-15 % PAGE, transferred to PVDF and probed with the new NopM antibody.
76
NopM was shown to be secreted by the NGR234 T3SS. After 40 h of induction
with 2 x 10−7 M apigenin, proteins found in the supernatants of cultures of NGR234 and
NGRΩrhcN were isolated and separated by SDS-PAGE (Figure 1B). Anti-NopM
detected a 60 kDa band in the NGR234 extracellular proteins (with the NopM his tag
fusion protein also detected at approximately the same size) but not in extracts from
NGRΩrhcN.
Construction of a deletion mutant of nopM
To assess the function of nopM, a deletion mutant was generated. The nopM
region was isolated and a 1 kb fragment of nopM excised which contained its start codon
(Figure 2).
ClaI NheI
nopM y4gA
200 bp
ClaI - NheI
∆nopM y4gA
Figure 2. Mutagenesis nopM.
Proteins found in the supernatants of cultures of NGR234, NGRΩrhcN, and
NGR∆nopM were isolated and separated by SDS-PAGE and then stained with silver
(Figure 3A). Comparison of the distinct profiles of the extracellular proteins showed
clearly that proteins found in induced cultures of NGR234 were missing in induced
cultures of NGRΩrhcN that abolishes secretion of protein via the T3SS. The extracellular
proteins of NGR∆nopM were similar to those of NGR234 and no clear band of 60 kDa
(corresponding to NopM) was obviously missing. Probably NopM which is about 60 kDa
product was covered by NopX (64 kDa). To visualize NopM in NGR234 extracts
compared to NGR∆nopM extracts, two-dimensional gel electrophoresis (2D-gels) could
be used to separate proteins according to their size and isoelectric point, but instead the
77
anti-NopM antisera was used. To confirm that NopM was missing in the nopM deletion
mutant and also determine definitively whether NopM is required for the transit of Nops
into the extracellular medium, secreted proteins from NGR234, NGRΩrhcN and
NGR∆nopM were separated by SDS-15 % PAGE and transferred to PVDF membranes
and then probed with antibodies against NopM, NopX, NopL, NopP, NopB, NopC and
NopA. Western blots using anti-NopM showed that a 60 kDa protein secreted by
NGR234 after the flavonoid induction, cross-reacted with anti-NopM antiserum but not
in extracts from either non-induced NGR234, or induced cultures of NGR∆nopM and
NGRΩrhcN (Figure 3B). Additionally, secretion of Nops occurred in the nopM mutant,
but not the T3SS mutant. Thus NGR∆nopM did not change the pattern of secreted
proteins with the exception of the absence of NopM.
94
67
43
30
20
14
kDa
A
NopA
NopX
NopL
NopP
NopB
NopC
Anti-NopX
Anti-NopM
Anti-NopL
Anti-NopP
Anti-NopB
Anti-NopC
Anti-NopA
NGR234
NGR∆nopM
NGRΩrhcN
+- + +NGR234
NGR∆nopM
NGRΩrhcN
B
Figure 3. Nop secretion by NGR∆nopM. A: Secretion proteins from induced cultures of NGR234, NGRΩrhcN and NGR∆nopM were separated by SDS-15 % PAGE and stained with silver nitrate. B: Immunostaining with antibodies against NopX, NopM, NopL, NopP, NopB, NopC and NopA. Strains were grown in the absence (-) or presence (+) of apigenin.
78
In NGR234 mutations in proteins encoding components of the secretion
machinery block Nop secretion, which was not the case for NGR∆nopM. Considering
this and the homology of NopM to effector proteins from other pathogenic bacteria we
conclude that NopM is not a part of the secretion machinery and is another of the
NGR234 T3SS effector proteins that most likely function within legume cells.
Secretion of NopM by other NGR234 strains
Additionally, immunological detection of NopM was carried out using
intracellular and extracellular proteins of various (induced) mutant derivatives of
NGR234 and USDA257 (Figure 4). As a control, anti-NopL (Marie et al., 2003) was used,
as NopL is known to be detectable in both fractions.
Anti-NopL
Anti-NopMIntracellular
protein
Extracellularprotein
NG
R23
4N
GR
Ωrh
cN
NG
R∆no
pM
USD
A25
7
NG
Rno
pB::
uidA
NG
RΩ
nopL
NG
R∆n
opA
NG
R∆n
opP to
tal
NG
R∆n
opX
NG
R∆t
tsI
Anti-NopL
Anti-NopM
Anti-NopL
Anti-NopMIntracellular
protein
Extracellularprotein
NG
R23
4N
GR
Ωrh
cN
NG
R∆no
pM
USD
A25
7
NG
Rno
pB::
uidA
NG
RΩ
nopL
NG
R∆n
opA
NG
R∆n
opP to
tal
NG
R∆n
opX
NG
R∆t
tsI
Anti-NopL
Anti-NopM
Figure 4. Detection of NopM in various Rhizobium strains. Intracellular and extracellular proteins of induced USDA257 and various derivatives of NGR234 were resolved by SDS-15 % PAGE and transferred to PVDF membranes, followed by immuno-staining with specific anti-Nop antibodies.
As expected NopM and NopL secretion was abolished in T3SS machinery
mutants (NGRΩrhcN, NGR∆nopA and NGRnopB::uidA), but both Nops were detected
intracellularly confirming that it is the absence of the secretion machinery which leads to
their non-secretion. This experiment also demonstrates that under the defined growth
79
conditions used throughout, there is no NGR234 cell lysis and subsequent release of the
Nops. Furthermore, both NopM and NopL were missing in the intracellular and
extracelluar fractions from the transcriptional regulator mutant (NGR∆ttsI), as most
likely the T3SS genes were not induced. NopM and NopL were missing from their
respective mutants, but not from the mutations of NopP or NopX.
Interestingly in the Sinorhizobium fredii USDA257 protein fractions, NopM was
not detectable, NopL could be however, as has been previously shown (Ausmees et al.,
2004). NGR234 and USDA257 have similar legume host ranges (Pueppke and Broughton,
1999) and the genomic organization of their T3SS loci is remarkably similar. In previous
studies, it was shown that at least six Nops were secreted by T3SS of USDA257
(Krishnan, 2002; Krishnan et al., 2003; Lorio et al., 2004). It is possible that either the
peptide sequences used from NopM of NGR234 to generate the anti-NopM antiserum are
not present in a NopM-like protein in USDA257 or USDA257 is missing this Nop. To
answer to this question, Southern blot analysis should be able to confirm whether
USDA257 has sequence homologous to nopM. Recently it has been shown that S. fredii
HH103 probably secretes NopM (Rodrigues et al., 2007). This suggests that there could
be differences in Nop secretion between USDA257 and HH103, which might affect their
different symbioses host plants. The absence/presence of NopM is a good candidate with
which to test this theory.
Symbiotic phenotype of nopM
Nops are known to modulate nodule number and play a role in nodule
development. For some plant species, such as Tephrosia vogelii, Flemingia congesta and
Lablab purpureus, Nops enhance nodule formation, but for the Pachyrhizus tuberosus
and Crotalaria juncea, Nops appear to be deleterious. To evaluate the effect of NopM on
symbiosis, the nodulation abilities of strains NGR234, NGRΩrhcN, and NGR∆nopM
were compared on five different legume species known to have a phenotype with the
NGR234 T3SS (Figure 5A to E).
80
No
dule
num
be
rN
odu
len
umb
er
0
10
20
30
40
50
0
10
20
30
40
50
0
10
20
30
40
50
60
0
10
20
30
40
50
60
0
5
10
15
20
25
0
5
10
15
20
25
0
5
10
15
20
25
0
5
10
15
20
25
No
dule
num
ber
No
dule
num
ber
Nod
ule
num
ber
Nod
ule
num
ber
Nod
ule
num
ber
Nod
ule
num
ber
NGR234 NGRΩrhcN NGR∆nopMNGR234 NGRΩrhcN NGR∆nopM
NGR234 NGRΩrhcN NGR∆nopMNGR234 NGRΩrhcN NGR∆nopM
NGR234 NGRΩrhcN NGR∆nopM H O2
NGR234 NGRΩrhcNNGR∆nopM H O2NGR234 NGRΩ rhcNNGR∆nopM H O2
NGR234 NGRΩrhcNNGR∆ nopM H O2
NGR234 NGRΩrhcN NGR∆ nopM H O2
A: Lablab purpureus B: Pachyrhizus tuberosus
C: Flemingia congesta D: Tephrosia vogelii
E: Crotalaria juncea
NGR : all fix+ΩrhcN
NGR234 NGR∆nopM
Figure 5. Symbiotic phenotype of NopM on
various legume plants. Each bar indicated the
average number of nitrogen-fixing nodules per
plant, and standard errors of the means are
indicated adjacent to the ba
and . For the
control, sterilized water was used. Independent
experiment was performed at least three times.
r.
Ω ∆
Each leguminous
plant was inoculated with NGR234, T3SS null
mutant NGR NGRrhcN nopM
: all fix-
81
In contrast to wild-type NGR234, which produced up to twenty nodules per plant
on L. purpureus, the T3SS null mutant NGRΩrhcN formed few nodules on this plant. On
L. purpureus, in absence of NopM, a significant decrease of nodule number was observed
compared to NGR234. Plants and nodule weights were also decreased. On P. tuberosus, a
functioning T3SS has a globally detrimental effect on nodulation. A slight increase in
nodule number was obtained with NGR∆nopM indicating that NopM is partly
responsible for this block in formation of nodules. On F. congesta, T. vogelii and C.
juncea, NGR∆nopM did not change nodulation.
Interestingly, NGR∆nopM showed different effects depending on the plant
species. On L. purpureus, NGR∆nopM reduced the nodulation ability 50 % compare to
wild-type, and thus NopM acts as a positive effector. On P. tuberosus however,
NGR∆nopM slightly recovered the nodulation ability, suggesting NopM is a negative
effector. In NGR234, NopL and NopP were found and identified as effector proteins,
These Nops were shown only to have positive effects on legumes, for example, NopP and
NopL have positive phenotype on F. congesta and T. vogelii (Skorpil et al., 2005). Thus
in NGR234, NopM is the first effector protein that showed both positive/negative and
effects. This situation mirrors the role of Avr proteins secreted by phytopathogens. For
instance, two Avr proteins (AvrPto and AvrPtoB) from Pseudomonas syringae function
to suppress signalling in the generation of a plant innate defence response in their non-
host Arabidopsis (He et al., 2006) i.e. a positive role in the infection of this plant.
Whereas both AvrPto and AvrPtoB were originally identified as avirulence proteins
recognized by plants triggering a hypersensitive response (HR), a localized programmed
cell death (Dangl and Jones, 2001; Staskawicz et al., 2001) i.e. a negative role in the
infection of this plant. Thus on L. purpureus, NopM may function as suppressor of host
defences facilitating infection by NGR234 and thus improved nodulation, but on P.
tuberosus, NopM could be recognized as an avirulence factor to induce HR.
However as the effect of the NGR∆nopM not as strong as that of NGRΩrhcN on
either plant, suggesting the presence of alternative positive effector(s) for L. purpureus
and negative effector(s) for P. tuberosus. The double mutant, NGRΩnopL∆nopP was
shown to have a more pronounced phenotype than either single mutant, suggesting that
82
the effector Nops may function cooperatively (Skorpil et al., 2005). To test for the
presence of additional positive or negative effector on L. purpureus and P. tuberosus,
multiple Nop mutants could answer this hypothesis. Skorpil and associates (Skorpil et al.,
2005) suggested the presence of a negative effector as well as the positive effector in
NGRΩnopL∆nopP, in the interaction with T. vogelii. NopM is a possible candidate, thus
at the same time a triple mutant NGRΩnopL∆nopM∆nopP was created to test specifically
on T. vogelii.
Construction of multiple mutants
To investigate the interaction of Nops on symbiosis, the double mutants
NGRΩnopJ∆nopM, NGRΩnopL∆nopM, NGR∆nopM∆nopP and NGR∆nopM∆nopT as
well as the triple mutant NGRΩnopL∆nopM∆nopP were generated. To verify the absence
of specific Nops from these mutants extracellular proteins were separated on SDS-PAGE
and Western blot were performed (Figure 6A and B). Each double mutant showed
abolished the secretion of NopM and specifically NopL, NopP or NopT. The triple
mutant abolished secretion of NopL, NopM and NopP. Even though a NopJ antibody has
been constructed it does not detect NopJ in extracellular proteins, however
NGRΩnopJ∆nopM was resistant to spectinomycin as conferred by the omega interposon
inserted into nopJ. All mutants verified by PCR and Southern blots.
83
Anti -NopM
Anti -NopT
Anti -NopL
Anti -NopP
Anti -NopX
A B
Anti -NopM
Anti -NopL
Anti -NopP
Anti -NopM
Anti -NopT
Anti -NopL
Anti -NopP
Anti -NopX
Anti -NopM
Anti -NopL
Anti -NopP
NG
R234
NG
R∆nop
M
NG
R23
4
NG
R
∆nop
M
Ωno
pJ
NG
R
∆nop
P
∆nop
M
NG
R
∆nop
M
Ωno
pL
NG
R
∆nop
T
∆ nop
M
NG
R
∆nop
P
Ωno
pLN
GR
∆nop
M
Ω
∆
nopL
nopP
Figure 6. Profiles of Nops from multiple mutants. Extracellular proteins of multiple Nops mutants were separated by SDS-15 % PAGE and transferred to PVDF membranes and probed with Nop antibodies. A: Double mutants of NGRΩnopJ∆nopM, NGRΩnopL∆nopM, NGR∆nopM∆nopP and NGR∆nopM∆nopT. B: Triple mutant NGRΩnopL∆nopM∆nopP.
To establish whether NopM acts as the unidentified negative effector on T. vogelii,
the triple mutant NGRΩnopL∆nopM∆nopP was tested and compared with each single
mutants and NGRΩnopL∆nopP (Figure 7). As described earlier, the NGRΩnopL∆nopP
double mutant showed a more pronounced phenotype than either single mutants and the
nodulation ability was lower than NGRΩrhcN, indicating the existence of the
unidentified negative effector. The triple mutant NGRΩnopL∆nopM∆nopP generated a
slight increase nodule number but there was no significant difference compared with the
NGRΩnopL∆nopP double mutant. This result suggests that NopM is probably not a
negative effector on T. vogelii and thus the presence of other negative effector(s). As a
first approach to detect negative effector on T. vogelii, mutations of the other known
effector proteins (NopJ and NopT) in NGR234 should be created in NGRΩnopL∆nopP.
84
NG
R2
34N
GR
234
Ωrh
cNΩ
rhcN
ΩL
∆ M∆ P
ΩL
∆ M∆ P
0
5
10
15
20
25
Nod
ule
num
ber
ΩL
∆L
∆PP
∆ nop
∆ nop
∆M
∆M
nop
nop
Ωno
pno
p L
Tephrosia vogelii
ΩrhcN ∆nopM ΩnopL ∆nopP Ω ∆L P H O2NGR234 Ω ∆L P∆M
Figure 7. Symbiotic phenotype of multiple Nop mutants on T. vogelii. A triple mutant NGRΩnopL∆nopM∆nopP was inoculated and compared. Each bar indicated the average number of nitrogen-fixing nodules per plant, and standard errors of the means are indicated adjacent to the bar. For the control, sterilized water was used. Independent experiments were performed at least three times.
The double and triple multiple mutants were tested for their symbiotic ability on P.
tuberosus and L. purpureus - plants affected by NopM (Figure 8A and B). On P.
tuberosus, multiple mutants did not show any significant differences to the single nopM
mutant. This data suggested the presence of another (unidentified) negative effector. To
identify the negative effector(s) on P. tuberosus, a Tn5 transposon (Wilson et al., 1995)
could be used to randomly mutagenesis NGR234 and a mixture of mutants inoculated
onto P. tuberosus. Nodules from plants growing healthily could be harvested and the
rhizobia within extracted. Although it is more likely that Nop secretion is totally blocked
in these mutants, this could be tested, and any transposon mutants still able to secrete
Nops would be good candidates to have an insertion in the gene encoding the negative
effector.
On L. purpureus, the nodulation ability of double mutant NGR∆nopM∆nopP was
lower than NGR∆nopM, and it showed no difference in nodulation ability to T3SS null
85
mutant NGRΩrhcN. This result showed not only identified an additional positive effector,
NopP but also interpreted the difference in nodulation ability between NGR234 and
NGRΩrhcN. Because of missing two positive effectors NopM and NopP, there is a
difference of phenotype between NGR234 and NGRΩrhcN. Furthermore, the nodule
formation ability of NGRΩnopJ∆nopM is approximately equal with wild-type in spite of
the absence of NopM, the nopM single mutant showed 50 % lower nodulation ability
compare to wild-type. This result suggests that NopJ might be a negative effector on L.
purpureus. Furthermore the overall effect of the T3SS might be a result of both positive
and negative Nops. Thus on L. purpureus, the symbiotic phenotype of NGR234 is an
equilibrium result of negative (NopJ) and positive Nops (NopM & NopP). This will be
investigated further in the next section by testing L. purpureus with each single nop
mutants.
H2O
NG
R23
4
Ωrh
cN
∆nop
M
ΩL∆
M
ΩJ∆
M
∆M∆P
ΩL∆
M∆P
B: Pachyrhizus tuberosus
∆M∆T
0
10
20
30
40
50
Nod
ule
num
ber
NG
R23
4
Ωrh
cN
∆nop
M
ΩL
∆M
ΩJ∆
M
∆M∆P
ΩL
∆M∆P
∆M∆T
0
4
8
1 2
1 6
2 0
NG
R23
4
Ωrh
cN
∆nop
M
ΩL
∆M
ΩJ∆
M
∆M∆P
ΩL
∆M∆P
∆M∆T
Nod
ule
num
ber
H2O
NG
R23
4
Ωrh
cN
∆nop
M
ΩL∆
M
ΩJ∆
M
∆M∆P
ΩL∆
M∆P
∆M∆T
A: Lablab pupureus
H2O
NG
R23
4
Ωrh
cN
∆nop
M
ΩL∆
M
ΩJ∆
M
∆M∆P
ΩL∆
M∆P
B: Pachyrhizus tuberosus
∆M∆T
0
10
20
30
40
50
Nod
ule
num
ber
NG
R23
4
Ωrh
cN
∆nop
M
ΩL
∆M
ΩJ∆
M
∆M∆P
ΩL
∆M∆P
∆M∆T
0
4
8
1 2
1 6
2 0
NG
R23
4
Ωrh
cN
∆nop
M
ΩL
∆M
ΩJ∆
M
∆M∆P
ΩL
∆M∆P
∆M∆T
Nod
ule
num
ber
H2O
NG
R23
4
Ωrh
cN
∆nop
M
ΩL∆
M
ΩJ∆
M
∆M∆P
ΩL∆
M∆P
∆M∆T
A: Lablab pupureus
Figure 8. Symbiotic phenotype of multiple Nop mutants. Double and triple effector multiple mutants were inoculated on L. purpureus (A) and P. tuberosus (B). The phenotypes were compared with NGR234, NGRΩrhcN and NGR∆nopM. Each bar indicated the average number of nitrogen-fixing nodules per plant, and standard errors of the means are indicated adjacent to the bar. For the control, sterilized water was used. Independent experiments were performed at least three times.
86
Symbiotic phenotype of nops on Lablab purpureus
In NGR234, so far five effector proteins have been found and identified. On L.
purpureus, these single nop mutants were tested for their nodulation ability (Figure 9).
Plants inoculated with NGR∆nopP showed a dramatic decrease in nodulation ability.
NopP is also a positive effector as NopM, but its effect is stronger than NopM. Thus as
demonstrated earlier with the double mutant NGR∆nopM∆nopP, producing an equal
nodule number as the T3SS null mutant, NopM and NopP are the major positive (T3SS-
derived) determinants for nodulation on L. purpureus. In contrast to these Nops, plants
inoculated by NGRΩnopJ showed an increase in nodule number, although it was not
statistically significant. Thus probably NopJ has negative effect on L. purpureus. The
absence of NopL and NopT had no significant effect on L. purpureus.
Figure 9. Symbiotic phenotype of Nops on Lablab purpureus. Five difference effector Nops single mutants were inoculated on L. purpureus and the phenotype were compared with NGR234 and NGRΩrhcN. Each bar indicated the average number of nitrogen-fixing nodules per plant, and standard errors of the means are indicated adjacent to the bar.
NGR234 was isolated from nodules of L. purpureus and thus should be
considered as its natural host plant (Trinick, 1980). It is thus noteworthy that a functional
T3SS is necessary for efficient nodule formation.
0
5
10
15
20
25
30
35
0
1
2
3
4
5
6
7
8
9
NGR234 NGRΩrhcN NGR∆nopM NGRΩnopJ
No
dul
e n
umbe
r
NGRΩnopL NGR∆nopP NGR∆nopT
Pla
nt w
eig
ht (
g)
0
5
10
15
20
25
30
35
0
1
2
3
4
5
6
7
8
9
NGR234 NGRΩrhcN NGR∆nopM NGRΩnopJ
No
dul
e n
umbe
r
NGRΩnopL NGR∆nopP NGR∆nopT
Pla
nt w
eig
ht (
g)
87
Chapter 4: Functions of Nops in eukaryotic cells.
Introduction
For many Gram-negative bacterial pathogens, the T3SS is essential for the
initiation of maintenance of host infection (Galan and Collmer, 1999). It is, however, the
cocktail of effector proteins injected by the T3SS into cells of the plant or animal host
that change signal pathways to promote responses beneficial to the pathogen. Presently
the exact molecular functions of only a few effectors have been determined.
Understanding the functions of these effectors has become an urgent goal of both animal
and plant pathology. Determining the mechanism of action of the effectors is difficult,
primary sequence analysis often gives no clues as to their function. Thus a common
approach is to express the effectors in eukaryotic cell culture systems and observe the
consequences. Although this requires the technical ability of developing cell culture
systems from host organisms and methods for transfer of non-host genes and their
subsequent expression.
Some of the Nops are homologous to characterised effector proteins from
pathogens of various animal and plant species (see chapter 3). As reported in chapter 3,
Nops can have negative and/or positive effect depending on the host plant. We suggest
that these responses depend upon recognition (or not) of each Nop by host plants. By
comparison to the use of effectors by pathogens, positive effectors may aid infection (and
thus nodulation) by modulating host signal pathways, perhaps suppressing defence
responses or facilitating endocytosis. In contrast, negative effectors might be recognized
as avirulence factors and lead to strong localised defence reactions (HR-like). It is
difficult to work on many of the host plants of NGR234 at the molecular level. Thus
another eukaryotic model, yeast was used to study Nop functions.
To study microbial virulence factors, as a eukaryotic model, Saccharomyces
cerevisiae can serve as a powerful system (Lesser and Miller, 2001). Yersinia YopM
function was demonstrated in yeast cells and these confirmed the localization patterns
showing YopM to be transported to nuclei (Skrzypek et al., 2003). It was also shown
88
using yeast cells, that the catalytic core of YopT C139, H258, and D274 are essential for
YopT cytotoxicity (Shao et al., 2002). YopJ was also shown to inhibit MAPK signalling
in yeast cells (Yoon et al., 2003).
In this study, all the effector Nops were expressed in yeast cells. For NopJ, NopM
and NopT, based upon their homology to characterised effectors we observed whether the
Nops had similar effects. Thus we tried to visualize the location of NopM in yeast cells,
by expressing it as a GFP fusion. For NopJ and NopT, their toxicity in yeast was assessed,
as both effectors have the conserved catalytic residues found in their pathogenic
homologues. As these residues in the YopT family are also necessary for their proteolytic
activity, we looked for autoproteolytic cleavage. NopL and NopP were also expressed in
yeast, to study potential intracellular locations and their effects on yeast cell growth. Both
NopL and NopP have homology only to rhizobial proteins, thus there is no clue to their
functions from their primary sequences, although both may well interfere in
phosphorylation-based signalling pathways.
As well as using yeast, attempts were made to transform the (non-legume) model
plant Arabidopsis thaliana with the effector nops. Finally it was planned to test any
identified function of the effector Nops in host plants of NGR234. Presently it is not
possible to stably transform these plants thus I studied way to improve experimental
techniques required to transform roots of L. purpureus and V. unguiculata. Several A.
rhizogenes species were tested for their transformation frequency on L. purpureus and V.
unguiculata and attempts made to express Nops in their roots.
89
Materials and methods
Microbiological techniques
Escherichia coli strains were grown in Luria-Bertani (LB) media at 37 °C
(Sambrook et al., 1989). Rhizobium strains were grown at 27 °C in either complete (TY)
(Beringer, 1974) media or minimal media containing succinate as the carbon source
(RMS) (Broughton et al., 1986). Antibiotics were added to the media at the following
final concentrations; ampicillin (Ap), 50 µg ml-1; kanamycin (Kn), 50 µg ml-1; rifampicin
(Rif), 50 µg ml-1; spectinomycin (Sp), 50 µg ml-1; tetracycline (Tet), 15 µg ml-1; and
chloramphenicol (Cm), 15 µg ml-1. Escherichia coli strains DH5α was used as a host for
amplification and storage of plasmids. They were grown in Luria-Bertani (LB) media at
37 °C (Sambrook et al., 1989).
Yeast techniques
Plasmids and Strains
Plasmids and strains are summarized in Table 1. The open reading frame
encoding each of the translocated protein (Nops) was PCR amplified from NGR234
genomic DNA and subcloned in-frame with the C-terminus of GFP in pFUS (Johnson,
1991), to create GFP fusion proteins and without fusion tags in pYES2 (Invitrogen) under
the control of the GAL10 promoter. The PCR-amplified fragments used for cloning were
analyzed by DNA sequencing.
Saccharomyces cerevisiae strain W303 MATa/MATα (leu2-3,112 trp1-1 can1-100
ura3-1 ade2-1 his3-11,15) [phi+] (Fan et al., 1996) was used for the expression of NopM
fused to GFP in the expression vector pFUS and all Nop proteins in the expression vector
pYES2. YPD medium (peptone, yeast extract and glucose) was used for routine growth
of yeast. Whereas synthetic defined (SD) medium was used, with appropriate omissions
of amino acids to select for plasmids carrying metabolic markers, and with either glucose
90
(repression), raffinose (no effect) or galactose (induction) of the GAL10 promter.
Transformation of yeast was performed as described in Gietz and Schiestl (Gietz et al.,
1995).
Construction of pYES-nopM
To obtain pYES-nopM, nopM was amplified by PCR from genomic DNA of
NGR234 using the following primer pairs: A (5’-CAGGATCCATGAATGTACAACGG
CCCGG-3’) and B (5’-TCACAGCTCAAGACCGCGACC-3’). The 1.6 kb fragment
containing of nopM was first cloned into the EcoRV site of pBluescript KS+ and verified
by sequencing. HindIII and BamHI were used to excise a nopM fragment and which was
subcloned into the expression vector pYES2. pYES2-nops (nopJ, nopL, nopP, nopT and
nopT point mutants) were constructed using PCR (W. Deakin, unpublished).
Localization of NopM-GFP in yeast using microscopy
Yeast cultures carrying the plasmid pFUS-NopM were grown overnight in non-
inducing selective synthetic media supplemented with 2 % raffinose. Yeast were diluted
to OD600= 1.0. Expression of the fusion protein was induced by addition of 2 % galactose
to the medium. Yeast was observed at designated time points on a fluorescent microscope.
DNA was visualized by staining with DAPI (Roche) or Hoescht (Sigma). For DAPI
staining, yeast cells were collected by centrifugation and resuspended in H2O then
incubated with DAPI or Hoescht (1 µg/ml).
Preparation of protein extracts and immunoblot analysis
To confirm the presence of Nops protein in the yeast cells, total proteins from
yeast cells were extracted using Y-PER (Yeast Protein Extraction Reagent) (PIERCE).
After induction of Nops by 2 % galactose, yeast cells were collected. Cell pellets were
resuspended with appropriate amount of Y-PER and incubated 20 min at room
temperature. Cell debris were removed by centrifuging, the supernatants were used for
immunoblot analysis. Proteins in the soluble fractions from extraction procedure were
equilibrated to be at the same quantities, and then separated by SDS-PAGE. For
91
immunoblot, proteins were transformed from SDS-PAGE onto Millipore immobilon
PVDF membranes by electroblotting.
Growth assays
To compare the growth rates of strains carrying different Nops, saturated
overnight cultures of the strains were grown in non-inducing selective synthetic media
with 2 % raffinose. Each culture was normalized to OD600= 0.1 and then serially diluted
10-fold four additional times. Aliquots (10 µl) of each of the five dilutions were spotted
onto a selective medium plate supplemented with 2 % glucose or 2 % galactose. The
plates were incubated at 30 °C and photographs of the plates were obtained 2 days (with
glucose) or 2-4 days (with galactose) after plating.
Generation of transgenic roots
Plasmids and Strains
Plasmids and strains are summarized in Table 1. Agrobacterium rhizogenes strain
K599 (Cheon et al., 1993) was kindly supplied by Dr. F. Sanchez, A4RSII (Jouanin et al.,
1986), LBA9402 (Hood et al., 1993), 8196 (Hansen et al., 1992), 2659 (Brevet and
Tempe, 1988) and 15834 (Schiemann and Eisenreich, 1989) were kindly supplied by Dr.
D. Tepfer. These strains were tested the transformation frequency on Lablab purpureus.
A. rhizogenes strain strains were grown at 27 °C in either complete (TY) (Beringer, 1974)
media.
Construction of pCHF3-nopM-GFP
The open reading frame encoding NopM protein was subcloned in-frame with the
C-terminus of GFP in pCHF3 binary vector (Ge et al., 2005), to create GFP fusion
proteins under the control of the 35S promoter. To obtain pCHF3-nopM-GFP, nopM was
amplified by PCR from genomic DNA of NGR234 using the following primer pairs: A
(5’-CGAGTACTATGAATGTACAACGGCCCGG-3’) and B (5’-GTCTCGCCTTGGAT
92
CCTGCG-3’). The 1.6 kb fragment containing of nopM was first cloned into the EcoRV
site of pBluescript KS+ and verified by sequencing. KpnI and BamHI were used to excise
a nopM fragment and which was subcloned into the expression vector pCHF3-GFP.
Triparental matings were used to transfer the resulting plasmid into A. rhizogenes A4RSII,
K599 and LBA9402.
Root transformation using A. rhizogenes
For root transformation, L. purpureus and V. unguiculata were used and
transformation were performed as described in Estrada-Navarrete and associates
(Estrada-Navarrete et al., 2006). Plant seeds were sterilized as described in chapter 3, and
plants were grown 4 to 5 days until germination. Young seedlings with unfolded
cotyledons were infected at the cotyledonary node with A. rhizogenes carrying the gene
construct to be tested and the infection sites were kept in an environment of high
humidity. When the emerged hairy roots could support the plants, the main roots were
removed and the transgenic roots could be tested.
GUS staining
Hairy roots were placed whole in 90 % acetone on ice 20 min then washed with
cold sterile water. After fixation, roots were replaced in X-Gluc staining solution [2 mM
5-bromo-4-chloro-3-indolyl-β-d-glucuronide, 5 mM sodium phosphate, 2 mM potassium
ferrocyanide and 2 mM potassium ferricyanide] and incubated for 10 min at 37 °C.
Tissue was destained with 70 % (w/v) ethanol.
93
Table 1. Strains and plasmids used in this study
Strain Relevant characteristics Reference
Escherichia coli
DH5α supE44 ∆lacY169 ( 80lacZ∆M15) hsdR17 recA1 endA1 gyrA96 thi-1 relA1
BRL, Bethesdda, MD, U.S.A.
Saccharomyces cerevisiae
W303 MATa/MATα (leu2-3,112 trp1-1 can1-100 ura3-1 ade2-1 his3-11,15) [phi+]
(Fan et al., 1996)
Rhizobium strains
NGR234 Broad host-range bacterium isolated from nodules of Lablab purpureus, Rifr
(Lewin et al., 1990)
Agrobacterium rhizogenes
K599 Cucumopine-type strain (Cheon et al., 1993)
A4RSII Agropine-type strain (Jouanin et al., 1986)
LBA9402 Octopine-type strain (Hood et al., 1993)
8196 Mannopine-type strain Ri plasmid: pAr8196b (Hansen et al., 1992)
2659 Cucumopine-type strain (Brevet and Tempe, 1988)
15834 Agropine-type strain (Schiemann and Eisenreich, 1989)
Plasmids
pBluescript II KS+ High copy number ColE1-based phagemid, Apr Straragene, La Jolla, CA
pBDG98 pBluescript KS+ derivative carrying an nopM in EcoRV and XbaI site, Apr
W. Deakin, unpublished
pXBS23 Lorist 2 derivative containing the y4eF to y4gD region of pNGR234a, Knr
(Perret et al., 1991)
pFUS Yeast expression vector to create GFP fusions, LEU2, GAL10 promoter, high copy number
(Lesser and Miller, 2001)
pYES2 Yeast expression vector, URA3, GAL1 promoter, high copy number
Invitrogen
pFUS-nopM nopM cloned into pFUS as a 1.6 kb SacI-XhoI fragment. This work
pYES2-nopM nopM cloned into pYES2. This work
pYES2-nopJ nopJ cloned into pYES2. W. Deakin, unpublished pYES2-nopL nopL cloned into pYES2. W. Deakin, unpublished pYES2-nopP nopP cloned into pYES2. W. Deakin, unpublished pYES2-nopT nopT cloned into pYES2. W. Deakin, unpublished pYES2-nopT C93S nopT C93S cloned into pYES2. W. Deakin, unpublished pYES2-nopT H205A nopT H205A cloned into pYES2. W. Deakin, unpublished pYES2-nopT D220A nopT D220A cloned into pYES2. W. Deakin, unpublished pLG-GFPOAF1 Inserted GFP upstream of Oaf1, LEU2, GPD promoter M. MacLean,
unpublished. p35SGusInt Binary vector expressing GUS under the control of 35S
promoter, the Gus gene has an intron. (Vancanneyt et al., 1990)
pCHF3-GFP Binary vector to create GFP fusions C. Fankhauser, unpublished.
pCHF3-nopM-GFP Binary vector with nopM fused in frame with GFP This work
94
Results and Discussion
Expression of a NopM-GFP fusion in yeast
To determine where NopM localize in eukaryotic cells, NopM was expressed
tagged with GFP in S. cerevisiae strain W303. Yeast cells expressing the fusion protein
were observed by fluorescence microscopy after induction with galactose (Figure 1A).
Comparing the distribution of NopM-GFP with that of GFP alone (expressed from yeast
containing the vector only) showed that the un-tagged GFP had a diffuse distribution,
being present throughout the cytosol, in the nucleus, and sometimes in the vacuole of the
cell. In contrast, NopM-GFP concentrated in the nucleus and co-localized with Hoechst
staining of DNA (i.e. nuclei) at 1.5 h and 3 h after induction. This finding demonstrated
that NopM of NGR234 does preferentially localize within eukaryotic cell nuclei.
However, after 6 h of induction and all subsequent time points, GFP fluorescence could
be observed in throughout yeast cells containing NopM-GFP (data did not show),
suggesting that the ability of NopM to be trafficked to nuclei was lost. The ability of
NopM to be transiently localised in the nuclei would be an interesting adaptation
compared with YopM, which is stably located in the nucleus (Skrzypek et al., 2003). It
was equally possible that the NopM-GFP fusion could be degrading, however. To check
this, proteins were extracted from yeast cells and western-blots performed using an anti-
NopM antibody (Figure 1B). Although a NopM-GFP fusion protein of approximately 90
kDa could be detected after induction a band of approximately 60 kDa (presumably non-
tagged) NopM single band was also detected. Note that a yeast protein of approximately
60 kDa is detectable with the anti-NopM (or anti-rabbit secondary) antibodies, but with
the NopM-GFP fusions there is clearly an extra detectable band. Thus it appears that the
NopM-GFP fusion protein is unstable, even immediately after induction the fusion started
to degrade and after 6 hours the relative proportion of untagged GFP made microscopic
detection of the NopM-GFP fusion in the nucleus impossible. Thus to confirm the
localization of NopM in yeast cells, use of a yeast protease mutant (e.g. YPL 154c) might
reduce the degradation of the fusion protein. Although the fusion could simply be
inherently unstable and thus alternative techniques might be required.
95
DAPI GFPDAPI/GFP
Control
NopM-GFP fusion
DAPI GFPDAPI/GFP
Positive control
control
Positive control
NopM-GFP fusion
pFUS-NopM-GFP
83
62
kDa0 1.5 3 0 1.5 3
83
62
kDa
pFUS
A
B
Figure 1. A: Immunofluorescence microscopy of yeast expressing NopM-GFP proteins. Yeast (W303) carrying plasmids encoding galactose-inducible nopM-GFP fusion genes were visualized at 0 h, 1.5 h or 3 h after the addition of galactose. Yeast carrying plasmids, pFUS and pLG-GFPOAF1 were used for vector and positive control, respectively. Yeast cells were stained with DAPI to visualize DNA. DNA (blue) is shown in the first panel, GFP (green) is shown in the third panel and the middle panel represents the first two panels merged together such that the turquoise features represent co-localization of NopM-GFP (green) and DNA (blue). B: Immunological detection of NopM in yeast strains. Yeast proteins were extracted at 0 h, 1.5 h or 3 h after the addition of galactose. Then these proteins were separated by SDS-15 % PAGE and transferred to PVDF from SDS-PAGE onto PVDF membranes and probed with NopM antibody. For the control, pFUS vector were expressed in yeast. Note the presence of a non-specific band of approximately the same size as NopM in yeast cells expressing the vector control. As sample concentrations were equilibrated before loading the increased signal at about 60 kDa in samples represents GFP-less NopM.
96
Study of NopT in yeast
As discussed in the previous chapter, NopT is a member of the YopT family of
effectors which have a catalytic triad of amino acids (in YopT - C139, H258, and D274)
essential for function (and for YopT its cytotoxicity in yeast cells) (Shao et al., 2002). In
the homologue AvrPphB of P. syringae these residues are also essential for an auto-
proteolytic event, whereby AvrPphB is cleaved from its 35 kDa precursor form into a
mature peptide of 28 kDa. The cleavage event reveals a myristolation site, and it has been
shown in Arabidopsis that the mature form of AvrPphB is myristolated resulting in its
targeting to the plant plasma membrane (Nimchuk et al., 2000). By alignment NopT and
other rhizobial homologues of YopT/AvrPphB also have the conserved residues (Figure
2).
Various forms of NopT were expressed in yeast cells to study whether NopT
functions similarly to YopT and/or AvrPphB. In particular I examined whether NopT was
capable of autoproteolytic cleavage within yeast cells. NopT after secretion by NGR234
appears to be unprocessed (W. Deakin, unpublished) implying that to function as a
protease NopT might require some feature of the eukaryotic intracellular environment. To
facilitate this study a point mutant in a residue of the catalytic triad of NopT, NopT C93S,
(S. Ardissone, unpublished) was also used. If auto-proteolysis occurs the location of
NopT will be examined.
97
*: conserved catalytic core : other conserved residues
10 20 30 40 50 60 70. . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . |
NopT ----------- MHSPI SGSFTSSTQVHDPI HPANSDGFRETLANVELRTKSPSAECPDKMGCCASKP---blr2140 ----------- MYDRI GGSSTRTSQTDEPSQSVDSGSFTETLADLAPQWSSRSGELPDKMGACCSKPDTLblr2058 ----------- MYNRVDGEYAHTEQAEESSWPADGSECAQTLTEI ARLESLAPGELFDRMGLCFSKPHTSAvrPphB ----------- MKI GTQATSLAVLHNQESHAPQAPI AVRPEPAHAI PEI PLDLAI RPRTRGI HPFLAMTLYopT MNSI HGHYHI QLSNYSAGENLQSATLTEGVI GAHRVKVETALSHSNLQKKLSATI KHNQSGRSMLDRKLT
80 90 100 110 120 130 140. . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . |
NopT ---- QASDPNNPSTSSPAR------------ PSTSLFRYR---------------- TAELAQANADGI CVblr2140 DANVQTSSASEPSTSSPES------------ PATSLFEYR---------------- TADLRDANVDGI CVblr2058 DAI DDSSNTSGLSTSSLSSSSELSVAT--- SPVRPLFDYR---------------- TAELPQANVSGI CVAvrPphB GDKGCASSSGVSLEDDSHT------------- QVSLSDFS---------------- VASR- DVNHNNI CAYopT SDGKANQRSSFTFSMIMYRMI HFVLSTRVPAVRESVANYGGNI NFKFAQTKGAFLHKII KHSDTASGVCE
150 160 170 180 190 200 210. . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . |
NopT GLTAEWLRNLNS- HPSI RMEALVPGSQRHASATVRQKEY- ENLKVHLRRQGAGPSEADFAAQNTMLQKAGblr2140 GLTAEWFRNLSN- SPSTRMSALTPGSQTHASAAERQQQY- QRLKDQLRSRGAGSSQADLQAQNTIL EEAGblr2058 GLAAEWLL DLPS- SASSRMGVLLPGTENHRSAARRQEQS- EKLKTQLKEDKAEGS- HNFQAKSTIL RDAGAvrPphB GLSTEWLVMSSDGDAESRMDHLDYNGEGQSRGSERHQVYNDALRAALSND--- DEAPFFTASTAVI EDAGYopT ALCAHWI RSHAQ-- GQSLFDQLYVGGRKGKFQI DTLYSI KQLQI DGCKADVDQDEVTLDWFKKNGI SERM
220 230 240 250 260 270 280. . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . |
NopT LAPSGK- EKVYKVGEP--- NFPRMLT- KI TADGSNHLL SLYFAEG-- GAHTVATSAMDGN- TTLFDPNFGblr2140 LEPAGE- EKRFAFGKSS-- NVKSMVN- EI NEDGSNHLL SLYFAEG-- GAHTVATSASNGT- TTLFDPNYGblr2058 LEPSAE- ETRYRFGTSS-- CI DKIV N- ELAQDPSVHLVSLKFVQPGAGTHTI ATATSNGT- TIL SDPNYGAvrPphB FSLRREPKTVHASGGSA-- QLGQTVAHDVAQSGRKHLL SLRFANV-- QGHAI ACSCEGSQ- FKLFDPNLGYopT I ERHCLL RPVDVTGTTESEGLDQLL NAIL DTHGI GYGYKKI HLSGQMSAHAI AAYVNEKSGVTFFDPNFG
290 300 310 320 330. . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . . . | . . .
NopT EFTVQSD-- QI DDLFRSLANRYSNPNRQHLTTVTTQKMT-------------------blr2140 EFTVRSDPDQMASLL QSLANRYRNPNGQHLSTI TTQRMQ-------------------blr2058 EFTVPSD-- RVGGLFKSLAERYSTLNKRDI SAVVTQRI RYGHPNATDLALFPRAEPHRAvrPphB EFQSSRS-- AAPQLI KGLI DHYNSLN- YDVACVNEFRVS-------------------YopT EFHFSDK---- EKFRKWFTNSFWGNSMYHYPLGVGQRFRVLTFDSKEV----------
*
* * *** *
**
**
*
: cleavage site and myristoylation sites (glycine residue)
Figure 2. Multiple sequence alignment of representative members of the YopT family of effectors. Members were identified by PSI-BLAST searches and aligned with the Bio Edit program. The following members are shown; NopT from NGR234, blr2140 and blr2058 from B. japonicum, AvrPphB from Pseudomonas syringae pv. phaseolicola and YopT from Y. pestis. The putative catalytic core residues of cysteine, histidine, and aspartic acid are boxed. Other invariant residues are marked with asterisks. The potential cleavage and myristoylation sites (glycine 61) of the rhizobial homologues are indicated with red triangles.
When NopT and NopT C93S were expressed in yeast cell, western-blot analysis
showed an interesting profile (Figure 3). Use of the NopT antibody was complicated by a
relatively high background of non-specific protein detection, but was easily clarified by
comparing the size of expressed proteins to NopT present in secreted proteins isolated
from cultures of NGR234. Thus when wild-type NopT was expressed in yeast after 4
98
hours a band of approximately 28 kDa was visible of the same size as NopT secreted by
NGR234. A second smaller band of approximately 23 kDa was also detected.
Furthermore at 7 hours post induction only this smaller band was detectable. When the
point mutant, NopT-C93S, was expressed and only a band of 28 kDa band was detected
which is probably the unprocessed form of NopT. Thus this result demonstrated that not
only can NopT cleave itself, but when one of the predicted amino acids essential for
protease activity is mutated, the cleavage does not happen. Thus at least this residue of
the predicted catalytic triad is essential for the cleavage of NopT.
NopT
pYES2-nopT
T0 T4 T7 T0 T4 T7 T0 T4 T7
pYES2-nopT C93S pYES2
NG
R2
34
Figure 3. Detection of NopT and NopT-C93S in yeast strains. Yeast proteins were extracted at 0 h, 4 h and 7 h after the addition of galactose. Then these proteins were separated by SDS-15 % PAGE and transferred to PVDF from SDS-PAGE onto PVDF membranes and probed with NopT antibody. For the control, NGR234 supernatant protein and expressing pYES2 vector in yeast were used. Red arrow and triangle indicate full-length of NopT and cleavage NopT bands, respectively.
Unfortunately further experiments to determine the location of NopT after
autoproteolytic cleavage did not reveal a plasma membrane site (data not shown). Most
likely there are differences between the ability of yeast and plant cells to myristolate
99
proteins. The yeast system could however be used to purify the cleaved form of NopT
and to determine whether the cleavage site is where it is predicted to be.
Effects of Nops on yeast growth
To test whether the expression of Nops within yeast affected cell growth and thus
could confer genetically manipulatable growth phenotypes, yeast cells were transformed
with each of the nop genes without any tags (Figure 4A). As YopT is known to be toxic
to yeast growth and based upon the previous results showing NopT is a functional
protease inside yeast cells, all the nopT point mutants in the catalytic triad were assayed.
Expression of the Nops after galactose induction was confirmed by immuno-blotting
(Figure 4B). In yeast expressing NopJ, NopP, NopM and NopT (and the NopT point
mutants) after galactose induction no growth inhibitions were observed. All these strains
grew similarly to a strain expressing vector alone. NopL expression, however conferred a
severe inhibition to growth. When NopL was induced in yeast cell, yeast growth was
completely prevented. Thus NopL must have a function which is a toxic for eukaryotic
cell. It is possible that NopL interferes extensively with signalling pathways within yeast
cells causing this toxicity. NopL is an excellent substrate for plant Ser/Thr kinases and
NopL is phosphorylated by MAP kinases (Bartsev et al., 2003). This phenotype of NopL
within yeast cells, opens up the possibility of functional screens to identify key
domains/residues in NopL important for its function. To identify regions of NopL which
is responsible for growth inhibition, nopL point mutants or deletion mutants will be
generated and tested in yeast cells. Mutated forms of NopL that permit yeast growth after
galactose induction, could reveal an “active site” of NopL. The corresponding nopL
mutants could then be tested for their nodulation ability on F. congesta (Marie et al.,
2003). Screening libraries of yeast mutants with wild-type NopL for strains that are also
capable of growth may indicate the cellular process(es) affected by NopL and thus a
potential enzymatic function.
100
pYES2-nopP
Anti-NopP
Anti-NopL
NGR T0 T4 T7
pYES2-nopL
NGR T0 T4 T7
B2% Glucose 2% Galactose
pYES2-nopM
pYES2
pYES2-nopJ
pYES2-nopP
pYES2-nopL
pYES2
pYES2-nopT
pYES2- C93SnopT
pYES2- H205AnopT
pYES2- 220AnopT D
pYES2
A
10 fold dilutions
Figure 4. Effects of Nops on yeast growth. A: Yeast (W303) carrying plasmids encoding galactose-inducible nop genes were grown overnight in non-inducing selective synthetic media containing raffinose as a carbon source. Cultures were then normalized to OD600 = 0.1 and serial 10-fold dilutions were spotted onto selective media plates containing glucose (2 %) and galactose (2 %). For the control, pYES2 vector were used. B: Detection of NopL and NopP in yeast strains. Yeast proteins were extracted at 0 h, 4 h or 7 h after the addition of galactose to confirm the presence of Nops. Then these proteins were separated by SDS-15 % PAGE and transferred to PVDF membranes and probed with NopL or NopP antibody. For the control, proteins were extracted from yeast containing only the pYES vector.
101
Expression of Nops within legumes - root transformation using A. rhizogenes
Susceptibility of NGR234 hosts to A. rhizogenes
Ideally the results from the Nop expression in yeast experiments would be
confirmed using legumes and more particularly legumes known to be hosts for NGR234.
Few such legume expression systems exist and thus as a test case, I attempted to
determine whether NopM was also targeted to legume nuclei. As NopM has a positive
role in the nodulation of L. purpureus, this plant was selected. Previous studies had
showed that another NGR234 host V. unguiculata, could be infected by some A.
rhizogenes strains, with A4RSII the most virulent (A. Krause, unpublished). Several A.
rhizogenes species were tested for their transformation ability on L. purpureus. V.
unguiculata was also re-tested for infection by A. rhizogenes A4RSII and K599 strains
and it was reaffirmed that A4RSII had high efficiency (100 %), and formed on average 6
and 18 hairy roots at 2 and 4 weeks after infection respectively. The susceptibility of L.
purpureus was tested with 6 difference A. rhizogenes species after 2 and 4 weeks
injection. Only K599, A4RSII and LBA9402 strains induced hairy root formation at 2
weeks (Figure 5). One to two roots per wound were produced with these A. rhizogenes
strains. The frequencies increased at 4 weeks after injection, with even 2659 and 15834
strains produced hairy roots. Highest frequencies to induce hairy roots were observed
when L. purpureus was infected with A. rhizogenes K599.
102
0
1
2
3
4
5
6
K599 A4RSII LBA9402 8296 2659 15834
Ave
rage
nu
mb
erof
har
iry
root
sp
erp
lan
t
2 weeks 4 weeks
Figure 5. Root transformation using various A. rhizogenes on L. purpureus. A: L. purpureus plant was infected with K599 and hairy roots could be seen emerging from globular tumours formed at wounded sites. B: Average number of hairy roots per plant with various A. rhizogenes strains. Hairy roots were counted at 2 or 4 weeks after infection.
Transformation efficiency
Although hairy roots were visible, it was necessary to verify that hairy roots could
be co-transformed with DNA from a binary vector. Thus a reporter system was used to
test this, a binary vector containing a 35S-gusA-intron cassette was integrated into A.
rhizogenes K599, A4RSII and LBA9402 strains by triparental mating. The construct 35S-
gusA-intron contains the β-glucuronidase (GUS) gene under the control of the 35S
promoter and the gusA gene contains a plant intron so it cannot be expressed by
agrobacteria (Vancanneyt et al., 1990). L. purpureus were infected with A. rhizogenes
K599, A4RSII and LBA9402 strains contain p35S-gusA-intron and individual hairy roots
were excised and stained for GUS activity 4 weeks A4RSII infection (Figure 6A). V.
unguiculata was also infected with A. rhizogenes A4RSII strains as a positive control.
The transformed hairy roots were obtained with K599 and A4RSII strains on L.
purpureus, the efficiencies were 33.8 % + 23 % and 38.5 % + 9.5 %, respectively. The
transformed efficiency of V. unguiculata with A4RSII strain (52.8 % + 31.4 %) was
higher however. Compared to V. unguiculata, a high frequency transformed hairy root
103
was not obtained with L. purpureus, however an attempt was made to express a NopM-
GFP fusion in L. purpureus roots (see next section).
0
10
20
30
40
50
60
70
80
90
K599 A4RSII LBA9402 A4RSII
L. purpureus V. unguiculata
Tra
ns
form
edh
air
yro
ots
(%)
0
10
20
30
40
50
60
70
80
90
K599 A4RSII LBA9402 A4RSII
L. purpureus V. unguiculata
Tra
ns
form
edh
air
yro
ots
(%)
Figure 6. Root transformation efficiency on L. purpureus and V. unguiculata. A: GUS staining of hairy roots. Hairy roots were formed by injection with K599 on L. purpureus and stained to see GUS expression. B: Transformed hairy roots per plant (%). Various A. rhizogenes strains were tested the transformation frequency. The hairy roots were collected 4 weeks after infection.
Transformation of pCHF3-nopM-GFP
A. rhizogenes A4RSII and K599 strains containing pCHF3-nopM-GFP were
infected into L. purpureus to see the localization of NopM in plant root cells. NopM is
fused to GFP protein for observation by immunofluorescence microscope with the empty
vector pCHF3-GFP used as a control. In an initial attempt the hairy roots which were
infected with A. rhizogenes A4RSII and K599 strains containing pCHF3-nopM-GFP
showed GFP green fluorescence, however the localization of GFP did not show any
difference compare to vector control (data not shown). Further attempts are required to
refine this technique, and in particular it should be confirmed that NopM-GFP fusion
protein is not degraded after expression in hairy roots.
104
Conclusions
Nops were expressed in yeast cells as to five an initial insight into their potential
molecular functions. A NopM-GFP fusion localized to the yeast nucleus 3 h after
induction however the fusion protein was too unstable to be used in further experiments.
For example it would have been ideal to investigate potential nuclear localisation signals
using yeast. Perhaps the use of yeast mutants lacking certain protease would improve the
stability of the NopM-GFP fusion. Immunofluorescence experiments could be performed
to verify the nuclear location of NopM, but are probably too time consuming to screen for
possible NLS. Unlike their Yersinia homologues, neither NopJ nor NopT were toxic to
yeast cells. NopT however was shown to be capable of cleaving itself after expression in
yeast cell, which was verified as the NopT point mutant C93S lost this enzymatic activity.
Perhaps the most useful result to come from the yeast expression assays was that NopL
was extremely toxic for yeast growth. A phenotype that will permit the use of yeast in
functional screens for the domains/residues of NopL responsible for this toxicity and
possibly even the yeast processes effected.
Attempts to express Nops in Arabidopsis were unsuccessful (data not shown), the
reasons for this are unclear but presumably the action of the Nops was detrimental to
plant viability. Preliminary experiments were performed to establish a root
transformation system in legume hosts of NGR234. Several A. rhizogenes strains were
tested for their ability to infect L. purpureus and then for their ability to co-transfer DNA
from a binary vector. For L. purpureus, A. rhizogenes K599 and A4RSII strains showed
high transformation frequency. An initial attempt to express a NopM-GFP fusion in L.
purpureus roots was unsuccessful and significant experimental work remains to establish
such an experimental model.
105
Chapter 5: Perspectives
Rhizobium sp. NGR234 establishes a symbiotic interaction with many legume
plants. The primary signal molecules produced by NGR234 have been extensively
studied. A notable feature is the great variety of Nod factor (NF) structures produced and
also the quantity secreted (Broughton et al., 2000). It is apparent though that NFs are not
the only signal molecules and NGR234 also produces a variety of so called secondary
signaling factors, which although not universally essential, are critical for certain
NGR234-host interactions. The work in this thesis details the further characterization of
one of these secondary signals, the T3SS.
Prior to this work it was already known that the T3SS was regulated within the
flavonoid inducible cascade of NGR234 (Kobayashi et al., 2004). My preliminary
projects contributed to the understanding of the TtsI-mediated induction of genes
preceded by tts-boxes, by complementing the NGR∆ttsI mutation (Wassem et al., 2008).
The symbiotic regulatory cascade which is trigged by plant produced flavonoids is
intricate and numerous factors participate including several transcriptional regulators to
control the coordinated synthesis of (at least) Nod-factors, polysaccharides as well as the
T3SS. Approximately half of my studies concerned other potential regulatory influences
on the flavonoid-induced cascade. Particularly the effects of the NodV (sensor) and
NodW (regulator) two-component system that in other rhizobia are key players in the
perception and response to flavonoids. In B. japonicum these regulators are thought to
perceive certain classes of flavonoids and are critical for the nodulation of certain
legumes (Göttfert et al., 1990). Of direct relevance to my work was the essential role of
NodVW in the regulation of the T3SS of B. japonicum potentially by activating ttsI
(Krause et al., 2002). Homologues of nodVW had been identified on the megaplasmid of
NGR234 (Streit et al., 2004) and in this work these were mutated and the effects on the
T3SS and other TB-controlled genes was assessed. There was no obvious effect on either
Nop secretion or the production of rhamnose-rich LPS after mutation of nodVW from
NGR234 and thus they do not have the same function as NodVW from B. japonicum.
Experiments testing NB- and TB-reporter gene fusions in the nodVW mutant, showed that
in some conditions there was a reduction in (flavonoid) induction. Although, as discussed
106
in chapter 2, this was more likely caused by a general effect of NodVW on key symbiosis
regulators, such as NodD1, SyrM2 and NodD2, as it seems there was an early effect of
NodVW on these main regulators. For this reason, attempts to follow the expression of
NB and TB controlled genes was extremely complicated using reporter genes, and other
methods are required to clarify some of these results. In particular to see if NodW binds
to any of the promoters of the other transcriptional activators, expanding on work already
described in chapter 2. Further studies will hopefully determine whether the NodW binds
to the promoters of nodD1, nodD2 and/or syrM1 using EMSA. From these results it
should be possible to see at what point in the regulatory cascade NodVW act.
It was not possible to define the exact biological role of NodVW in NGR234. A
striking observation was the dramatic increase in nodD1 and syrM2 expression in the
absence of flavonoids in the nodVW mutant. As discussed earlier, NodV & NodW are
members of the two-component sensor-regulator family of proteins. NodV shares
homology with sensor proteins. In typical two-component systems, the sensor histidine
protein kinase monitors external stimuli and transmits this information to the response
regulator protein by a phosphorylation step (Pan et al., 1993; Surette et al., 1996). As
flavonoids are the signaling molecules that trigger symbiosis between legumes and
rhizobia, does NodV detect flavonoids, as suspected in B. japonicum? The effects of
NodVW were observed on the nodD1 promoter and NB19 even without the addition of
flavonoids. On the other hand, the expression pattern of pnodD2 did not follow the NB19
expression profile as increased amounts of (NB19-controlled) SyrM2 should up-regulate
nodD2 after flavonoid induction. From these data and other conflicting expression
patterns, I hypothesised that NodV could possibly sense the concentration of flavonoids
in the environment. By monitoring when flavonoid concentrations are sub-optimal it
would activate NodW to bind to key regulatory promoters to suppress their expression
and thus prevent the production of NFs or other signalling molecules when NGR234 is
not in close proximity to the plant root. The NodVW system must have some role in the
repression of the nodD1 and syrM2 promoters, as their expression is increased in the
nodVW mutant background. NGR234 could thus have adapted the NodVW flavonoid
sensing system to prevent wasteful production of symbiotic signaling molecules. Other
107
sensing systems could override the NodVW repression system as flavonoid
concentrations increase to symbiotically proficient levels. Experiments should be
performed measuring the expression of various reporter genes at sub-optimal flavonoid
inducing conditions, especially in a nodVW mutant background.
An interesting consequence of my attempts to identify gene regulated specifically
by NodVW led to my involvement in a project to set-up a high-throughput reporter gene
system in NGR234. As detailed in chapter 2, NB- and TB-containing promoters were
fused upstream of the GFP reporter gene allowing gene expression levels to be measured
in vivo without extensive manipulative steps. The direct measurement of GFP expression
in cells, permits reporter assays to be performed in 96-well microplate format and thus
allows a greater number of possible promoters or mutant backgrounds to be assayed at
the same time. It was not clear whether the growth of NGR234 derivatives would be
affected in the smaller volumes present in the 96-well plates, thus as part of my
experiments to measure the expression of key promoters in the nodVW mutant, I
compared the relative expression levels with the β-galactosidase reporter system used
extensively in this laboratory. As described in chapter 2, generally expression levels
monitored using the two reporter systems generally followed the same trends both
temporally and in different mutant backgrounds and thus the high-throughput assay
system seems robust enough to study expression of NGR234 genes (Le Quéré et al.,
2008).
The second part of my thesis was concerned with the study of effector proteins
secreted by the T3SS of NGR234. T3SS effector proteins generally alter cell signalling
and thus host responses induced upon infection. However, their precise biochemical
functions are often difficult to define. In the absence of a suitable legume model to study
effector function, other eukaryotic cells were used to try to identify conserved signalling
pathways targeted by the NGR234 effectors. Finally the roles of individual effector
proteins were assessed on legumes previously shown to be responsive to the functionality
of the NGR234 T3SS.
108
I particularly focused on the effector NopM, initially identified from the
sequencing of pNGR234a as y4fR with homology to yopM of Y. pestis (Freiberg et al.,
1997). Using a specific antibody I demonstrated that NopM was secreted through the
T3SS and constructed a mutant, which was still capable of secreting other Nops, and thus
confirmed that NopM was a candidate NGR234 effector protein. During my study, the
exact function of this family of effectors was not known although many had been shown
to localize in the nuclei of mammalian cells, which was something I also tried to show for
NopM (see below). Recently however, a homologue of NopM has been shown to be an
ubiquitin ligase (Rohde et al., 2007). Furthermore a cysteine residue, conserved in all the
members of this effector family, was shown to be essential for ubiqutin ligase activity in
vitro. As NopM has a correspondingly conserved Cys residue, to confirm whether NopM
also acts as an ubiquitin ligase, nopM should be point mutated at the bases encoding the
Cys residue. The ability of NopM and the point mutant to add ubiquitin in vitro will be
assayed using yeast cells, as described by Rohde and associates (Rohde et al., 2007). The
point mutant will be checked for its secretion by the T3SS and then its nodulation ability
also tested on L. purpureus comparing with wild-type and nopM deletion mutant, to
determine whether its presumed ubiquitin ligase activity is essential for the positive effect
of NopM in the nodulation of this plant.
Initially I wanted to determine whether NopM is also transported into the nucleus
of legume cells. In the absence of a plant cell culture system to test this, I used an
alternative eukaryotic model system, as yeast cells had shown to be capable of modelling
the roles of effector proteins (Lesser and Miller, 2001). As described in chapter 4, I
developed the use of yeast cells to study NopM localisation and also other NGR234
effectors. NopM was shown to localise in yeast cell nuclei, although degradation of the
NopM-GFP fusion protein complicated visualisation, a yeast strain which has lost some
protease activity (e.g. YPL 154c) will be used to avoid the degradation of fusion protein
or in situ hybridization techniques/immunofluoresence will help. Once NopM
localization in the host nucleus is confirmed, in turn the identification of the host
perception mechanism to transit is an exciting future topic. NopM lacks a classical NLS
and thus how is NopM trafficked to nucleus? It was shown that the first three LRRs and
109
carboxy-terminal end (C-ter) of YopM act as NLSs in yeast (Benabdillah et al., 2004).
Constructing multiple NopM deletion mutants will elucidate which domains or residues
are responsible for the migration of NopM to the nucleus of eukaryotic cells. Yeast cells
are of course only a model system, and the results obtained should also be verified in
legume cells. Attempts were made to development a root transformation protocol for L.
purpureus, but relatively low transformation efficiencies made this impractical. Further
studies could be made to improve Lablab transformation, perhaps by trying different A.
rhizogenes strains or growth conditions. The model plant Arabidopsis was also used but it
was not possible to obtain transformed plants, possibly high levels of nop expression
from the 35S promoter were toxic to the plants. Transgenic plants expressing inducible
nopM could be created and thus the location of NopM now checked intracellularly. An
advantage of using Arabidopsis would be to easily identify plant proteins that bind to
NopM (perhaps to traffic it to the nucleus) by established techniques such as yeast 2-
hybrid assays or immunoprecipitation followed by mass spectrometric identification of
interacting plant proteins.
The yeast eukaryotic model system was also used to test the other NGR234
effectors, although expression of NopJ and NopP in yeast cells had no clear phenotypes,
both NopL and NopT provoked changes to yeast cells that could be used as screens to test
for functional domains/residues of these effectors. As described previously, after NopL is
delivered into plant cells, it most likely modulates the activity of signal transduction
pathways that culminate in activation of PR proteins (Bartsev et al., 2004). Expression of
NopL within yeast cells led to a severe growth inhibition. Initially sections of NopL
could be deleted and then these expressed in yeast to see if a particular domain of NopL
is responsible for its apparent toxicity. Assuming that the phosphorylation of NopL is
essential for its ability to disrupt plant kinases, it is possible that this function of NopL
also causes the yeast growth inhibition. Thus by using error-prone PCR, point mutations
in nopL could be generated, then this population could be cloned into a yeast expression
vector, transformed into yeast and then expression induced. Yeast colonies capable of
growth will most likely contain nopL mis-sense mutations or premature stop codons,
which can easily be identified by sequencing. It is also possible that the residues normally
110
phosphorylated could have been mutated preventing phosphorylation, and thus the
disruption to signaling pathways. These candidate mutants could be tested for their
phosphorylation in vitro, and if this is absent then on the legumes F. congesta and T.
vogelii to assess their symbiotic proficiency. In the case of NopT, the presence of key
residues was already suspected from comparison to AvrPphB. The AvrPphB protein from
Pseudomonas syringae was demonstrated to be targeted to the host plasma membrane
after cleaving itself. The cleavage event exposes a myristoylation sites, which after
modification by plant proteins is responsible for the membrane location (Nimchuk et al.,
2000). Expression of a NopT-GFP fusion within yeast cells led to the visualization of
smaller that expected products indicative of a possible auto-proteolytic event (data not
shown). Subsequent experiments expressing only NopT and a NopT point mutation in a
residue critical for its protease activity showed that this autoproteolytic cleavage could
occur (as shown in chapter 4). Further experiments could purify the processed form of
NopT to identify the cleavage site.
Finally in NGR234, the demonstration that NopM is an effector protein brings the
total to five effector proteins which have been identified. Our present hypothesis is that
these are the only effector proteins encoded on pNGR234a, based upon homology
searches and the presence of tts-boxes. Although the T3SS of NGR234 has been shown
to be an important factor in the nodulation of several legumes, the role of individual
effector proteins has not been determined on all these legumes. Thus in chapter 3 when
the symbiotic effects of NopM were being tested, the other four effector mutants were
also included. As described earlier it seems that when the T3SS has a positive effect on
the nodulation of, it actually appears that there is a varied response to the individual
effectors. Some of the effectors appear to be important for nodulation, whilst others are
negative-acting or with little clear role. Thus in this situation the phenotype of the T3SS
appears to be an equilibrium in the action of the individual effector proteins, and is also
indicative that (at least) all five effectors are translocated into the target plant cells. The
situation appears to be different on plants that respond negatively to the T3SS, for
example in the case of C. juncea one of the effectors (NopT) appears to be recognised as
very strongly negative, whereas the other effectors have little phenotype individually,
111
although when double mutants were created in a nopT mutant background, subtle positive
effects of the other effectors (e.g. NopP) were seen (K. Kambara and W. Deakin,
unpublished). It is also tempting to speculate, based upon its strong negative phenotype
and homology to Avr proteins of phytopathogens, that NopT is recognised by a resistance
protein of C. juncea that normally protects against pathogen attack. Although it remains
to be determined whether there is an equivalent hypersensitive type response on the roots
of this legume. The effector responsible for the negative effect of the T3SS on P.
tuberosus was not identified, suggesting that genes encoding other effector proteins are
present in the genome of NGR234. The search for these genes remains an open avenue of
research, one possibility is to use a Tn5 transposon (Wilson et al., 1995) to randomly
mutagenesis NGR234 and then inoculate this mutant population onto P. tuberosus and
select plants that are obviously green and thus nodulated. In this way the gene encoding
the negative effector could have been mutated by the transposon, however in practice this
strategy only identified mutants in the T3SS machinery (Skorpil, unpublished). Thus
alternative strategies need to be developed, bioinformatic approaches are often extremely
useful, based upon the premise that a tts-box should precede any genes encoding potential
effector proteins, upon completion of the NGR234 genome searches for tts-boxes will be
made. Candidate genes will be characterised as described in chapter 3, although the
identification of their exact molecular functions will no doubt continue to be an
extremely difficult subject.
112
Reference
Aepfelbacher, M., R. Zumbihl, K. Ruckdeschel, C.A. Jacobi, C. Barz, and J. Heesemann. 1999. The tranquilizing injection of Yersinia proteins: a pathogen's strategy to resist host defense. Biol Chem. 380:795-802.
Akiyama, K., K. Matsuzaki, and H. Hayashi. 2005. Plant sesquiterpenes induce hyphal branching in arbuscular mycorrhizal fungi. Nature. 435:824-7.
Albrecht, C., R. Geurts, and T. Bisseling. 1999. Legume nodulation and mycorrhizae formation; two extremes in host specificity meet. EMBO J. 18:281-8.
Amor, B.B., S.L. Shaw, G.E. Oldroyd, F. Maillet, R.V. Penmetsa, D. Cook, S.R. Long, J. Denarie, and C. Gough. 2003. The NFP locus of Medicago truncatula controls an early step of Nod factor signal transduction upstream of a rapid calcium flux and root hair deformation. Plant J. 34:495-506.
Ane, J.M., G.B. Kiss, B.K. Riely, R.V. Penmetsa, G.E. Oldroyd, C. Ayax, J. Levy, F. Debelle, J.M. Baek, P. Kalo, C. Rosenberg, B.A. Roe, S.R. Long, J. Denarie, and D.R. Cook. 2004. Medicago truncatula DMI1 required for bacterial and fungal symbioses in legumes. Science. 303:1364-7.
Atkinson, E.M., M.M. Palcic, O. Hindsgaul, and S.R. Long. 1994. Biosynthesis of Rhizobium meliloti lipooligosaccharide Nod factors: NodA is required for an N-acyltransferase activity. Proc Natl Acad Sci U S A. 91:8418-22.
Ausmees, N., H. Kobayashi, W.J. Deakin, C. Marie, H.B. Krishnan, W.J. Broughton, and X. Perret. 2004. Characterization of NopP, a type III secreted effector of Rhizobium sp. strain NGR234. J Bacteriol. 186:4774-80.
Ausubel, F.M., R. Brent, R.E. Kingston, D.D. Moore, J.G. Seidman, J.A. Smith, and K. Struhl. 1991. Current Protocols in Molecular Biology. John Wiley & Sons, Inc, New York.
Barnett, M.J., B.G. Rushing, R.F. Fisher, and S.R. Long. 1996. Transcription start sites for syrM and nodD3 flank an insertion sequence relic in Rhizobium meliloti. J Bacteriol. 178:1782-7.
Barnett, M.J., J.A. Swanson, and S.R. Long. 1998. Multiple genetic controls on Rhizobium meliloti syrA, a regulator of exopolysaccharide abundance. Genetics. 148:19-32.
Bartsev, A.V., N.M. Boukli, W.J. Deakin, C. Staehelin, and W.J. Broughton. 2003. Purification and phosphorylation of the effector protein NopL from Rhizobium sp. NGR234. FEBS Lett. 554:271-4.
Bartsev, A.V., W.J. Deakin, N.M. Boukli, C.B. McAlvin, G. Stacey, P. Malnoe, W.J. Broughton, and C. Staehelin. 2004. NopL, an effector protein of Rhizobium sp. NGR234, thwarts activation of plant defense reactions. Plant Physiol. 134:871-9.
Bateman, A., and M. Bycroft. 2000. The structure of a LysM domain from E. coli membrane-bound lytic murein transglycosylase D (MltD). J Mol Biol. 299:1113-9.
Becker, A., N. Fraysse, and L. Sharypova. 2005. Recent advances in studies on structure and symbiosis-related function of rhizobial K-antigens and lipopolysaccharides. Mol Plant Microbe Interact. 18:899-905.
Bellato, C., H.B. Krishnan, T. Cubo, F. Temprano, and S.G. Pueppke. 1997. The soybean cultivar specificity gene nolX is present, expressed in a nodD-dependent manner, and of symbiotic
113
significance in cultivar-nonspecific strains of Rhizobium (Sinorhizobium) fredii. Microbiology. 143:1381-8.
Benabdillah, R., L.J. Mota, S. Lutzelschwab, E. Demoinet, and G.R. Cornelis. 2004. Identification of a nuclear targeting signal in YopM from Yersinia spp. Microb Pathog. 36:247-61.
Beringer, J.E. 1974. R-factor transfer in Rhizobium leguminosarum. Journal of General Microbiology. 84:188-198.
Bhat, U.R., L.S. Forsberg, and R.W. Carlson. 1994. Structure of lipid A component of Rhizobium leguminosarum bv. phaseoli lipopolysaccharide. Unique nonphosphorylated lipid A containing 2-amino-2-deoxygluconate, galacturonate, and glucosamine. J Biol Chem. 269:14402-10.
Bhat, U.R., H. Mayer, A. Yokota, R.I. Hollingsworth, and R.W. Carlson. 1991. Occurrence of lipid A variants with 27-hydroxyoctacosanoic acid in lipopolysaccharides from members of the family Rhizobiaceae. J Bacteriol. 173:2155-9.
Bongaerts, R.J., I. Hautefort, J.M. Sidebotham, and J.C. Hinton. 2002. Green fluorescent protein as a marker for conditional gene expression in bacterial cells. Methods Enzymol. 358:43-66.
Borisov, A.Y., L.H. Madsen, V.E. Tsyganov, Y. Umehara, V.A. Voroshilova, A.O. Batagov, N. Sandal, A. Mortensen, L. Schauser, N. Ellis, I.A. Tikhonovich, and J. Stougaard. 2003. The Sym35 gene required for root nodule development in pea is an ortholog of Nin from Lotus japonicus. Plant Physiol. 131:1009-17.
Brevet, J., and J. Tempe. 1988. Homology mapping of T-DNA regions on three Agrobacterium rhizogenes Ri plasmids by electron microscope heteroduplex studies. Plasmid. 19:75-83.
Broughton, W.J., M. Hanin, B. Relić, J. Kopcinska, W. Golinowski, S. Simsek, T. Ojanen-Reuhs, B. Reuhs, C. Marie, H. Kobayashi, B. Bordogna, A. Le Quéré, S. Jabbouri, R. Fellay, X. Perret, and W.J. Deakin. 2006. Flavonoid-inducible modifications to rhamnan O antigens are necessary for Rhizobium sp. strain NGR234-legume symbioses. J Bacteriol. 188:3654-63.
Broughton, W.J., S. Jabbouri, and X. Perret. 2000. Keys to symbiotic harmony. J Bacteriol. 182:5641-52.
Broughton, W.J., C.-H. Wong, A. Lewin, U. Samrey, H. Myint, H. Meyer z. A., D.N. Dowling, and R. Simon. 1986. Identification of Rhizobium plasmid sequences involved in recognition of Psophocarpus, Vigna, and other legumes. Journal of Cell Biology. 102:1173-1182.
Carlson, R.W., F. Garci, D. Noel, and R. Hollingsworth. 1989. The structures of the lipopolysaccharide core components from Rhizobium leguminosarum biovar phaseoli CE3 and two of its symbiotic mutants, CE109 and CE309. Carbohydr Res. 195:101-10.
Carlson, R.W., R.L. Hollingsworth, and F.B. Dazzo. 1988. A core oligosaccharide component from the lipopolysaccharide of Rhizobium trifolii ANU843. Carbohydr Res. 176:127-35.
Carlson, R.W., B.L. Reuhs, L.S. Forsberg, and E.L. Kannenberg. 1999. Rhizobial cell surface carbohydrates: their structures, biosynthesis, and functions In Genetics of Bacterial Polysaccharides. Goldberg, J.B. ed:53– 90.
Catoira, R., C. Galera, F. de Billy, R.V. Penmetsa, E.P. Journet, F. Maillet, C. Rosenberg, D. Cook, C. Gough, and J. Denarie. 2000. Four genes of Medicago truncatula controlling components of a Nod factor transduction pathway. Plant Cell. 12:1647-66.
114
Chen, W.-P., and T.-t. Kuo. 1993. A simple and rapid method for the preparation of Gram-negative bacterial genomic DNA. Nucleic Acids Research. 21:2260.
Cheon, C.I., N.G. Lee, A.B. Siddique, A.K. Bal, and D.P. Verma. 1993. Roles of plant homologs of Rab1p and Rab7p in the biogenesis of the peribacteroid membrane, a subcellular compartment formed de novo during root nodule symbiosis. Embo J. 12:4125-35.
Christie, P.J., and E. Cascales. 2005. Structural and dynamic properties of bacterial type IV secretion systems (review). Mol Membr Biol. 22:51-61.
Corzo, J., R. Perez-Galdona, M. Leon-Barrios, and A.M. Gutierrez-Navarro. 1991. Alcian blue fixation allows silver staining of the isolated polysaccharide component of bacterial lipopolysaccharides in polyacrylamide gels. Electrophoresis. 12:439-441.
Cullimore, J.V., R. Ranjeva, and J.J. Bono. 2001. Perception of lipo-chitooligosaccharidic Nod factors in legumes. Trends Plant Sci. 6:24-30.
Dangl, J.L., and J.D. Jones. 2001. Plant pathogens and integrated defence responses to infection. Nature. 411:826-33.
Deakin, W.J., C. Marie, M.M. Saad, H.B. Krishnan, and W.J. Broughton. 2005. NopA is associated with cell surface appendages produced by the type III secretion system of Rhizobium sp. strain NGR234. Mol Plant Microbe Interact. 18:499-507.
Dénarié, J., F. Debellé, and J.C. Prome. 1996. Rhizobium lipo-chitooligosaccharide nodulation factors: signaling molecules mediating recognition and morphogenesis. Annu Rev Biochem. 65:503-35.
Dénarié, J., F. Debellé, and C. Rosenberg. 1992. Signaling and host range variation in nodulation. Annu Rev Microbiol. 46:497-531.
D'Haeze, W., and M. Holsters. 2002. Nod factor structures, responses, and perception during initiation of nodule development. Glycobiology. 12:79R-105R.
Dockendorff, T.C., A.J. Sharma, and G. Stacey. 1994. Identification and characterization of the nolYZ genes of Bradyrhizobium japonicum. Mol Plant Microbe Interact. 7:173-80.
Downie, J.A. 1998. Functions of rhizobial nodulation genes. In The Rhizobiaceae. H.P. Spaink, A. Kondorosi, and P.J.J. Hooykaas, editors. Kluwer Academic Publishers, Dordrecht. 387-402.
Downie, J.A., and S.A. Walker. 1999. Plant responses to nodulation factors. Curr Opin Plant Biol. 2:483-9.
Ehrhardt, D.W., R. Wais, and S.R. Long. 1996. Calcium spiking in plant root hairs responding to Rhizobium nodulation signals. Cell. 85:673-681.
Endre, G., A. Kereszt, Z. Kevei, S. Mihacea, P. Kalo, and G.B. Kiss. 2002. A receptor kinase gene regulating symbiotic nodule development. Nature. 417:962-6.
Estrada-Navarrete, G., X. Alvarado-Affantranger, J.E. Olivares, C. Diaz-Camino, O. Santana, E. Murillo, G. Guillen, N. Sanchez-Guevara, J. Acosta, C. Quinto, D. Li, P.M. Gresshoff, and F. Sanchez. 2006. Agrobacterium rhizogenes transformation of the Phaseolus spp.: a tool for functional genomics. Mol Plant Microbe Interact. 19:1385-93.
Fan, H.Y., K.K. Cheng, and H.L. Klein. 1996. Mutations in the RNA polymerase II transcription machinery suppress the hyperrecombination mutant hpr1 delta of Saccharomyces cerevisiae. Genetics. 142:749-59.
115
Fellay, R., J. Frey, and H. Krisch. 1987. Interposon mutagenesis of soil and water bacteria: a family of DNA fragments designed for in vitro insertional mutagenesis of Gram-negative bacteria. Gene. 52:147-154.
Fellay, R., M. Hanin, G. Montorzi, J. Frey, C. Freiberg, W. Golinowski, C. Staehelin, W.J. Broughton, and S. Jabbouri. 1998. nodD2 of Rhizobium sp. NGR234 is involved in the repression of the nodABC operon. Mol Microbiol. 27:1039-50.
Fellay, R., X. Perret, V. Viprey, W.J. Broughton, and S. Brenner. 1995. Organization of host-inducible transcripts on the symbiotic plasmid of Rhizobium sp. NGR234. Molecular Microbiology. 16:657-667.
Feng, J., Q. Li, H.L. Hu, X.C. Chen, and G.F. Hong. 2003. Inactivation of the nod box distal half-site allows tetrameric NodD to activate nodA transcription in an inducer-independent manner. Nucleic Acids Res. 31:3143-56.
Figurski, D.H., and D.R. Helinski. 1979. Replication of an origin-containing derivative of plasmid RK2 dependent on a plasmid function provided in trans. Proceedings of the National Academy of Sciences of the United States of America. 76:1648-1652.
Finan, T.M., A.M. Hirsch, J.A. Leigh, E. Johansen, G.A. Kuldau, S. Deegan, G.C. Walker, and E.R. Signer. 1985. Symbiotic mutants of Rhizobium meliloti that uncouple plant from bacterial differentiation. Cell. 40:869-77.
Fisher, R.F., and S.R. Long. 1989. DNA footprint analysis of the transcriptional activator proteins NodD1 and NodD3 on inducible nod gene promoters. J Bacteriol. 171:5492-502.
Fisher, R.F., and S.R. Long. 1993. Interactions of NodD at the nod Box: NodD binds to two distinct sites on the same face of the helix and induces a bend in the DNA. J Mol Biol. 233:336-48.
Forsberg, L.S., and R.W. Carlson. 1998. The structures of the lipopolysaccharides from Rhizobium etli strains CE358 and CE359. The complete structure of the core region of R. etli lipopolysaccharides. J Biol Chem. 273:2747-57.
Fraysse, N., F. Couderc, and V. Poinsot. 2003. Surface polysaccharide involvement in establishing the rhizobium-legume symbiosis. Eur J Biochem. 270:1365-80.
Fraysse, N., S. Jabbouri, M. Treilhou, F. Couderc, and V. Poinsot. 2002. Symbiotic conditions induce structural modifications of Sinorhizobium sp. NGR234 surface polysaccharides. Glycobiology. 12:741-748.
Freiberg, C., R. Fellay, A. Bairoch, W.J. Broughton, A. Rosenthal, and X. Perret. 1997. Molecular basis of symbiosis between Rhizobium and legumes. Nature. 387:394-401.
Galan, J.E., and A. Collmer. 1999. Type III secretion machines: bacterial devices for protein delivery into host cells. Science. 284:1322-8.
Galibert, F., T.M. Finan, S.R. Long, A. Puhler, P. Abola, F. Ampe, F. Barloy-Hubler, M.J. Barnett, A. Becker, P. Boistard, G. Bothe, M. Boutry, L. Bowser, J. Buhrmester, E. Cadieu, D. Capela, P. Chain, A. Cowie, R.W. Davis, S. Dreano, N.A. Federspiel, R.F. Fisher, S. Gloux, T. Godrie, A. Goffeau, B. Golding, J. Gouzy, M. Gurjal, I. Hernandez-Lucas, A. Hong, L. Huizar, R.W. Hyman, T. Jones, D. Kahn, M.L. Kahn, S. Kalman, D.H. Keating, E. Kiss, C. Komp, V. Lelaure, D. Masuy, C. Palm, M.C. Peck, T.M. Pohl, D. Portetelle, B. Purnelle, U. Ramsperger, R. Surzycki, P. Thebault, M. Vandenbol, F.J. Vorholter, S. Weidner, D.H. Wells, K. Wong, K.C. Yeh, and J.
116
Batut. 2001. The composite genome of the legume symbiont Sinorhizobium meliloti. Science. 293:668-72.
Gao, R., A. Mukhopadhyay, F. Fang, and D.G. Lynn. 2006. Constitutive activation of two-component response regulators: characterization of VirG activation in Agrobacterium tumefaciens. J Bacteriol. 188:5204-11.
Garcia, M., J. Dunlap, J. Loh, and G. Stacey. 1996. Phenotypic characterization and regulation of the nolA gene of Bradyrhizobium japonicum. Mol Plant Microbe Interact. 9:625-36.
Ge, X., C. Dietrich, M. Matsuno, G. Li, H. Berg, and Y. Xia. 2005. An Arabidopsis aspartic protease functions as an anti-cell-death component in reproduction and embryogenesis. EMBO Rep. 6:282-8.
Genre, A., M. Chabaud, T. Timmers, P. Bonfante, and D.G. Barker. 2005. Arbuscular mycorrhizal fungi elicit a novel intracellular apparatus in Medicago truncatula root epidermal cells before infection. Plant Cell. 17:3489-99.
Geremia, R.A., P. Mergaert, D. Geelen, M. Van Montagu, and M. Holsters. 1994. The NodC protein of Azorhizobium caulinodans is an N-acetylglucosaminyltransferase. Proc Natl Acad Sci U S A. 91:2669-73.
Geurts, R., E. Fedorova, and T. Bisseling. 2005. Nod factor signaling genes and their function in the early stages of Rhizobium infection. Curr Opin Plant Biol. 8:346-52.
Geurts, R., R. Heidstra, A.E. Hadri, J.A. Downie, H. Franssen, A. Van Kammen, and T. Bisseling. 1997. Sym2 of Pea Is Involved in a Nodulation Factor-Perception Mechanism That Controls the Infection Process in the Epidermis. Plant Physiol. 115:351-359.
Gianinazzi-Pearson, V. 1996. Plant Cell Responses to Arbuscular Mycorrhizal Fungi: Getting to the Roots of the Symbiosis. Plant Cell. 8:1871-1883.
Gietz, R.D., R.H. Schiestl, A.R. Willems, and R.A. Woods. 1995. Studies on the transformation of intact yeast cells by the LiAc/SS-DNA/PEG procedure. Yeast. 11:355-60.
Giraud, E., L. Moulin, D. Vallenet, V. Barbe, E. Cytryn, J.C. Avarre, M. Jaubert, D. Simon, F. Cartieaux, Y. Prin, G. Bena, L. Hannibal, J. Fardoux, M. Kojadinovic, L. Vuillet, A. Lajus, S. Cruveiller, Z. Rouy, S. Mangenot, B. Segurens, C. Dossat, W.L. Franck, W.S. Chang, E. Saunders, D. Bruce, P. Richardson, P. Normand, B. Dreyfus, D. Pignol, G. Stacey, D. Emerich, A. Vermeglio, C. Medigue, and M. Sadowsky. 2007. Legumes symbioses: absence of nod genes in photosynthetic bradyrhizobia. Science. 316:1307-12.
Gonzalez, J.E., B.L. Reuhs, and G.C. Walker. 1996. Low molecular weight EPS II of Rhizobium meliloti allows nodule invasion in Medicago sativa. Proc Natl Acad Sci U S A. 93:8636-41.
Gonzalez, V., P. Bustos, M.A. Ramirez-Romero, A. Medrano-Soto, H. Salgado, I. Hernandez-Gonzalez, J.C. Hernandez-Celis, V. Quintero, G. Moreno-Hagelsieb, L. Girard, O. Rodriguez, M. Flores, M.A. Cevallos, J. Collado-Vides, D. Romero, and G. Davila. 2003. The mosaic structure of the symbiotic plasmid of Rhizobium etli CFN42 and its relation to other symbiotic genome compartments. Genome Biol. 4:R36.
Göttfert, M., P. Grob, and H. Hennecke. 1990. Proposed regulatory pathway encoded by the nodV and nodW genes, determinants of host specificity in Bradyrhizobium japonicum. Proc Natl Acad Sci U S A. 87:2680-4.
117
Göttfert, M., D. Holzhauser, D. Bani, and H. Hennecke. 1992. Structural and functional analysis of two different nodD genes in Bradyrhizobium japonicum USDA110. Mol Plant Microbe Interact. 5:257-65.
Göttfert, M., S. Rothlisberger, C. Kundig, C. Beck, R. Marty, and H. Hennecke. 2001. Potential symbiosis-specific genes uncovered by sequencing a 410-kilobase DNA region of the Bradyrhizobium japonicum chromosome. J Bacteriol. 183:1405-12.
Graham, J.H., and M. Miller. 2005. Root Physiology: from Gene to Function. 79-100 pp.
Grob, P., P. Michel, H. Hennecke, and M. Göttfert. 1993. A novel response-regulator is able to suppress the nodulation defect of a Bradyrhizobium japonicum nodW mutant. Mol Gen Genet. 241:531-41.
Gudlavalleti, S.K., and L.S. Forsberg. 2003. Structural characterization of the lipid A component of Sinorhizobium sp. NGR234 rough and smooth form lipopolysaccharide. Journal of Biological Chemistry. 278:3957-3968.
Hand, N.J., and T.J. Silhavy. 2000. A practical guide to the construction and use of lac fusions in Escherichia coli. Methods Enzymol. 326:11-35.
Hanin, M., S. Jabbouri, W.J. Broughton, and R. Fellay. 1998. SyrM1 of Rhizobium sp. NGR234 activates transcription of symbiotic loci and controls the level of sulfated Nod factors. Molecular Plant-Microbe Interactions. 11:343-350.
Hansen, G., J. Tempe, and J. Brevet. 1992. A T-DNA transfer stimulator sequence in the vicinity of the right border of pRi8196. Plant Mol Biol. 20:113-22.
Haraga, A., and S.I. Miller. 2003. A Salmonella enterica serovar typhimurium translocated leucine-rich repeat effector protein inhibits NF-kappa B-dependent gene expression. Infect Immun. 71:4052-8.
Harris, J.M., R. Wais, and S.R. Long. 2003. Rhizobium-lnduced calcium spiking in Lotus japonicus. Mol Plant Microbe Interact. 16:335-41.
Harrison, M.J. 1997. The arbuscular mycorrhizal symbiosis: an underground association. Trends Plant Sci. 2:54–60.
Harrison, M.J. 2005. Signaling in the arbuscular mycorrhizal symbiosis. Annu Rev Microbiol. 59:19-42.
He, P., L. Shan, N.C. Lin, G.B. Martin, B. Kemmerling, T. Nurnberger, and J. Sheen. 2006. Specific bacterial suppressors of MAMP signaling upstream of MAPKKK in Arabidopsis innate immunity. Cell. 125:563-75.
Heckman, D.S., D.M. Geiser, B.R. Eidell, R.L. Stauffer, N.L. Kardos, and S.B. Hedges. 2001. Molecular evidence for the early colonization of land by fungi and plants. Science. 293:1129-33.
Heckmann, A.B., F. Lombardo, H. Miwa, J.A. Perry, S. Bunnewell, M. Parniske, T.L. Wang, and J.A. Downie. 2006. Lotus japonicus nodulation requires two GRAS domain regulators, one of which is functionally conserved in a non-legume. Plant Physiol. 142:1739-50.
Hirsch, A.M., M.R. Lum, and J.A. Downie. 2001. What makes the rhizobia-legume symbiosis so special? Plant Physiol. 127:1484-92.
Hitchcock, P.J., and T.M. Brown. 1983. Morphological heterogeneity among Salmonella lipopolysaccharide chemotypes in silver-stained polyacrylamide gels. J Bacteriol. 154:269-77.
118
Honma, M.A., M. Asomaning, and F.M. Ausubel. 1990. Rhizobium meliloti nodD genes mediate host-specific activation of nodABC. J Bacteriol. 172:901-11.
Hood, E.E., S.B. Gelvin, L.S. Melchers, and A. Hoekama. 1993. New Agrobacterium helper plasmid for gene transfer to plants. Transgenic Res. 2:208-218.
Hotson, A., R. Chosed, H. Shu, K. Orth, and M.B. Mudgett. 2003. Xanthomonas type III effector XopD targets SUMO-conjugated proteins in planta. Mol Microbiol. 50:377-89.
Hotson, A., and M.B. Mudgett. 2004. Cysteine proteases in phytopathogenic bacteria: identification of plant targets and activation of innate immunity. Curr Opin Plant Biol. 7:384-90.
Hu, H., S. Liu, Y. Yang, W. Chang, and G. Hong. 2000. In Rhizobium leguminosarum, NodD represses its own transcription by competing with RNA polymerase for binding sites. Nucleic Acids Res. 28:2784-93.
Hubac, C., J. Ferran, D. Guerrier, A. Trémolières, and A. Kondorosi. 1993. Luteolin absorption in Rhizobium meliloti wild-type and mutant strains. Journal of General Microbiology. 139:1571–1578.
Hubber, A., A.C. Vergunst, J.T. Sullivan, P.J. Hooykaas, and C.W. Ronson. 2004. Symbiotic phenotypes and translocated effector proteins of the Mesorhizobium loti strain R7A VirB/D4 type IV secretion system. Mol Microbiol. 54:561-74.
Hubber, A.M., J.T. Sullivan, and C.W. Ronson. 2007. Symbiosis-induced cascade regulation of the Mesorhizobium loti R7A VirB/D4 type IV secretion system. Mol Plant Microbe Interact. 20:255-61.
Hueck, C.J. 1998. Type III protein secretion systems in bacterial pathogens of animals and plants. Microbiol Mol Biol Rev. 62:379-433.
Imaizumi-Anraku, H., N. Takeda, M. Charpentier, J. Perry, H. Miwa, Y. Umehara, H. Kouchi, Y. Murakami, L. Mulder, K. Vickers, J. Pike, J.A. Downie, T. Wang, S. Sato, E. Asamizu, S. Tabata, M. Yoshikawa, Y. Murooka, G.J. Wu, M. Kawaguchi, S. Kawasaki, M. Parniske, and M. Hayashi. 2005. Plastid proteins crucial for symbiotic fungal and bacterial entry into plant roots. Nature. 433:527-31.
Jabbouri, S., R. Fellay, F. Talmont, P. Kamalaprija, U. Burger, B. Relić, J.C. Prome, and W.J. Broughton. 1995. Involvement of nodS in N-methylation and nodU in 6-O-carbamoylation of Rhizobium sp. NGR234 Nod factors. J Biol Chem. 270:22968-73.
Jin, S.G., T. Roitsch, P.J. Christie, and E.W. Nester. 1990. The regulatory VirG protein specifically binds to a cis-acting regulatory sequence involved in transcriptional activation of Agrobacterium tumefaciens virulence genes. J Bacteriol. 172:531-7.
John, M., H. Rohrig, J. Schmidt, U. Wieneke, and J. Schell. 1993. Rhizobium NodB protein involved in nodulation signal synthesis is a chitooligosaccharide deacetylase. Proc Natl Acad Sci U S A. 90:625-9.
Johnson, S. 1991. Structure and function analysis of the CDC4 gene product. In Thesis. University of Washington, Seattle, Washington.
Jouanin, L., J. Tourneur, C. Tourneur, and F. Casse-Delbart. 1986. Restriction maps and homologies of the three plasmids of Agrobacterium rhizogenes strain A4. Plasmid. 16:124-34.
119
Kafetzopoulos, D., G. Thireos, J.N. Vournakis, and V. Bouriotis. 1993. The primary structure of a fungal chitin deacetylase reveals the function for two bacterial gene products. Proc Natl Acad Sci U S A. 90:8005-8.
Kalo, P., C. Gleason, A. Edwards, J. Marsh, R.M. Mitra, S. Hirsch, J. Jakab, S. Sims, S.R. Long, J. Rogers, G.B. Kiss, J.A. Downie, and G.E. Oldroyd. 2005. Nodulation signaling in legumes requires NSP2, a member of the GRAS family of transcriptional regulators. Science. 308:1786-9.
Kambara, K., S. Ardissone, H. Kobayashi, M. Saad, O. Schumpp, W.J. Broughton, and W.J. Deakin. 2008. Rhizobia utilize homologues of pathogenic effector proteins during symbiosis. Molecular Microbiology. Submitted.
Kanamori, N., L.H. Madsen, S. Radutoiu, M. Frantescu, E.M. Quistgaard, H. Miwa, J.A. Downie, E.K. James, H.H. Felle, L.L. Haaning, T.H. Jensen, S. Sato, Y. Nakamura, S. Tabata, N. Sandal, and J. Stougaard. 2006. A nucleoporin is required for induction of Ca2+ spiking in legume nodule development and essential for rhizobial and fungal symbiosis. Proc Natl Acad Sci U S A. 103:359-64.
Kaneko, T., Y. Nakamura, S. Sato, E. Asamizu, T. Kato, S. Sasamato, A. Watanabe, K. Idesawa, and A. Ishikawa. 2000a. Complete genome structure of the nitrogen-fixing symbiotic bacterium Mesorhizobium loti. DNA Research. 7:331-338.
Kaneko, T., Y. Nakamura, S. Sato, E. Asamizu, T. Kato, S. Sasamoto, A. Watanabe, K. Idesawa, A. Ishikawa, K. Kawashima, T. Kimura, Y. Kishida, C. Kiyokawa, M. Kohara, M. Matsumoto, A. Matsuno, Y. Mochizuki, S. Nakayama, N. Nakazaki, S. Shimpo, M. Sugimoto, C. Takeuchi, M. Yamada, and S. Tabata. 2000b. Complete genome structure of the nitrogen-fixing symbiotic bacterium Mesorhizobium loti. DNA Res. 7:331-8.
Kaneko, T., Y. Nakamura, S. Sato, K. Minamisawa, T. Uchiumi, S. Sasamoto, A. Watanabe, K. Idesawa, M. Iriguchi, K. Kawashima, M. Kohara, M. Matsumoto, S. Shimpo, H. Tsuruoka, T. Wada, M. Yamada, and S. Tabata. 2002. Complete genomic sequence of nitrogen-fixing symbiotic bacterium Bradyrhizobium japonicum USDA110. DNA Res. 9:189-97.
Kawaguchi, M., H. Imaizumi-Anraku, H. Koiwa, S. Niwa, A. Ikuta, K. Syono, and S. Akao. 2002. Root, root hair, and symbiotic mutants of the model legume Lotus japonicus. Mol Plant Microbe Interact. 15:17-26.
Keyser, H.H., B.B. Bohlool, T.S. Hu, and D.F. Weber. 1982. Fast-Growing Rhizobia Isolated from Root Nodules of Soybean. Science. 215:1631-1632.
Kistner, C., and M. Parniske. 2002. Evolution of signal transduction in intracellular symbiosis. Trends Plant Sci. 7:511-8.
Kistner, C., T. Winzer, A. Pitzschke, L. Mulder, S. Sato, T. Kaneko, S. Tabata, N. Sandal, J. Stougaard, K.J. Webb, K. Szczyglowski, and M. Parniske. 2005. Seven Lotus japonicus genes required for transcriptional reprogramming of the root during fungal and bacterial symbiosis. Plant Cell. 17:2217-29.
Klose, K.E., D.S. Weiss, and S. Kustu. 1993. Glutamate at the site of phosphorylation of nitrogen-regulatory protein NTRC mimics aspartyl-phosphate and activates the protein. J Mol Biol. 232:67-78.
Kobayashi, H., Y. Naciri-Graven, W.J. Broughton, and X. Perret. 2004. Flavonoids induce temporal shifts in gene-expression of nod-box controlled loci in Rhizobium sp. NGR234. Mol Microbiol. 51:335-47.
120
Kobe, B., and J. Deisenhofer. 1994. The leucine-rich repeat: a versatile binding motif. Trends Biochem Sci. 19:415-21.
Kobe, B., and A.V. Kajava. 2001. The leucine-rich repeat as a protein recognition motif. Curr Opin Struct Biol. 11:725-32.
Krause, A., A. Doerfel, and M. Göttfert. 2002. Mutational and transcriptional analysis of the type III secretion system of Bradyrhizobium japonicum. Mol Plant Microbe Interact. 15:1228-35.
Krishnan, H.B. 2002. NolX of Sinorhizobium fredii USDA257, a type III-secreted protein involved in host range determination, is localized in the infection threads of cowpea (Vigna unguiculata [L.] Walp) and soybean (Glycine max [L.] Merr.) nodules. J Bacteriol. 184:831-9.
Krishnan, H.B., J. Lorio, W.S. Kim, G. Jiang, K.Y. Kim, M. DeBoer, and S.G. Pueppke. 2003. Extracellular proteins involved in soybean cultivar-specific nodulation are associated with pilus-like surface appendages and exported by a type III protein secretion system in Sinorhizobium fredii USDA257. Mol Plant Microbe Interact. 16:617-25.
Lan, C.Y., and M.M. Igo. 1998. Differential expression of the OmpF and OmpC porin proteins in Escherichia coli K-12 depends upon the level of active OmpR. J Bacteriol. 180:171-4.
Le Quéré, A., K. Kambara, M. Crèvecoeur, W.J. Broughton, and W.J. Deakin. 2008. Complementation of major Rhizobium sp. NGR234 infection factors during interaction with legumes. Manuscript in preparation.
Le Quéré, A.J., W.J. Deakin, C. Schmeisser, R.W. Carlson, W.R. Streit, W.J. Broughton, and L.S. Forsberg. 2006. Structural characterization of a K-antigen capsular polysaccharide essential for normal symbiotic infection in Rhizobium sp. NGR234: deletion of the rkpMNO locus prevents synthesis of 5,7-diacetamido-3,5,7,9-tetradeoxy-non-2-ulosonic acid. J Biol Chem. 281:28981-92.
Leigh, J.A., E.R. Signer, and G.C. Walker. 1985. Exopolysaccharide-deficient mutants of Rhizobium meliloti that form ineffective nodules. Proc Natl Acad Sci U S A. 82:6231-5.
Lerouge, P., P. Roche, C. Faucher, F. Maillet, G. Truchet, J.C. Prome, and J. Denarie. 1990. Symbiotic host-specificity of Rhizobium meliloti is determined by a sulphated and acylated glucosamine oligosaccharide signal. Nature. 344:781-4.
Leroux, B., M.F. Yanofsky, S.C. Winans, J.E. Ward, S.F. Ziegler, and E.W. Nester. 1987. Characterization of the virA locus of Agrobacterium tumefaciens: a transcriptional regulator and host range determinant. EMBO J. 6:849-56.
Lesser, C.F., and S.I. Miller. 2001. Expression of microbial virulence proteins in Saccharomyces cerevisiae models mammalian infection. Embo J. 20:1840-9.
Leung, K.Y., B.S. Reisner, and S.C. Straley. 1990. YopM inhibits platelet aggregation and is necessary for virulence of Yersinia pestis in mice. Infect Immun. 58:3262-71.
Levy, J., C. Bres, R. Geurts, B. Chalhoub, O. Kulikova, G. Duc, E.P. Journet, J.M. Ane, E. Lauber, T. Bisseling, J. Denarie, C. Rosenberg, and F. Debelle. 2004. A putative Ca2+ and calmodulin-dependent protein kinase required for bacterial and fungal symbioses. Science. 303:1361-4.
Lewin, A., E. Cervantes, C.-H. Wong, and W.J. Broughton. 1990. nodSU, two new nod genes of the broad host range Rhizobium strain NGR234 encode host-specific nodulation of the tropical tree Leucaena leucocephala. Molecular Plant-Microbe Interactions. 3:317-326.
121
Limpens, E., C. Franken, P. Smit, J. Willemse, T. Bisseling, and R. Geurts. 2003. LysM domain receptor kinases regulating rhizobial Nod factor-induced infection. Science. 302:630-3.
Loh, J., M. Garcia, and G. Stacey. 1997. NodV and NodW, a second flavonoid recognition system regulating nod gene expression in Bradyrhizobium japonicum. J Bacteriol. 179:3013-20.
Long, S.R. 1996. Rhizobium symbiosis: Nod factors in perspective. Plant Cell. 8:1885-98.
Lopez-Lara, I.M., J.D. van den Berg, J.E. Thomas-Oates, J. Glushka, B.J. Lugtenberg, and H.P. Spaink. 1995. Structural identification of the lipo-chitin oligosaccharide nodulation signals of Rhizobium loti. Mol Microbiol. 15:627-38.
Lorio, J.C., W.S. Kim, and H.B. Krishnan. 2004. NopB, a soybean cultivar-specificity protein from Sinorhizobium fredii USDA257, is a type III secreted protein. Mol Plant Microbe Interact. 17:1259-68.
Madsen, E.B., L.H. Madsen, S. Radutoiu, M. Olbryt, M. Rakwalska, K. Szczyglowski, S. Sato, T. Kaneko, S. Tabata, N. Sandal, and J. Stougaard. 2003. A receptor kinase gene of the LysM type is involved in legume perception of rhizobial signals. Nature. 425:637-40.
Maillet, F., F. Debelle, and J. Denarie. 1990. Role of the nodD and syrM genes in the activation of the regulatory gene nodD3, and of the common and host-specific nod genes of Rhizobium meliloti. Mol Microbiol. 4:1975-84.
Maniatis, G.M. 1982. Erythropoiesis: a model for differentiation. Prog Clin Biol Res. 102 pt A:13-24.
Marie, C., W.J. Broughton, and W.J. Deakin. 2001. Rhizobium type III secretion systems: legume charmers or alarmers? Curr Opin Plant Biol. 4:336-42.
Marie, C., W.J. Deakin, T. Ojanen-Reuhs, E. Diallo, B. Reuhs, W.J. Broughton, and X. Perret. 2004. TtsI, a key regulator of Rhizobium species NGR234 is required for type III-dependent protein secretion and synthesis of rhamnose-rich polysaccharides. Mol Plant Microbe Interact. 17:958-66.
Marie, C., W.J. Deakin, V. Viprey, J. Kopcinska, W. Golinowski, H.B. Krishnan, X. Perret, and W.J. Broughton. 2003. Characterization of Nops, nodulation outer proteins, secreted via the type III secretion system of NGR234. Mol Plant Microbe Interact. 16:743-51.
McDonald, C., P.O. Vacratsis, J.B. Bliska, and J.E. Dixon. 2003. The Yersinia virulence factor YopM forms a novel protein complex with two cellular kinases. Journal of Biological Chemistry. 278:18514-18523.
Meinhardt, L.W., H.B. Krishnan, P.A. Balatti, and S.G. Pueppke. 1993. Molecular cloning and characterization of a sym plasmid locus that regulates cultivar-specific nodulation of soybean by Rhizobium fredii USDA257. Mol Microbiol. 9:17-29.
Miao, E.A., C.A. Scherer, R.M. Tsolis, R.A. Kingsley, L.G. Adams, A.J. Baumler, and S.I. Miller. 1999. Salmonella typhimurium leucine-rich repeat proteins are targeted to the SPI1 and SPI2 type III secretion systems. Mol Microbiol. 34:850-64.
Michiels, J., P. De Wilde, and J. Vanderleyden. 1993. Sequence of the Rhizobium leguminosarum biovar phaseoli syrM gene. Nucleic Acids Res. 21:3893.
Miller, J.H. 1972. Assay of β-galactosidase. In Experiments in Molecular Genetics. J.H. Miller, editor. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York. 352-355.
122
Miller, W.G., J.H. Leveau, and S.E. Lindow. 2000. Improved gfp and inaZ broad-host-range promoter-probe vectors. Molecular Plant-Microbe Interactions. 13:1243-1250.
Mitra, R.M., C.A. Gleason, A. Edwards, J. Hadfield, J.A. Downie, G.E. Oldroyd, and S.R. Long. 2004a. A Ca2+/calmodulin-dependent protein kinase required for symbiotic nodule development: Gene identification by transcript-based cloning. Proc Natl Acad Sci U S A. 101:4701-5.
Mitra, R.M., S.L. Shaw, and S.R. Long. 2004b. Six nonnodulating plant mutants defective for Nod factor-induced transcriptional changes associated with the legume-rhizobia symbiosis. Proc Natl Acad Sci U S A. 101:10217-22.
Mittal, R., S.Y. Peak-Chew, and H.T. McMahon. 2006. Acetylation of MEK2 and I kappa B kinase (IKK) activation loop residues by YopJ inhibits signaling. Proc Natl Acad Sci U S A. 103:18574-9.
Miwa, H., J. Sun, G.E. Oldroyd, and J.A. Downie. 2006. Analysis of Nod-factor-induced calcium signaling in root hairs of symbiotically defective mutants of Lotus japonicus. Mol Plant Microbe Interact. 19:914-23.
Moulin, L., A. Munive, B. Dreyfus, and C. Boivin-Masson. 2001. Nodulation of legumes by members of the beta-subclass of Proteobacteria. Nature. 411:948-50.
Mukherjee, S., G. Keitany, Y. Li, Y. Wang, H.L. Ball, E.J. Goldsmith, and K. Orth. 2006. Yersinia YopJ acetylates and inhibits kinase activation by blocking phosphorylation. Science. 312:1211-1214.
Mulder, B., T. Michiels, M. Simonet, M.P. Sory, and G. Cornelis. 1989. Identification of additional virulence determinants on the pYV plasmid of Yersinia enterocolitica W227. Infect Immun. 57:2534-41.
Mulligan, J.T., and S.R. Long. 1989. A family of activator genes regulates expression of Rhizobium meliloti nodulation genes. Genetics. 122:7-18.
Mylona, P., K. Pawlowski, and T. Bisseling. 1995. Symbiotic Nitrogen Fixation. Plant Cell. 7:869-885.
Nimchuk, Z., E. Marois, S. Kjemtrup, R.T. Leister, F. Katagiri, and J.L. Dangl. 2000. Eukaryotic fatty acylation drives plasma membrane targeting and enhances function of several type III effector proteins from Pseudomonas syringae. Cell. 101:353-363.
Noel, K.D., and D.M. Duelli. 2000. Rhizobium lipopolysaccharide and its role in symbiosis . In Prokaryotic Nitrogen Fixation: a Model System for Analysis of Biological Process, Wymondham, UK. 415– 431.
Odum, E.P., and A.E. Smalley. 1959. Comparison of Population Energy Flow of a Herbivorous and a Deposit-Feeding Invertebrate in a Salt Marsh Ecosystem. Proc Natl Acad Sci U S A. 45:617-22.
Oldroyd, G.E., and J.A. Downie. 2004. Calcium, kinases and nodulation signalling in legumes. Nat Rev Mol Cell Biol. 5:566-76.
Oldroyd, G.E., and J.A. Downie. 2006. Nuclear calcium changes at the core of symbiosis signalling. Curr Opin Plant Biol. 9:351-7.
Oldroyd, G.E., M.J. Harrison, and M. Udvardi. 2005. Peace talks and trade deals. Keys to long-term harmony in legume-microbe symbioses. Plant Physiol. 137:1205-10.
Oldroyd, G.E., and S.R. Long. 2003. Identification and characterization of nodulation-signaling pathway 2, a gene of Medicago truncatula involved in Nod factor signaling. Plant Physiol. 131:1027-32.
123
Orth, K. 2002. Function of the Yersinia effector YopJ. Current Opinion in Microbiology. 5:38-43.
Pan, S.Q., T. Charles, S. Jin, Z.L. Wu, and E.W. Nester. 1993. Preformed dimeric state of the sensor protein VirA is involved in plant--Agrobacterium signal transduction. Proc Natl Acad Sci U S A. 90:9939-43.
Parniske, M. 2000. Intracellular accommodation of microbes by plants: a common developmental program for symbiosis and disease? Curr Opin Plant Biol. 3:320-8.
Pazour, G.J., and A. Das. 1990. Characterization of the VirG binding site of Agrobacterium tumefaciens. Nucleic Acids Res. 18:6909-13.
Peck, M.C., R.F. Fisher, and S.R. Long. 2006. Diverse flavonoids stimulate NodD1 binding to nod gene promoters in Sinorhizobium meliloti. J Bacteriol. 188:5417-27.
Perret, X., W.J. Broughton, and S. Brenner. 1991. Canonical ordered cosmid library of the symbiotic plasmid of Rhizobium species NGR234. Proceedings of the National Academy of Sciences of the United States of America. 88:1923-1927.
Perret, X., C. Freiberg, A. Rosenthal, W.J. Broughton, and R. Fellay. 1999. High-resolution transcriptional analysis of the symbiotic plasmid of Rhizobium sp. NGR234. Mol Microbiol. 32:415-25.
Perret, X., C. Staehelin, and W.J. Broughton. 2000. Molecular basis of symbiotic promiscuity. Microbiol Mol Biol Rev. 64:180-201.
Pfaffl, M.W. 2001. A new mathematical model for relative quantification in real-time RT-PCR. Nucleic Acids Res. 29:e45.
Powell, B.S., P.M. Rogowsky, and C.I. Kado. 1989. virG of Agrobacterium tumefaciens plasmid pTiC58 encodes a DNA-binding protein. Mol Microbiol. 3:411-9.
Price, N.P. 1999. Carbohydrate determinants of Rhizobium-legume symbioses. Carbohydr Res. 317:1-9.
Pueppke, S.G., and W.J. Broughton. 1999. Rhizobium sp. strain NGR234 and R. fredii USDA257 share exceptionally broad, nested host ranges. Mol Plant Microbe Interact. 12:293-318.
Puri, N., C. Jenner, M. Bennett, R. Stewart, J.W. Mansfield, N. Lyons, and J. Taylor. 1997. Expression of avrPphB, an avirulence gene from Pseudomonas syringae pv. phaseolicola, and the delivery of signals causing the hypersensitive reaction in bean. Molecular Plant-Microbe Interactions. 10:247-256.
Quandt, J., and M.F. Hynes. 1993. Versatile suicide vectors which allow direct selection for gene replacement in Gram-negative bacteria. Gene. 127:15-21.
Radutoiu, S., L.H. Madsen, E.B. Madsen, H.H. Felle, Y. Umehara, M. Gronlund, S. Sato, Y. Nakamura, S. Tabata, N. Sandal, and J. Stougaard. 2003. Plant recognition of symbiotic bacteria requires two LysM receptor-like kinases. Nature. 425:585-92.
Reddy, P.M., M. Rendón-Anaya, M.d.l.D.S.d. Río, and S. Khandual. 2007. Flavonoids as Signaling Molecules and Regulators of Root Nodule Development. In Global Science Books. Vol. 1, México. 83-94.
Redecker, D., J.B. Morton, and T.D. Bruns. 2000. Ancestral lineages of arbuscular mycorrhizal fungi (Glomales). Mol Phylogenet Evol. 14:276-84.
124
Relić, B., R. Fellay, A. Lewin, X. Perret, N.P.J. Price, P. Rochepeau, and W.J. Broughton. 1993. nod genes and Nod factors of Rhizobium species NGR234. In New Horizons in Nitrogen Fixation. R. Palacios, J. Mora, and W.E. Newton, editors. Kluwer Academic Publishers, Dordrecht, Boston, London. 183-189.
Remy, W., T.N. Taylor, H. Hass, and H. Kerp. 1994. Four hundred-million-year-old vesicular arbuscular mycorrhizae. Proc Natl Acad Sci U S A. 91:11841-3.
Reuhs, B.L., R.W. Carlson, and J.S. Kim. 1993. Rhizobium fredii and Rhizobium meliloti produce 3-deoxy-D-manno-2-octulosonic acid-containing polysaccharides that are structurally analogous to group II K antigens (capsular polysaccharides) found in Escherichia coli. J Bacteriol. 175:3570-80.
Reuhs, B.L., D.P. Geller, J.S. Kim, J.E. Fox, V.S. Kolli, and S.G. Pueppke. 1998. Sinorhizobium fredii and Sinorhizobium meliloti produce structurally conserved lipopolysaccharides and strain-specific K antigens. Appl Environ Microbiol. 64:4930-8.
Reuhs, B.L., B. Relić, L.S. Forsberg, C. Marie, T. Ojanen-Reuhs, S.B. Stephens, C.H. Wong, S. Jabbouri, and W.J. Broughton. 2005. Structural characterization of a flavonoid-inducible Pseudomonas aeruginosa A-band-like O antigen of Rhizobium sp. strain NGR234, required for the formation of nitrogen-fixing nodules. J Bacteriol. 187:6479-87.
Roche, P., F. Maillet, C. Plazanet, F. Debelle, M. Ferro, G. Truchet, J.C. Prome, and J. Denarie. 1996. The common nodABC genes of Rhizobium meliloti are host-range determinants. Proc Natl Acad Sci U S A. 93:15305-10.
Roden, J., L. Eardley, A. Hotson, Y. Cao, and M.B. Mudgett. 2004. Characterization of the Xanthomonas AvrXv4 effector, a SUMO protease translocated into plant cells. Molecular Plant-Microbe Interactions. 17:633-643.
Rodrigues, J.A., F.J. Lopez-Baena, F.J. Ollero, J.M. Vinardell, R. Espuny Mdel, R.A. Bellogin, J.E. Ruiz-Sainz, J.R. Thomas, D. Sumpton, J. Ault, and J. Thomas-Oates. 2007. NopM and NopD are rhizobial nodulation outer proteins: identification using LC-MALDI and LC-ESI with a monolithic capillary column. J Proteome Res. 6:1029-37.
Rohde, J.R., A. Breitkreutz, A. Chenal, P.J. Sansonetti, and C. Parsot. 2007. Type III secretion effectors of the IpaH family are E3 ubiquitin ligases. Cell Host Microbe. 1:77-83.
Rohrig, H., J. Schmidt, U. Wieneke, E. Kondorosi, I. Barlier, J. Schell, and M. John. 1994. Biosynthesis of lipooligosaccharide nodulation factors: Rhizobium NodA protein is involved in N-acylation of the chitooligosaccharide backbone. Proc Natl Acad Sci U S A. 91:3122-6.
Ruckdeschel, K., and K. Richter. 2002. Lipopolysaccharide desensitization of macrophages provides protection against Yersinia enterocolitica-induced apoptosis. Infect Immun. 70:5259-64.
Saad, M.M., H. Kobayashi, C. Marie, I.R. Brown, J.W. Mansfield, W.J. Broughton, and W.J. Deakin. 2005. NopB, a type III secreted protein of Rhizobium sp. strain NGR234, is associated with pilus-like surface appendages. J Bacteriol. 187:1173-81.
Sambrook, J., E.F. Fritsch, and T. Maniatis. 1989. Molecular Cloning: A Laboratory Manual, 2nd edn. Cold Spring Harbour Laboratory Press, Cold Spring Harbor, NY.
Sanjuan, J., R.W. Carlson, H.P. Spaink, U.R. Bhat, W.M. Barbour, J. Glushka, and G. Stacey. 1992. A 2-O-methylfucose moiety is present in the lipo-oligosaccharide nodulation signal of Bradyrhizobium japonicum. Proc Natl Acad Sci U S A. 89:8789-93.
125
Sanjuan, J., P. Groß, M. Göttfert, H. Hennnecke, and G. Stacey. 1994. NodW is essential for the full expression of the common nodulation genes in Bradyrhizobium japonicum. Mol. Plant-Microbe Interact. 7:364-369.
Schauser, L., K. Handberg, N. Sandal, J. Stiller, T. Thykjaer, E. Pajuelo, A. Nielsen, and J. Stougaard. 1998. Symbiotic mutants deficient in nodule establishment identified after T-DNA transformation of Lotus japonicus. Mol Gen Genet. 259:414-23.
Schiemann, J., and G. Eisenreich. 1989. Transformation of field bean Vicia faba L. cells: expression of a chimeric gene in cultured hairy roots and root-derived callus. Biochem. Physiol. Pfl. 185:135–140.
Schlaman, H.R., R.J. Okker, and B.J. Lugtenberg. 1992. Regulation of nodulation gene expression by NodD in rhizobia. J Bacteriol. 174:5177-82.
Schneider, A., A. Walker, M. Sagan, G. Duc, N. Ellis, and A. Downie. 2002. Mapping of the nodulation loci sym9 and sym10 of pea ( Pisum sativum L.). Theor Appl Genet. 104:1312-1316.
Schultze, M., B. Quiclet-Sire, E. Kondorosi, H. Virelizer, J.N. Glushka, G. Endre, S.D. Gero, and A. Kondorosi. 1992. Rhizobium meliloti produces a family of sulfated lipooligosaccharides exhibiting different degrees of plant host specificity. Proc Natl Acad Sci U S A. 89:192-6.
Shachar-Hill, Y., P.E. Pfeffer, D. Douds, S.F. Osman, L.W. Doner, and R.G. Ratcliffe. 1995. Partitioning of Intermediary Carbon Metabolism in Vesicular-Arbuscular Mycorrhizal Leek. Plant Physiol. 108:7-15.
Shao, F., C. Golstein, J. Ade, M. Stoutemyer, J.E. Dixon, and R.W. Innes. 2003. Cleavage of Arabidopsis PBS1 by a bacterial type III effector. Science. 301:1230-1233.
Shao, F., P.M. Merrit, Z. Bao, R.W. Innes, and J.E. Dixon. 2002. A Yersinia effector and a Pseudomonas avirulence protein define a family of cysteine proteases functioning in bacterial pathogenesis. Cell. 109:575-588.
Shaw, S.L., and S.R. Long. 2003. Nod factor elicits two separable calcium responses in Medicago truncatula root hair cells. Plant Physiol. 131:976-84.
Skorpil, P., M.M. Saad, N.M. Boukli, H. Kobayashi, F. Ares-Orpel, W.J. Broughton, and W.J. Deakin. 2005. NopP, a phosphorylated effector of Rhizobium sp. strain NGR234, is a major determinant of nodulation of the tropical legumes Flemingia congesta and Tephrosia vogelii. Mol Microbiol. 57:1304-17.
Skrzypek, E., T. Myers-Morales, S.W. Whiteheart, and S.C. Straley. 2003. Application of a Saccharomyces cerevisiae model to study requirements for trafficking of Yersinia pestis YopM in eucaryotic cells. Infect Immun. 71:937-47.
Smit, G., S. Swart, B.J. Lugtenberg, and J.W. Kijne. 1992. Molecular mechanisms of attachment of Rhizobium bacteria to plant roots. Mol Microbiol. 6:2897-903.
Smit, P., J. Raedts, V. Portyanko, F. Debelle, C. Gough, T. Bisseling, and R. Geurts. 2005. NSP1 of the GRAS protein family is essential for rhizobial Nod factor-induced transcription. Science. 308:1789-91.
Smith, S., S. Dickson, and F. Smith. 2001. Nutrient transfer in arbuscular mycorrhizas: How are fungal and plant processes integrated? J Plant Physiol. 28:683–694.
126
Spaink, H.P. 2000. Root nodulation and infection factors produced by rhizobial bacteria. Annu Rev Microbiol. 54:257-88.
Spaink, H.P., R.J.H. Okker, C.A. Wijffelman, E. Pees, and B.J.J. Lugtenberg. 1987. Promoters in the nodulation region of the Rhizobium leguminosarum Sym plasmid pRL1JI. Plant Molecular Biology. 9:27-39.
Spaink, H.P., A.H. Wijfjes, K.M. van der Drift, J. Haverkamp, J.E. Thomas-Oates, and B.J. Lugtenberg. 1994. Structural identification of metabolites produced by the NodB and NodC proteins of Rhizobium leguminosarum. Mol Microbiol. 13:821-31.
Staehelin, C., L.S. Forsberg, W. D'Haeze, M.Y. Gao, R.W. Carlson, Z.P. Xie, B.J. Pellock, K.M. Jones, G.C. Walker, W.R. Streit, and W.J. Broughton. 2006. Exo-oligosaccharides of Rhizobium sp. strain NGR234 are required for symbiosis with various legumes. J Bacteriol. 188:6168-78.
Staskawicz, B.J., M.B. Mudgett, J.L. Dangl, and J.E. Galan. 2001. Common and contrasting themes of plant and animal diseases. Science. 292:2285-9.
Stock, A.M., V.L. Robinson, and P.N. Goudreau. 2000. Two-component signal transduction. Annu Rev Biochem. 69:183-215.
Strack, D., T. Fester, B. Hause, W. Schliemann, and M.H. Walter. 2003. Arbuscular mycorrhiza: biological, chemical, and molecular aspects. J Chem Ecol. 29:1955-79.
Stracke, S., C. Kistner, S. Yoshida, L. Mulder, S. Sato, T. Kaneko, S. Tabata, N. Sandal, J. Stougaard, K. Szczyglowski, and M. Parniske. 2002. A plant receptor-like kinase required for both bacterial and fungal symbiosis. Nature. 417:959-62.
Streit, W.R., R.A. Schmitz, X. Perret, C. Staehelin, W.J. Deakin, C. Raasch, H. Liesegang, and W.J. Broughton. 2004. An evolutionary hot spot: the pNGR234b replicon of Rhizobium sp. strain NGR234. J Bacteriol. 186:535-42.
Sullivan, J.T., J.R. Trzebiatowski, R.W. Cruickshank, J. Gouzy, S.D. Brown, R.M. Elliot, D.J. Fleetwood, N.G. McCallum, U. Rossbach, G.S. Stuart, J.E. Weaver, R.J. Webby, F.J. De Bruijn, and C.W. Ronson. 2002. Comparative sequence analysis of the symbiosis island of Mesorhizobium loti strain R7A. J Bacteriol. 184:3086-95.
Surette, M.G., M. Levit, Y. Liu, G. Lukat, E.G. Ninfa, A. Ninfa, and J.B. Stock. 1996. Dimerization is required for the activity of the protein histidine kinase CheA that mediates signal transduction in bacterial chemotaxis. J Biol Chem. 271:939-45.
Suss, C., J. Hempel, S. Zehner, A. Krause, T. Patschkowski, and M. Göttfert. 2006. Identification of genistein-inducible and type III-secreted proteins of Bradyrhizobium japonicum. J Biotechnol. 126:69-77.
Swanson, J.A., J.T. Mulligan, and S.R. Long. 1993. Regulation of syrM and nodD3 in Rhizobium meliloti. Genetics. 134:435-44.
Szczyglowski, K., P. Kapranov, D. Hamburger, and F.J. de Bruijn. 1998. The Lotus japonicus LjNOD70 nodulin gene encodes a protein with similarities to transporters. Plant Mol Biol. 37:651-61.
Toyotome, T., T. Suzuki, A. Kuwae, T. Nonaka, H. Fukuda, S. Imajoh-Ohmi, T. Toyofuku, M. Hori, and C. Sasakawa. 2001. Shigella protein IpaH9.8 is secreted from bacteria within mammalian cells and transported to the nucleus. Journal of Biological Chemistry. 276:32071-32079.
127
Trinick, M.J. 1980. Relationships amongst the fast-growing rhizobia of Lablab purpureus, Leucaena leucocephala, Mimosa spp., Acacia farnesiana and Sesbania grandiflora and their affinities with other rhizobial groups. Journal of Applied Bacteriology. 49:39-53.
Tsai, C.M., and Frasch, C.E. 1982. A sensitive silver stain for detecting lipopolysaccharides in polyacrylamide gels. Analytical Biochemistry. 119:115-119.
Vancanneyt, G., R. Schmidt, A. O'Connor-Sanchez, L. Willmitzer, and M. Rocha-Sosa. 1990. Construction of an intron-containing marker gene: splicing of the intron in transgenic plants and its use in monitoring early events in Agrobacterium-mediated plant transformation. Mol Gen Genet. 220:245-50.
Viprey, V., A. Del Greco, W. Golinowski, W.J. Broughton, and X. Perret. 1998. Symbiotic implications of type III protein secretion machinery in Rhizobium. Mol Microbiol. 28:1381-9.
Walker, S.A., V. Viprey, and J.A. Downie. 2000. Dissection of nodulation signaling using pea mutants defective for calcium spiking induced by Nod factors and chitin oligomers. Proc Natl Acad Sci U S A. 97:13413-8.
Wang, L.X., Y. Wang, B. Pellock, and G.C. Walker. 1999. Structural characterization of the symbiotically important low-molecular-weight succinoglycan of Sinorhizobium meliloti. J Bacteriol. 181:6788-96.
Wang, S.P., and G. Stacey. 1991. Studies of the Bradyrhizobium japonicum nodD1 promoter: a repeated structure for the nod box. J Bacteriol. 173:3356-65.
Warren, R.F., P.M. Merritt, E. Holub, and R.W. Innes. 1999. Identification of three putative signal transduction genes involved in R gene-specified disease resistance in Arabidopsis. Genetics. 152:401-12.
Wassem, R., H. Kobayashi, K. Kambara, A. Le Quéré, G.C. Walker, W.J. Broughton, and W.J. Deakin. 2008. TtsI regulates symbiotic genes in Rhizobium species NGR234 by binding to tts boxes. Mol Microbiol.
Wilson, K.J., A. Sessitsch, J.C. Corbo, K.E. Giller, A.D. Akkermans, and R.A. Jefferson. 1995. beta-Glucuronidase (GUS) transposons for ecological and genetic studies of rhizobia and other gram-negative bacteria. Microbiology. 141 ( Pt 7):1691-705.
Winans, S.C., P.R. Ebert, S.E. Stachel, M.P. Gordon, and E.W. Nester. 1986. A gene essential for Agrobacterium virulence is homologous to a family of positive regulatory loci. Proc Natl Acad Sci U S A. 83:8278-82.
Xiao, H., S.J. Shen, and J.B. Zhu. 1998. Binding of activator SyrM to the site of nodD3 P1 region of Rhizobium meliloti. science in china series c-life scienves. 41:157-162.
Yeh, K.C., M.C. Peck, and S.R. Long. 2002. Luteolin and GroESL modulate in vitro activity of NodD. J Bacteriol. 184:525-30.
Yoon, S., Z. Liu, Y. Eyobo, and K. Orth. 2003. Yersinia effector YopJ inhibits yeast MAPK signaling pathways by an evolutionarily conserved mechanism. J Biol Chem. 278:2131-5.
Zhu, H., B.K. Riely, N.J. Burns, and J.M. Ane. 2006. Tracing nonlegume orthologs of legume genes required for nodulation and arbuscular mycorrhizal symbioses. Genetics. 172:2491-9.
128
PUBLICATION LIST
Publication in international journal
Wassem, R., Kobayashi, H., Kambara, K ., Le Quéré, A., Walker, G.C., Broughton, W.J. &
Deakin, W.J. (2008) TtsI regulates symbiotic genes in Rhizobium species NGR234 by binding to
tts boxes. Mol. Microbiol. in press.
Publication in conference proceedings
Boukli, N.M., Deakin, W.J., Kambara, K , Kobayashi, H., Marie, C., Perret, X., Le Quere, A.,
Reuhs, B., Saad, M., Schumpp, O., Skorpil, P., Staehelin, C., Streit, W. & Broughton, W.J.
(2005). Rhizobial control of host-specificity. In ¨Biological Nitrogen Fixation, Sustainable
Agriculture and the Environment¨, p. 217-218, Wang, Y.-P., Lin, M., Tian, Z.X., Elmerich, C.,
and Newton, W.E. (Eds.) Springer, Dordrecht, The Netherlands.
Conference presentations
William J. Deakin, Silvia Ardissone, Kumiko Kambara , Patricia Lariguet, Olivier Schumpp,
and William J. Broughton.
The role of Avirulence-like proteins in the Rhizobium-legume symbiosis
17th Swiss Plant Molecular and Cell Biology Conference, 6-8 February, 2008, Les Diablerets,
Switzerland.
William J. Deakin, Silvia Ardissone, Jeremie Gay-Fraret, Kumiko Kambara , Patricia Lariguet,
Antoine le Quéré, Olivier Schumpp, Roseli Wassem and William J. Broughton.
The role of Avirulence-like proteins in the Rhizobium-legume symbiosis
20th North American Symbiotic Nitrogen Fixation Conference, 10-14 July, 2007, Milwaukee,
USA.
W.J. Deakin, S. Ardissone, J. Gay-Fraret, K. Kambara , P. Lariguet, A. le Quéré, O. Schumpp, R.
Wassem & W.J. Broughton.
129
Symbiotic rhizobia use pathogenic-like protein secretion systems to establish an intracellular life
within plant roots
160th Meeting of the Society for General Microbiology, 26-29 March, 2007, Manchester, UK.
W.J. Deakin, S. Ardissone, J. Gay-Fraret, K. Kambara , P. Lariguet, A. le Quéré, O. Schumpp &
W.J. Broughton
Type III protein secretion systems in the Rhizobium-legume symbiosis
66th Annual Assembly of the Swiss Society for Microbiology, 1-2 March 2007, Interlaken,
Switzerland.
W.J. Deakin, S. Ardissone, J. Gay-Fraret, K. Kambara , P. Lariguet, A. le Quéré, O. Schumpp &
W.J. Broughton
The role of type III protein secretion systems in the Rhizobium-legume symbiosis
7th European Nitrogen Fixation Conference, 22-26 July 2006, Aarhus, Denmark.
W.J. Deakin, S. Ardissone, J. Gay-Fraret, K. Kambara , P. Lariguet, A. le Quéré, M. Saad, O.
Schumpp, P. Skorpil & W.J. Broughton
Type III Secretion Systems Affect the Rhizobium-Legume Symbiosis
ASM-FEMS Conference on Protein Traffic in Prokaryotes, 6-11 May, 2006, Crete, Greece.
K. Kambara , M. MacLean, W.J. Broughton & W.J. Deakin
Characterisation of NopM an effector protein secreted by Rhizobium species NGR234
15th Annual meeting of Japanese Society of Plant Microbe Interactions, 10-12 September, 2005,
Kagawa, Japan.
130
Acknowledgements
I would like to express my sincere appreciation to Dr. William J. Dearkin, my supervisor supporting all my study, and also giving me opportunities, providing guidance,
constant support and invaluable kindness.
I would like to express my sincere appreciation to Prof. William J. Broughton, for supporting my study and also giving me opportunities, providing guidance and advices.
My special thanks are expressed to Dr. Morag MacLean for the supporting and giving advices the yeast work.
My special thanks are expressed to Dr. Hajime Kobayashi and Dr. Roseli Wassem for their invaluable kindness aid and helps for this study.
Thanks to all members of LBMPS for their support and sharing great times. Many thanks to Prof. Xavier Perret, Dr. Michele Crevecoeur, Dr. Olivier Schumpp, Dr. Silvia Ardissone, Dr. Antoine Le Quéré, Dr. Patricia Lariguet, Dr. Maged Saad,
Dr. Sonia Guimil and Ms. Nadia Bakkou for their advice and kindness. Special thanks to Mme. Dora Gerber, Mme. Yin Yin Aung, Mme. Florenea Ares,
and Mme. Rosa Pimenta de Abreu for their kindness and help.
Finally, I am grateful to my family and all my friends for their love, understanding and giving me the encouragement.
TtsI regulates symbiotic genes in Rhizobium species NGR234by binding to tts boxes
Roseli Wassem,1,2 Hajime Kobayashi,1,3
Kumiko Kambara,1 Antoine Le Quéré,1
Graham C. Walker,3 William J. Broughton1 andWilliam J. Deakin1*1Laboratoire de Biologie Moléculaire des PlantesSupérieures (LBMPS), Sciences III, 30 QuaiErnest-Ansermet, Université de Genève, CH-1211Geneva 4, Switzerland.2Departamento de Genética, Universidade Federal doParaná, Caixa Postal 19071, CEP 81531–990, Curitiba,PR, Brazil.3Department of Biology, Massachusetts Institute ofTechnology, 77 Massachusetts Avenue, Cambridge,MA 02139, USA.
Summary
Infection of legumes by Rhizobium sp. NGR234 andsubsequent development of nitrogen-fixing nodulesare dependent on the coordinated actions of Nodfactors, proteins secreted by a type III secretionsystem (T3SS) and modifications to surface poly-saccharides. The production of these signal mol-ecules is dependent on plant flavonoids which triggera regulatory cascade controlled by the transcriptionalactivators NodD1, NodD2, SyrM2 and TtsI. TtsI isknown to control the genes responsible for T3SSfunction and synthesis of a symbiotically importantrhamnose-rich lipo-polysaccharide, most probably bybinding to cis elements termed tts boxes. Eleven ttsboxes were identified in the promoter regions oftarget genes on the symbiotic plasmid of NGR234.Expression profiles of lacZ fusions to these tts boxesshowed that they are part of a TtsI-dependent reguloninduced by plant-derived flavonoids. TtsI was purifiedand demonstrated to bind directly to two of thesetts boxes. DNase I footprinting revealed that TtsIoccupied not only the tts box consensus sequence,but also upstream and downstream regions in aconcentration-dependent manner. Highly conservedbases of the consensus tts box were mutated and,
although TtsI binding was still observed in vitro, gfpfusions were no longer transcribed in vivo. Randommutagenesis of a tts box-containing promoterrevealed more nucleotides critical for transcriptionalactivity outside of the consensus.
Introduction
Symbioses between legumes and rhizobia which result inthe formation of nitrogen-fixing root nodules are the resultof a complex signal exchange between both partners.Initially, flavonoids exuded by the plant trigger synthesis ofNod factors (NF) that are secreted from the bacteria andare critical for rhizobial infection (Broughton et al., 2000;Perret et al., 2000). Nevertheless, establishment of func-tional nitrogen-fixing nodules requires other bacterialsignals such as surface polysaccharides and secretedproteins (Fraysse et al., 2003; Broughton et al., 2006;Soto et al., 2006; Jones et al., 2007). Rhizobium sp.NGR234 (hereafter NGR234) is the most promiscuousknown microsymbiont, capable of establishing symbioseswith more than 112 genera of legumes (Pueppke andBroughton, 1999). Its genome is partitioned into threereplicons: the chromosome and two large plasmids,pNGR234a and pNGR234b (Viprey et al., 2000).pNGR234a is also called the symbiotic plasmid as it con-tains all genes necessary for NF synthesis and nitrogenfixation. Sequencing of this 536-kb plasmid showed that italso contains orthologues of a type III protein secretionsystem (T3SS) (Freiberg et al., 1997). Until this discovery,such secretion systems were thought to be characteristicof pathogenic bacteria, where they play important roles inhost infection. T3SS form an apparatus that injects bac-terial proteins directly into eukaryotic cells to disruptnormal functioning of the cell, facilitating infection (Hueck,1998). The T3SS of NGR234 is capable of secreting Nops(nodulation outer proteins), and is an important determi-nant of host range (Viprey et al., 1998).
Production of NF requires flavonoids and the LysR-type regulator NodD1, which binds to conserved motifs(termed nod boxes) found in the promoter regions ofgenes/operons responsible for NF synthesis. Nop secre-tion also requires flavonoids, NodD1 and another regula-tory protein TtsI (Viprey et al., 1998; Marie et al., 2004). Anod box is located in the promoter region of ttsI, and
Accepted 27 February, 2008. *For correspondence. Email [email protected]; Tel. (+41) 22 379 3128; Fax (+41) 22 37913009.
Molecular Microbiology (2008) doi:10.1111/j.1365-2958.2008.06187.x
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd
NodD1 is thought to activate TtsI which in turn initiatestranscription of T3SS genes (Kobayashi et al., 2004). TtsIshares characteristics with the DNA-binding responseregulators of two-component regulatory systems (Vipreyet al., 1998; Marie et al., 2004). Usually, such regulatorsare activated by their partner sensor, histidine proteinkinases, which auto-phosphorylate at a histidine residueupon sensing an environmental signal. The phosphorylgroup is subsequently transferred to an aspartate residuein the response regulator, inducing a conformationalchange that leads to its activation. Once phosphorylated,response regulators act as transcriptional activators bybinding to cis elements in the promoters of genes requiredto process the initial environmental signal. TtsI, however,has a glutamate residue instead of the conservedaspartate. In other bacterial response regulators, such asubstitution leads to constitutive activation, bypassing therequirement for the sensor kinase partner. It is thus pos-sible that TtsI functions as a transcriptional activator inde-pendent of phosphorylation and a sensor kinase partner.Instead, transcription of ttsI and therefore function(s)regulated by TtsI, are modulated by NodD1 in a flavonoid-dependent manner (Kobayashi et al., 2004; Marie et al.,2004).
Sequencing numerous rhizobial genomes has revealedthat T3SS and TtsI control are relatively common. Acomparison of the promoter regions of T3SS genesfrom several rhizobia identified a putative cis-regulatoryelement termed a tts box (TB). TtsI is thought to bind TBand stimulate transcription of downstream genes (Krauseet al., 2002). Using this consensus sequence, 11 putativeTBs (TB1–TB11) were identified on pNGR234a (Marieet al., 2004). Five of the TBs are located upstream ofgenes/operons involved in the assembly of the type IIIsecretion machine; others precede genes encoding pos-sible secreted proteins. TBs are also found in the promot-ers of genes encoding proteins not directly related toT3SS functions (Fig S1). Thus TtsI potentially regulatesmore than the T3SS, and indeed mutation of ttsI leads todifferent symbiotic phenotypes compared to a T3SSmutant alone (Viprey et al., 1998). As well as beingimpaired in protein secretion, the ttsI mutant failed toproduce a rhamnose-rich lipo-polysaccharide (LPS)known to be important for successful nodulation (Marieet al., 2004; Reuhs et al., 2005; Broughton et al., 2006). Aflavonoid-inducible operon encoding enzymes respon-sible for rhamnose synthesis was shown to require TtsI foractivation and to contain a TB in its promoter region.Evidence that the TB is essential for the activity of thisoperon was obtained by deleting a small region containingthe TB which abolished TtsI-mediated induction (Marieet al., 2004).
In this work, we determined whether the promoterregions containing the 11 predicted TB are inducible in a
TtsI- and flavonoid-dependent manner. We then testedif TtsI could physically bind to TB-containing promotersand mapped the actual binding site in vitro by DNaseIfootprinting. We also mutated key residues in the TBconsensus sequence and randomly mutated aTB-containing promoter to identify further importantresidues. It seems likely that the TtsI/TB regulatorysystem is a basic feature of rhizobial T3SS as Brady-rhizobium japonicum USDA110, Mesorhizobium lotiMAFF303099 and Sinorhizobium fredii USDA257 allpossess T3SS, TtsI homologues, as well as predicted TBsequences (Krause et al., 2002; Krishnan et al., 2003;Hubber et al., 2004). Thus our findings are applicable tomultiple genera of rhizobia.
Results
NGRDttsI, a non-polar deletion mutant of ttsI
Polar mutation of ttsI (NGRWttsI ) demonstrated thatTtsI is required for Nop secretion and synthesis of arhamnose-rich polysaccharide, as well as the transcrip-tional activation of two of the 11 TBs, TB2 and TB8.Although introduction of a plasmid-born copy of ttsI intoNGRWttsI allowed complementation of rhamnan synthe-sis, it failed to restore Nop secretion (Viprey et al., 1998;Marie et al., 2004). As ttsI, rhcC2 and y4xK are predictedto form an operon (Perret et al., 2003), the insertion of anW cassette into ttsI most probably blocked transcriptionof these downstream genes. In other bacteria, rhcC2encodes an essential component of the T3SS: its additionin trans (possibly y4xK as well) would thus be required forcomplementation of Nop secretion by NGRWttsI. Addi-tional regulatory controls of T3SS gene expression havebeen shown in some bacteria: if the machinery fails toassemble correctly (because of mutation of a key gene forexample), then expression of genes encoding secretedproteins is suppressed (Wei et al., 2000). It is thus pos-sible that the block in TB expression in NGRWttsI is due tothe absence of RhcC2, causing the T3SS assemblymachine to fail. In this case, TB expression was probablysuppressed by another regulator. For this reason, weconstructed a non-polar deletion mutant of ttsI (NGRDttsI )to maintain transcription of rhcC2 and y4xK from nod box18 and thus avoid this possibility (Fig. 1). To characterizethe new mutant, secreted proteins and surface polysac-charides were isolated from NGRDttsI and NGR234. Nopsecretion and de novo synthesis of rhamnose-rich LPSwere blocked in NGRDttsI (Fig. S2), consistent with ourprevious observations of the polar mutant NGRWttsI(Marie et al., 2004). To complement NGRDttsI, ttsI with itsown promoter region was subcloned into pRG960 (Vanden Eede et al., 1992), giving rise to pttsI-2. Introductionof pttsI-2 into NGRDttsI restored both Nop secretion and
2 R. Wassem et al.
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
production of rhamnose-rich LPS. Thus NGRDttsI doesnot appear to dramatically affect transcription of rhcC2 (ory4xK) and this mutant was used in all subsequent work.
Promoter activities of TB-containing loci
To examine the function of all TBs, we subcloned the11 predicted TBs into pMP220, a broad-host-rangetranscriptional-lacZ reporter system (Spaink et al., 1987),thus creating pMP-TB1 to pMP-TB11 (see Table 1). Toassess the flavonoid and TtsI dependence on transcrip-tion of the TB, tri-parental matings were used to introduceeach of the constructs into NGR234 and NGRDttsI. Liquidcultures were grown to an OD600 of 0.1 in RMS and theflavonoid daidzein added at 2 ¥ 10-7 M. At 1, 6 and 24 hpost induction (hpi), b-galactosidase activities were moni-tored in transconjugants of NGR234 (red bars in Fig. 2)or at 1 and 24 hpi for NGRDttsI transconjugants (pink barsin Fig. 2). In the absence of an inducer, and with theexception of pMP-TB5, only low promoter activitieswere observed with the different constructs (open bars
in Fig. 2), but addition of daidzein caused significantincreases in b-galactosidase activities 24 hpi (Fig. 2).At 24 hpi, TB8, which controls expression of thenopBrhcJnolUVrhcNy4yJrhcQRSTU operon, is the stron-gest promoter (2500 130 Miller units), whereas thelowest activity was recorded with TB11 (157 5 units).Although expression of TB11 appears to be low, it repre-sents a sixfold induction over that found in the NGRDttsImutant (Fig. 2K). By mobilizing the different TB–lacZfusions into the mutant strain NGRDttsI, the role of TtsI inthe activation of each individual TB was assessed. All TBslost flavonoid inducibility in NGRDttsI (Fig. 2). Introductionof pttsI-2 into four randomly selected NGRDttsI (pMP-TB2, TB4, TB8 and TB10) transconjugants restoredflavonoid-dependent induction (closed bars, Fig. S3).
TtsI binds to TB2 and TB8
TtsI contains an N-terminal conserved receiver domainand a C-terminal helix-turn-helix (HTH) domain, bothtypical of response regulators of two-component systems.The HTH domain usually interacts directly with a DNAbinding site present in the promoters of genes controlledby these regulators. Although the HTH structure is highlyconserved, it has the ability to recognize specific bases,and thus discriminate small modifications in a binding site(Stock et al., 2000). TtsI of NGR234 and other rhizobiahas been shown to control the expression of severalgenes containing a TB in the promoter region, but directcontact had never been shown. To further characterize thebinding of TtsI to the TB-containing promoter regions,we cloned the NGR234 ttsI coding sequence into thepETBlue2 vector, then overexpressed and purified a
ttsI rhcC2 y4xK
N PP S
Δ0.5 kb
nopL
A
nod box NB18 Ω
Fig. 1. Physical map of the ttsI locus of pNGR234a. Restrictionsites are as follows: ApaI (A); NheI (N); PstI (P); SacII (S). Locationof the deleted region in NGRDttsI is shown by D and the site of theomega cassette insertion in NGRWttsI shown by W.
Fig. 2. Expression analyses of TBs inpNGR234a. Flavonoid inducibility of TBs inthe wild-type and NGRDttsI backgrounds. A–Lrepresent the levels of b-galactosidase activity(¥ 103 Miller’s units). Activity of the vectorpMP220 devoid of an insert is reported in L.Assays were performed 1, 6 and 24 hpi with2 ¥ 10-7 M daidzein. In the absence of aninducer, basal levels of b-galactosidaseactivity are shown as open bars. Valuesobtained with induced transconjugants arecoded as: NGR234 (red bars); NGRDttsI (pinkbars). The values reported represent themeans of three independent experiments.Error bars are shown on top of each column.Numbers on top of each bar represent therelative increase in activity of induced- ascompared with non-induced cultures.
A B C D
E F G H
I J K L
TtsI-mediated regulation 3
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
Table 1. Bacterial strains and plasmids and primers.
Relevant characteristics Reference
StrainsNGR234 RifR derivative of the isolate NGR234 Lewin et al. (1990)NGRDttsI ttsI deletion mutant of NGR234 RifR This workNGRDrmlB-wbgA Rhamnose synthesis mutant of NGR234, RifR, KmR Marie et al. (2004)
PlasmidspBluescript II KS+ Phage f1, lacZ, ApR StratagenepUC::ttsI pUC18 containing ttsI and its promoter as a 2.4-kb PstI fragment Marie et al. (2004)pJQ200mp18 Suicide vector used in directed mutagenesis, GmR Quandt and Hynes (1993)pJQDttsI As above, but carrying DttsI fragment, subcloned into PstI site, GmR This workpRK2013 Tra+ helper plasmid for mobilisation, KmR Ditta et al. (1980)pRG960 IncQ vector containing promoter-less uidA, SpR Van den Eede et al. (1992)pttsI-2 pRG960 containing ttsI and its promoter as a 2.4 kb PstI fragment This workpMP220 IncP vector containing promoter-less lacZ, TetR Spaink et al. (1987)pMP-TB1 TB1 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB2 Also called pMP220-rmlB; TB2 cloned as a BamHI fragment in pMP220 Marie et al. (2004)pMP-TB3 TB3 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB4 TB4 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB5 TB5 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB6 TB6 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB7 TB7 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB8 Also called pMP220-B; TB8 cloned as a XbaI-PstI fragment in pMP220 Marie et al. (2004)pMP-TB9 TB9 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB10 TB10 cloned in pMP220 as a XbaI-PstI fragment This workpMP-TB11 TB11 cloned in pMP220 as a XbaI-PstI fragment This workpPROBE-GT pVS1/p15a vector, GmR Miller, 2000pPROBE-GT′ As above but with inverted MCS Miller, 2000pGT-nopB TB8 region in pPROBE-GT′ as a HindIII fragment This workpGT-GAATG Site-directed mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A117 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A2D Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A3G Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A518 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A62 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A74 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A812 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-A9BG Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-B312 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-B620 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This workpGT-B1127 Random mutation of TB8 region in pPROBE-GT as an EcoRI fragment This work
PrimersTB1-F 5′-tctcatctctagaccaatcggcg-3′TB1-R 5′-cctgcagcgatattgtctcctcg-3′TB3-F 5′-tctagagccgtcagtcatctttcg-3′TB3-R 5′-tgtcctgcagatcgttgatgagg-3′TB4-F 5′-tctagacgatggcgatgttgctc-3′TB4-R 5′-acgactgcaggccttcaagatgg-3′TB5-F 5′-tgctctagagcaccggaagc-3′TB5-R 5′-tcctgcaggggaaagtagcatc-3′TB6-F 5′-cctctagagcctgtcttttctcg-3′TB6-R 5′-gctgcaggcttgcgtttagtgg-3′TB7-F 5′-tcgtctagacgttgaacggtctac-3′TB7-R 5′-aaggctgcaggccgacattgtg-3′TB9-F 5′-tctctagatggcgtcaaatgctgc-3′TB9-R 5′-ttctgcagccatttgcttgctgg-3′TB10-F 5′-catctagactgagagagcttcacg-3′TB10-R 5′-acctgcagctactcctgccttag-3′TB11-F 5′-cgaatctagacgactttcgatcgc-3′TB11-R 5′-gactctgcagggcgttcgtttccc-3′rmlB-F 5′-aagcaccccgaaaactacct-3′rmlB-R 5′-gcattgcgaaatttggatgga-3′nopB-F 5′-ctcgtcttgataaaccaaatctgaa-3′nopB-R 5′-ggactcgattacttaactctttgac-3′TB8-F mut 5′-ggccggtagaatgcgtgtcgtcagctcgcctc-3′TB8-R mut 5′-ggaggcgagctgacgacacgcattctaccggc-3′
4 R. Wassem et al.
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
His-tagged TtsI protein. High levels of expression wereobtained, but more than 50% of the TtsI-His wasinsoluble, which was also observed with other membersof this family (Kumagai et al., 2006). To test the ability ofTtsI-His to bind to TB sequences, we initially performedelectrophoretic mobility shift assays using a 150-bp regionof the nopB promoter that contains TB8. When increasingamounts of TtsI-His were added to the reaction, slowermigrating bands were observed, consistent with DNA–protein interactions (Fig. 3). The slowest band appearedonly at increasing concentrations of TtsI, which could be aresult of oligomerization of TtsI-His upon binding to DNA,or the presence of more than one TB at different loca-tions in the DNA. Inspection of the sequence did notreveal any other candidate region, suggesting that TtsIforms oligomers upon binding TB8. Addition of up to50 mg ml-1 poly(dI-dC) as heterologous competitor DNAdid not disrupt the DNA–protein complexes, suggestingthat binding of TtsI to TB8 is specific (Fig. S4). This speci-ficity was confirmed using a double-stranded oligo-nucleotide specific to TB8 which disrupted TtsI–nopBpromoter complexes (data not shown). A second double-stranded oligo-nucleotide composed of the adjacentsequence upstream of TB8 (originally designed as acontrol) also disrupted the complexes, however. Thisunexpected effect suggested that the TtsI binding regionextends outside of the TB consensus sequence and, forthis reason, we mapped exactly where TtsI bound to thenopB promoter.
The identification of the precise interaction site ofTtsI with the nopB promoter was determined by DNaseI cleavage protection (footprinting) assays in whichevidence of protein binding is seen as modifications ofthe cleavage pattern that result in both decreases and
increases in the intensity of cleaved fragments. When thepolymerase chain reaction (PCR) fragment containing theTB8 site used in the mobility shift assays described abovewas labelled and used as the probe, it clearly interactedwith TtsI-His as revealed by the presence of protectedand hyperreactive bands in the consensus sequence(Fig. 4A). Increasing concentrations of TtsI produced aclearer pattern of interaction, but did not reveal any newinteraction sites. Furthermore, TtsI caused a modificationto the cleavage pattern of bases located upstream anddownstream of the TB, suggesting that it occupies a broadsection of the target DNA (Fig. 4A). This result is consis-tent with oligomerization of TtsI upon binding to DNA, assuggested by the mobility shift assays. The hyperreactivebands observed are an indication that TtsI induces majordistortions in the bound DNA, exposing these sites toDNase I cleavage.
To test whether such a broad footprint is specific to TB8,a TB2-containing portion of the rmlB promoter region wasalso used as a template in identical experiments. As seenwith TB8, modified bases were also observed within andoutside of the TB, and increasing the quantity of TtsI in thereactions sharpened the footprint (Fig. 4B). Thus TtsI hasa broader than predicted binding site on both promoterregions. Bases modified by TtsI binding in both TBs weremapped (Fig. 4C and D), but it was not possible to detectany trend of base cleavage modification which couldpinpoint bases important for binding outside both TBs.Nevertheless, it is evident from the protection and hyper-reactivity of the highly conserved bases of the TB that theyare clearly involved in direct interaction with TtsI. It shouldbe noted that the modified cleavage pattern induced byTtsI towards the 5′ and 3′ ends of the templates may notnecessarily indicate direct contact of these sequenceswith the protein, but could represent distortion of the DNAcaused by the binding of the activator with the TB.
Site-directed mutagenesis of a TB
Specific point mutations were introduced to three highlyconserved bases of the TB8 consensus sequence (spe-cifically GTCAG to GAATG), and the ability of TtsI to bindand activate transcription was tested in vitro and in vivo.Mobility shift assays showed that TtsI binds in vitro toboth wild-type and mutant TBs at similar concentrations(Fig. 5). The ability of the mutated promoter to activatetranscription of a reporter gene was then tested using thegreen fluorescent protein (GFP) to facilitate reporterassays. First, the non-mutated TB8 promoter was sub-cloned upstream of a promoter-less gfp gene in plasmidpPROBE-GT′ (Miller et al., 2000) and then introduced intoNGR234 as well as NGRDttsI by tri-parental matings.Cultures were induced with flavonoids for 40 h and GFPproduction measured in terms of cellular fluorescence. As
0.1
1 3 50TtsI (μM)
Free probe
TtsI-probe
TtsI-probe
Fig. 3. TtsI binding to the nopB (TB8) promoter. Mobility shiftassay using a 32P-labelled 150-bp PCR fragment containing thenopB promoter region. Purified TtsI-His was added at increasingconcentrations, incubated for 20 min and subject to electrophoresisunder native conditions.
TtsI-mediated regulation 5
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
expected, a strong GFP signal was observed in NGR234containing the TB8–gfp fusion, whereas no expressionwas observed from NGRDttsI (Fig. 6). The mutated TB8promoter was also subcloned upstream of gfp in plasmidpPROBE-GT (Miller et al., 2000). When the activity of thisplasmid was assayed in NGR234 (under the same con-ditions of induction), no GFP signal was observed (Fig. 6).To answer the question of why the mutated TB8 promoterwas inactive in vivo but apparently unaffected in its
binding in vitro led us to test the ability of TtsI to bind to theGAATG TB8 by the more sensitive assay of DNase Ifootprinting. Using the same experimental conditionsdescribed earlier, differences between TB8 and GAATGTB8 were found, especially near the mutated bases, but
Fig. 4. DNase I footprints of TtsI bound tothe nopB (TB8) and rmlB (TB2) promoterregions. 32P-labelled PCR fragments wereincubated with different concentrations of TtsIand digested using limiting concentrations ofDNase I. After purification, DNA fragmentswere separated in a 6% sequencing gel,dried, exposed to Phosphoimager screensand scanned. The TB8- and TB2-containingPCR fragments are shown in A and Brespectively. Numbers on the right refer to theDNA position compared with ATG of thedownstream gene. Brackets indicate the limitsof the TB. Open and closed circles pinpointDNase I protected and hyperreactive bandsrespectively. Below the panels, the DNAsequences show the organization of the nopB(C) and rmlB (D) promoter regions and theirreactivity to DNase I cleavage. Underlinedbases delineate the TBs with the highlyconserved bases in bold font. Capital lettersrepresent DNase I hyperreactive bases anditalics show protected bases. Numbers referto positions upstream of the ATG of thedownstream gene.
1 2 40 0.25
0.5
TB2
TtsI (μM)
- 467
- 331
•
°
•
•
•
°°
°
°
°
°
°•
•
•
•
°°°
TtsI (μM) 0.25
0.5
1 2 40
TB8
- 133
- 8
•
•
•
°
°
°
°
°°
••
•
•
°
°
°
•••
•
•
••
•
•
BA
aatctCccat gcgGTTcaac tcgACtaaCa TcactctTca AtgggcaAgc gacgctgccgtts box (TB8)
gTagtcagcg tgtcgTcagc tcgcctcgCt agagttccAc gTcaaagagt taagtaatcg
C
-133
tts box (TB2)tacccgTcgC ctAtggatgt cctaaaTagg agagttcgTc agctttTcga aagctcagcC
gaaTagcagT gggaaggcCa agaCcgacCa acctacctga attcagaaaT gg
D-467
0.25
0.5
1 2 40 0.25
0.5
1 2 40TtsI (μμM)
mutantWild type
Free probe
TtsI-probe
TtsI-probe
Fig. 5. TtsI binds to the site-directed TB8 mutant. Mobility shiftassays were performed as before, with 32P-labelled 150-bp PCRfragments containing the nopB promoter regions.
0
200
400
600
800
1000
1200
1400
1600
pPROBE/wt pnopB/wt pnopB/ttsI- GAATG/wt
Fig. 6. In vivo expression of the site-directed TB8 mutant. Themutated nopB promoter region was fused to a promoter-less gfpgene and assayed after 40-h induction with 2 ¥ 10-6 M apigenin.Numbers shown (¥ 103) are an average of at least three replicateexperiments. pPROBE/wt, the vector control in NGR234;pnopB/ttsI-, the wild-type nopB promoter in NGRDttsI; pnopB/wt,the wild-type nopB promoter in NGR234; GAATG/wt, thesite-directed mutant nopB promoter in NGR234.
6 R. Wassem et al.
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
also elsewhere in the TB8 consensus (Fig. 7). Thusalthough the GAATG TB8 mutation is clearly insufficient toblock TtsI binding, it alters the nature of the binding whichin turn may well lead to the inability of GAATG TB8 to betranscribed, as observed in vivo.
Random mutagenesis of a TB
As TtsI bound to regions of TB-containing promotersoutside of the TB, we used a random mutagenesisapproach to identify other potential bases important fortranscriptional control by TtsI. Error-prone PCR was per-formed on the nopB promoter, the products cloned into
pGEM-T, and then sequenced. Because of the mutagenicconditions used, several bases were often changed ineach mutant. A number of these PCR products wereselected according to the location of the mutations andsubcloned upstream of the promoter-less gfp gene andmobilized into NGR234. Most of the mutants analysed hadno activity, some had partial activity when induced byapigenin, but none had constitutive activity in the absenceof flavonoid (Fig. 8). Three mutants had no mutationswithin the TB (A62, A117 and A74) and had zero, 6% and18% of the wild-type TB8 activity, suggesting that either theconsensus sequence is longer than predicted (in agree-ment with the large footprint), or the mutated bases alteredbinding of other components of the transcriptional machin-ery. Interestingly, one mutant exhibited higher activitiesthan the wild type upon induction. Attempts to delimit thenopB promoter by footprinting assays using the holoen-zyme Escherichia coli RNA polymerase were not success-ful, possibly as a result of differences in the housekeepingsigma factors of both species. However, the nopB pro-moter region of S. fredii USDA257 is identical to NGR234,and the exact position of the start of transcription wasmapped to a cytidine residue located at the -30 positionfrom the ATG (Kovács et al., 1995). Inspection of theupstream sequence using the proposed consensussequence for rhizobial promoters (MacLellan et al., 2006)allowed the identification of a compatible -10 RNA poly-merase binding site (Fig. 9). Although the -10 sequence isfairly well conserved (four out of six bases), the -35 regiondoes not resemble the consensus, and indeed overlaps thehighly conserved GTCAG bases of the TB. The majority ofinactive mutants had mutations either in the TB or theputative -10 site (Fig. 9). On the other hand, the threemutants that remained active (B1127) or partially active(A2D andA3G) did not have mutations in the TB consensus
TtsI (μM) 0.25
0.5
1 20
TB80.
25
0.5
1 20
***
A B
-113
-8
°
°
°
Fig. 7. DNase I footprint of the site-directed TB8 mutant.32P-labelled PCR fragments (A, wild-type and B, site-directedmutant) were incubated with increasing concentrations of TtsI andthen digested with limiting concentration of DNase I. Afterpurification, DNA fragments were separated in a 6% sequencinggel, dried, exposed to Phosphoimager screens and scanned.Numbers on the right refer to DNA positions compared with ATG ofdownstream genes. Asterisks show the mutated bases; opencircles highlight the differences in DNase I activity observed (ascompared with the wild-type TB8).
0200400600800
100012001400160018002000
pPROBE wt
ttsI-
A1 17
A2 D
A3 G
A5 18
A6 2
A7 4
A8 12
A9BG
B3 12
B6 20
B1127
Fig. 8. In vivo expression levels of the randomly mutated nopBpromoter regions. Mutated nopB promoter regions were fused topromoter-less gfp genes, transferred to NGR234 and NGRDttsI andassayed after 40-h induction with 2 ¥ 10-6 M apigenin. The results(¥ 103) are averages of at least three replicate experiments.pPROBE, vector only in NGR234; wt, the wild-type nopB promoterin NGR234; ttsI-, the wild type nopB promoter in NGRDttsI; thecode names refer to randomly mutated nopB promoters.
TtsI-mediated regulation 7
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
sequence or the putative -10 promoter. Interestingly, theA518 mutant possessed four mutations, none of whichmapped to either of binding sites, but it still exhibited verylow transcriptional activity. This indicates that basesoutside of the TB are important for nopB transcription,presumably by modulating binding of TtsI.
Discussion
Phytopathogenic bacteria use T3SS to facilitate infectionor conversely to trigger plant defences (Mudgett, 2005;Grant et al., 2006). Many different effector proteins can besecreted by such T3SS and they have been cataloguedbased upon homology searches or by assessing the poten-tial for co-regulation with other T3SS genes (Cunnac et al.,2004; Lindeberg et al., 2006). Specific plant compoundsthat induce expression of T3SS genes are not known and,as a consequence, the proteins used as sensors by phy-topathogens have not been identified. Nevertheless, manyplayers in the intermediate stages have been identifiedthrough mutagenesis and two broad classes of gene regu-lation are now recognized (Mole et al., 2006; Tang et al.,2006): in group I (represented by Erwinia spp., Pantoeaspp. and Pseudomonas syringae), the activator is a sigmafactor, termed HrpL which is thought to bind directly to a ciselement (hrp boxes) in promoter regions of T3SS genes. Ingroup II, the direct activators are members of the AraCfamily of transcriptional regulators, called HrpX in Xanth-omonas spp. and HrpB in Ralstonia solanacearum, both ofwhich are proposed to bind to cis elements in the promoterregions of T3SS genes. HrpL andAraC-type transcriptionalactivators are encoded by genes in the T3SS loci.
In contrast, flavonoids trigger induction of T3SS (alongwith other symbiotic genes) in rhizobia (Krause et al.,2002; Krishnan et al., 2003; Kobayashi et al., 2004;Viprey et al., 1998). Members of the NodD/LysR family of
transcriptional regulators act at the top of this cascade,and by binding to nod boxes activate both genes encodingthe synthesis of symbiotic signalling molecules along withother regulatory proteins (Schlaman et al., 1998). Thegene encoding one such regulator, TtsI, is found within theT3SS loci of several rhizobia and in all cases is precededby a nod box. ttsI is the only gene encoding a transcrip-tional regulator in all T3SS loci and, when translated, isproposed to recognize a further cis element, the TB, foundin the promoters of T3SS-related genes. The TtsI/TBregulatory system is found in for all rhizobia possessingT3SS (Krause et al., 2002; Krishnan et al., 2003; Marieet al., 2004). Thus the demonstration that the responseregulator transcriptional activator TtsI binds directly to TBsuggests that the regulation of rhizobial T3SS is differentfrom that found in phyto-pathogens.
TtsI binding is not specific to the TB consensussequence, however, and the DNase I footprint extendedup to 100 bp up- and downstream of the TB. Furthermore,a double-stranded oligonucleotide (located from -111 to-79) paired to sequences adjacent to the TB and com-peted with TtsI binding to the nopB promoter region. Itshould be noted that other members of the responseregulator family of transcriptional activators also demon-strate large footprints despite specific consensussequence predictions (Cullen et al., 1996). It is possiblethat other proteins bind TtsI and, in doing so, increasespecificity of the interaction with TB. Mixing the solubleprotein fraction of cell extracts with TtsI and TB-containingpromoter regions had no effect on binding. Furthermore,TtsI did not bind to promoter regions lacking TB, nor did itbind to its own promoter (containing a nod box – data notshown), demonstrating that TtsI recognizes specific DNAsequences and that auto-regulation is absent.
Site-specific mutation of TB8 blocked promoter activitybut did not abolish TtsI binding. A similar result was
-148......-138......-128......-118......-108......-98.......-88.......-78.......-68.......-58.......-48.......-38.......-28.......-18.......-8|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|....|ATAAACCAAATCTGAAAATCTCCCATGCGGTTCAACTCGACTAACATCACTCTTCAATGGGCAAGCGACGCTGCCGGTAGTCAGCGTGTCGTCAGCTCGCCTCGCTAGAGTTCCACGTCAAAGAGTTAAGTAATCGAGTCC
TB8 ............................................................................GTAGTCAGCGTGTCGTCAGCTCGCCTCGCT...................................
POL .................................................................................Cagcgt.................CTAgAg...............................POL CON .................................................................................CTTGAC.................CTATAT...............................
A117..........................T..G...T....G...T.G.......................G.......C.................................C.....C.............................A2D..............................G........G.........G.......................G...C.T............C..........G..............T............................A3G..........................................................CC...............A..................G..............A.....................................A518.......................C.....................T............................................A........................C..............................A62....................................C...........................................................................G....C.............................A74....................................C........................................G......................................C.....................G........A812................................T...........G.................A.....................A...A...........................C...........G.................A9BG..................................................G..................................................C....C....G..................................B312..................................AC.......A..............C......................................T.C......A...C.A.................................B620.......................C............C................G.......GA...................C.A......G......T...............................................B1127..........................................A.............CC..............G......A........................T........................................GAATG....................................................................................AAT..........................................................
Fig. 9. Positions of the mutated bases in the nopB promoter region. Top line of the DNA sequence shows the wild-type nopB promoter withthe probable transcription start, TB8 underlined. The highly conserved bases of TB8 are also underlined. The putative -35/-10 promoter(labelled as POL) is shown, with bases not matching the consensus sequence (labelled as POL CON) in lower case. Dots representunchanged bases, whereas mutated bases are lettered, code names are indicated at the left. Dotted lines below represent specific mutatednopB promoter regions (labelled with code names), mutated bases are lettered. Numbers refer to positions upstream of the nopB ATG.
8 R. Wassem et al.
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
observed with HrpL of Pantoea agglomerans wheredirect binding was unaffected by mutations of the hrpbox consensus sequence that did not permit transcrip-tion (Nissan et al., 2005). Given that TtsI has a largefootprint, it may well bind to or interact with a relativelylarge stretch of DNA, and thus site-directed mutantswould not be expected to prevent binding. However,application of the more sensitive DNase I cleavage pro-tection assay to promoter regions containing the site-specific mutations revealed subtle differences comparedwith the non-mutated promoter. Modulation of cleavageprotection was observed at the sites of mutation, butalso at a second location in the TB, suggesting that theinteraction between TtsI and the TB is altered and tran-scription thus blocked. It should also be noted that thenature of the mutations may have indirectly affected theability of DNase I to digest the target DNA as this abilityis very dependent on the nature of the sequence(Herrera and Chaires, 1994).
Random mutagenesis of the nopB promoter region iden-tified further bases that are important for TtsI-dependenttranscriptional activity. In one case, transcriptional activitywas higher than wild-type levels, although flavonoids andTtsI were always required. No constitutively active muta-tions were generated. The mutants A117, A518 and A74, inwhich activity was blocked, were particularly revealing asnone of the mutated residues were within the TB consen-sus sequence. As the nopB promoter regions of S. frediiUSDA257 and NGR234 have identical DNA sequence, weused the experimentally proven transcription start ofUSDA257 to identify a putative rhizobial RNA polymerasebinding site. Although the nopB promoter is not highlysimilar to the consensus sequences of S. meliloti (MacLel-lan et al., 2006), the -10 box is a good match, whereas the-35 region is poorly conserved. However the sequenceencompassing the -35 region overlaps with numeroushighly conserved residues of the TB. It is possible that thehigh activity of the nopB promoter may be due to thetransition from a normally inactive state to one in which thechanged conformation upon TtsI binding, exposes thepromoter to RNA polymerase. Indeed, other transcriptionalactivators are known to interact with RNA polymerase andbind to sites located very close to the promoter (Browningand Busby, 2004), some by binding to sites which partiallyoverlap the -35 region of the promoter and interact directlywith the s70 subunit of RNA polymerase (Dhiman andSchleif, 2000; Wickstrum and Egan, 2004). Transcriptionalcontrol of genes by the response regulator PhoB, wherethe conserved -35 hexamer in the RNA polymerasebinding site is absent and replaced by a pho box to whichPhoB binds (Makino et al., 1993), might be a good modelfor the TtsI/TB system. In these promoters, RNA poly-merase is only able to bind in the presence of phosphory-lated PhoB.
Following comparison of promoter regions of T3SSgenes from several rhizobial species, Krause et al. (2002)predicted a consensus TB sequence. Using this sequenceto search the symbiotic plasmid of NGR234, we identified11 TBs, the majority of which are involved in regulatingT3SS functions. Although we had previously demon-strated that TB2 and TB8 are active (Marie et al., 2004), itis now clear that 10 of the 11 known TB loci of pNGR234aare functional flavonoid- and TtsI-dependent promoters.TB3, which is upstream of y4gJ, an open reading frame(ORF) without obvious homologues (but part of a clusterof genes involved in LPS modification, some of which arecontrolled by TB2), is also induced to relatively high levelsin a TtsI-dependent manner. Taken together, these datasuggest that genes downstream of TB3 (e.g. y4gJ whichis involved in modifying LPS) may also have a role insymbiosis.
In NGR234, at least 20 genes are thought to be involvedin T3SS, including those that encode NopA, NopB, NopC,NopL, NopP and NopX (Viprey et al., 1998; Marie et al.,2003; Ausmees et al., 2004; Deakin et al., 2005; Saadet al., 2005). NopA, B and X are associated with pilus-likecell surface appendages, and are therefore thought to be apart of extracellular component of the T3SS machine(Krishnan et al., 2003; Deakin et al., 2005; Saad et al.,2005). NopL and NopP are known effectors, which areprobably injected into the cytoplasm of host cells (Bartsevet al., 2003; 2004; Marie et al., 2003; Ausmees et al.,2004; Skorpil et al., 2005). Generally, genes involved in theformation of the membrane-spanning secretion apparatus,such as nopBrhcJnolUVrhcNy4yJrhcQRSTU (TB8), nopX(TB7) and nopCAy4yQrhcVy4yS (TB10), are under thecontrol of moderate to strong promoters. In contrast, TB6and TB9 that control transcription of two effector proteins(NopL and NopP) are only weakly induced (threefold to12-fold induction as compared with non-induced levels)24 hpi (Fig. 2F and I). Furthermore, the ORFs y4fR (TB1),y4lO (TB4) and y4zC (TB11) are all homologous to knownT3SS effector proteins (Marie et al., 2001) and theirexpression profiles are lower than TB controlling themachinery (sixfold, 13-fold and sixfold respectively). Thatthese promoters are active in a TtsI-dependent mannerand after flavonoid induction suggests that they may wellbe upstream of genes encoding functional effector pro-teins. Generally, promoters upstream of potential effectorproteins have variable expression levels. As an example,the expression profile of pMP-TB5 differs significantly fromthose of other constructs. Although a slight induction (1.2-fold) by daidzein was observed 24 hpi, TB5 had basaltranscriptional activities as high as 3440 190 Miller unitseven under non-induced conditions. As a null mutation inttsI had no affect on its basal activity, TB5 is probably underadditional regulatory control. ORF downstream of TB5 arenot obviously related to T3SS or LPS functions, and seem
TtsI-mediated regulation 9
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
to be involved in stabilization of pNGR234a (Dombrechtet al., 2001).
Use of the TB consensus sequence in a bio-informaticsscreen to identify TtsI-regulated genes on pNGR234a waslargely successful as 10 of the 11 predicted TBs areactive. Indeed, extending such screens to the other rep-licons of NGR234 as well as other rhizobia should befeasible, although the predictions will need to be verifiedon a case-by-case base as the example of TB5 shows.Differences in the TtsI regulon could be specific to T3SSfunction, as rhizobia possess and may well secrete differ-ent effector proteins, which TB-based searches can helpidentify. Alternatively, production of diverse signallingmolecules could also be controlled by TtsI, such as therhamnose-rich LPS synthesized by NGR234 but not by B.japonicum USDA110 or S. fredii USDA257(Marie et al.,2004). Control of rhamnose synthesis is brought about bygenes recruited into the TtsI regulon out of temporalnecessity, as all are induced relatively late, or as afunctional requirement linked to T3SS activity. Over 30predicted TB sequences are present in the B. japonicumUSDA110 genome (Suss et al., 2006). Completion ofmore rhizobial genomes, particularly those with T3SS andTB, will allow ever more powerful comparative studies intothe roles of flavonoid-inducible genes in symbiosis.
Conclusions
We have extended the inventory of members of theflavonoid-regulatory cascade of NGR234 which bringabout the exceptionally broad host range of thisRhizobium. Methods used here to analyse the TtsIregulon of NGR234 are applicable to other TB-possessingrhizobia, although it is very probable that genes modu-lated by TtsI will vary considerably. What remains is to testTB expression levels in planta, as the potential cocktail ofinducing compounds and environments may well revealmore mechanisms of regulatory control.
Experimental procedures
Microbiological techniques
Escherichia coli recombinants were grown at 37°C on Luria–Bertani medium (Sambrook et al., 1989). NGR234 and itsderivatives were raised at 28°C in Rhizobium minimalmedium containing succinate as the carbon source (RMS)(Broughton et al., 1986) or TY (Beringer, 1974). Ampicillin (forBluescript/pGem), gentamycin, kanamycin (for pRK2013),rifampicin, spectinomycin and tetracycline were added atconcentrations of 50, 20, 50, 100, 50 and 15 mg ml-1
respectively. The flavonoids, apigenein or daidzein were usedto induce ttsI, as both have been shown to induce NB18(Viprey et al., 1998; Kobayashi et al., 2004; Marie et al.,2004).
Construction of NGRDttsI and pttsI-2
To obtain a mutant with a deletion in ttsI, the 2.4-kb PstIfragment from pUC::ttsI (Marie et al., 2004), which carriesttsI as well as its flanking region (Fig. 1), was digested withSacII and NheI, purified by electrophoresis, treated with theKlenow fragment, and self-ligated. Then, the remaining0.8-kb PstI fragment, lacking ttsI, was purified and sub-cloned into the PstI site of pJQ200-mp18 (Quandt andHynes, 1993). The resulting plasmid was mobilized intoNGR234 by tri-parental matings using the pRK2013 helperplasmid (Ditta et al., 1980). Marker exchange in NGRDttsIwas confirmed by Southern hybridization. To complementNGRDttsI, ttsI along with its own nod box-containing pro-moter region, the 2.4-kb PstI fragment of pUC::ttsI (Fig. 1),were subcloned into the PstI site of pRG960 (Van den Eedeet al., 1992), a vector which is compatible with pMP220-based lacZ fusion constructs described below, giving rise topttsI-2.
Extraction and analysis of Nops and LPS
After 40-h induction with 10-6 M apigenin, secreted pro-teins and LPS were recovered from the various NGR234strains as described in Viprey et al. (1998) and Marie et al.(2004) respectively. Aliquots of purified proteins were sepa-rated on SDS-polyacrylamide (PAGE) gels and stainedwith silver (Ausubel et al., 1991) or, for immuno-detection,separated proteins were transferred to PVDF Immobilon-Pmembranes (Millipore Corporation, Bedford, Massachusetts,USA) and probed with antibodies against NopL, NopPand NopX. Horseradish peroxidase-labelled goat anti-rabbit immunoglobulin antibodies of the ECL kit (GE Life-sciences Amersham Pharmacia Biotech, Uppsala, Sweden)were used as secondary antibodies. Reactions were visu-alized by enhanced chemi-luminescence. Extracted LPSsamples were separated on 16% deoxycholic acid (DOC)-PAGE and stained with silver nitrate (Tsai and Frasch,1982).
Cloning of the 11 TBs in pMP220
Predicted promoter regions containing TB1, TB3–TB11 wereamplified by PCR using the primer pairs listed in Table 1. Theamplified products were subcloned into pBluescript KS+
(Stratagene, La Jolla, California) and verified by sequencingthe inserts. Then, the inserts were excised and cloned intopMP220. pMP220 constructs containing TB2 (pMP-TB2) andTB8 (pMP-TB8) correspond to plasmids pMP220-rmlBand pMP220B (Marie et al., 2004) respectively. Promoterconstructs cloned into the broad-host-range reporter vectorpMP220 (Spaink et al., 1987) were mobilized into NGR234and its derivatives by tri-parental matings using pRK2013 asthe helper plasmid (Ditta et al., 1980). Flavonoid inductionwas performed as described previously (Kobayashi et al.,2004): rhizobial cultures grown to a density of 1cmOD600
0.5–0.6 were diluted to 1cmOD600 0.1 in RMS medium andinduced with 2 ¥ 10-7 M daidzein or 1 ¥ 10-6 M apigenin.b-Galactosidase activity was assayed according to Miller(1972).
10 R. Wassem et al.
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
DNase I footprinting
DNA fragments were amplified with polynucleotide kinase-end-labelled primers. The rmlB and nopB promoter regionswere amplified with the following primers (respectively):rmlB-F and rmlB-R, and nopB for and nopB rev (Table 1).DNase I footprinting assays were performed in a total volumeof 50 ml of TAP buffer without polyethyleneglycol (50 mMTris-acetate pH 8.0, 100 mM potassium acetate, 8 mM mag-nesium acetate, 27 mM ammonium acetate, 1 mMdithiothreitol). Labelled fragments were added at a final con-centration of approximately 5 nM and incubated with the pro-teins for 30 min at room temperature. After incubation, 0.05 Uof freshly diluted DNase I (Invitrogen, Carlsbad, CA) wasadded, and the reaction was allowed to run for 2 min at roomtemperature. Then, the samples were extracted with phenol,precipitated with ethanol, washed, re-suspended in loadingbuffer and loaded on a 6% DNA sequencing gel. Images wereobtained by a Cyclone imager (Packard Institute, DownersGrove, Illinois) after exposing the dried gel to a Phosphoim-ager screen or by exposing the gels to X-ray film andscanning. Sequence ladders were prepared using the Seque-nase Quick Denature Plasmid DNA Sequencing Kit asdescribed by the manufacturer (USB, Cleveland, Ohio).
Electrophoretic mobility shift assays
32P-labelled PCR fragments were incubated for 30 min inTAP buffer (50 mM Tris-acetate, 100 mM potassium acetate,8 mM magnesium acetate, 3.5% polyethylene glycol 8000,1 mM DTT, pH 7.9) with the indicated concentrations of TtsIand reactions loaded into a 4% native PAGE gel. Runningbuffer contained 50 mM Tris, 400 mM glycine, 2 mM EDTA,8 mM MgSO4 at pH 8.5. Dried gels were exposed to X-rayfilms and images obtained by scanning the film.
Site-directed mutagenesis of TB8
The non-mutated TB8 promoter was excised from pMP-TB8as a HindIII fragment and subcloned upstream of a promoter-less gfp gene in plasmid pPROBE-GT′. Point mutations inTB8 were introduced by PCR using a pair of primers thatreplace the highly conserved triplet TCA for AAT. Two inde-pendent PCR reactions were carried out using primers TB8-Fmut (5′-ggccggtagaatgcgtgtcgtcagctcgcctc-3′) versus nopBrev (5′-ggactcgattacttaactctttgac-3′) and TB8-R mut (5′-ggaggcgagctgacgacacgcattctaccggc-3′) versus nopB for (5′-ctcgtcttgataaaccaaatctgaa-3′). PCR products were pooled,amplified, cloned into pGEM-T (Promega, Madison, Wiscon-sin) and sequenced. The mutated promoters were subse-quently transferred into pPROBE-GT as an EcoRI insert andorientation was checked. The constructs were mobilized intoNGR234 or NGRDttsI as described previously.
Random mutagenesis of TB8
Mutagenesis of the nopB promoter region was accomplishedusing mutagenic PCR as described by Vartanian et al.(1996). PCR reactions contained 1¥ taq buffer, 2.5 mMMgCl2, 0.5 mM MnCl2, 50 mM dATP and dCTP, 1 mM dGTP
and dTTP, 2.5 mM each primer, template DNA and taqpolymerase (Eppendorf). PCR fragments were clonedinto pGEM-T (Promega), sequenced and transferred topPROBE-GT as an EcoRI insert and orientation waschecked.
Assay of GFP intensity
Rhizobial cultures were grown to an OD600 of 0.5, diluted to anOD600 of 0.1 in RMS medium and induced with 1 ¥ 10-6 Mapigenin. Both optical density (OD595) and fluorescence (exci-tation filter at 485 nm and emission filter at 535 nm) weremeasured on 100 ml of cultures 40 hpi using a Plate Chame-leon Multilabel Detection Platform (Hidex Oy, Turku, Finland).Optical densities and fluorescence were corrected to back-ground levels using un-inoculated media, and the resultsrepresent the means of at least three independentexperiments.
Acknowledgements
This work was supported by the Fonds National Suisse dela Recherche Scientifique (Projects 3100AO-104097 and3100A0-116858 to W.J.B. and W.J.D.), the Département del’Instruction Publique du Canton de Genève (to W.J.B. andW.J.D.), the Universitè de Genève (to W.J.B.) and a grantfrom the National Institute of Health (GM31010 to G.C.W.).G.C.W. is also supported by an American Cancer SocietyResearch Professorship and a Howard Hughes Medical Insti-tute Professorship. R.W. was supported by a CAPES post-doctoral fellowship. H.K. is supported by JSPS PostdoctoralFellowships for Research Abroad. We wish to thank Y.-Y.Aung and D. Gerber for their unstinting help, M.M. Saad foruseful discussions on Nop preparation and K.E. Gibson forkind help with LPS preparation.
References
Ausmees, N., Kobayashi, H., Deakin, W.J., Marie, C.,Krishnan, H.B., Broughton, W.J., and Perret, X. (2004)Characeterisation of NopP, a type III secreted effectorof Rhizobium sp. NGR234. J Bacteriol 186: 4774–4780.
Ausubel, F.M., Brent, R., Kingston, R.E., Moore, D.D.,Seidman, J.G., Smith, J.A., and Struhl, K. (eds) (1991)Current Protocols in Molecular Biology. New York: JohnWiley & Sons.
Bartsev, A.V., Boukli, N.M., Deakin, W.J., Staehelin, C., andBroughton, W.J. (2003) Purification and phosphorylation ofthe effector protein NopL from Rhizobium sp. NGR234.FEBS Lett 554: 271–274.
Bartsev, A.V., Deakin, W.J., Boukli, N.M., McAlvin, C.B.,Stacey, G., Malnoë, P., et al. (2004) NopL, an effectorprotein of Rhizobium sp. NGR234 thwarts activation ofplant defence reactions. Plant Physiol 134: 871–879.
Beringer, J.E. (1974) R-factor transfer in Rhizobiumleguminosarum. J Gen Microbiol 84: 188–198.
Broughton, W.J., Wong, C.-H., Lewin, A., Samrey, U., Myint,H., Meyer, z.A.H., et al. (1986) Identification of Rhizobiumplasmid sequences involved in recognition of Psophocar-pus, Vigna, and other legumes. J Cell Biol 102: 1173–1182.
TtsI-mediated regulation 11
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
Broughton, W.J., Jabbouri, S., and Perret, X. (2000) Keys tosymbiotic harmony. J Bacteriol 182: 5641–5652.
Broughton, W.J., Hanin, M., Relic, B., Kopcinska, J., Goli-nowski, W., Simsek, S., et al. (2006) Flavonoid-induciblemodifications to rhamnan O antigens are necessary forRhizobium sp. strain NGR234-legume symbioses.J Bacteriol 188: 3654–3663.
Browning, D.F., and Busby, S.J.W. (2004) The regulation ofbacterial transcription initiation. Nat Rev Microbiol 2: 1–9.
Cullen, P.J., Bowman, W.C., and Kranz, R.G. (1996) In Vitroreconstitution and characterization of the Rhodobactercapsulatus NtrB and NtrC two-component system. J BiolChem 271: 6530–6536.
Cunnac, S., Occhialini, A., Barberis, P., Boucher, C., andGenin, S. (2004) Inventory and functional analysis of thelarge Hrp regulon in Ralstonia solanacearum: identificationof novel effector proteins translocated to plant host cellsthrough the type III secretion system. Mol Microbiol 53:115–128.
Deakin, W.J., Marie, C., Saad, M.M., Krishnan, H.B., andBroughton, W.J. (2005) NopA is associated with cellsurface appendages produced by the type III secretionsystem of Rhizobium sp. strain NGR234. Mol PlantMicrobe Interact 18: 499–507.
Dhiman, A., and Schleif, R. (2000) Recognition of overlap-ping nucleotides by AraC and the sigma subunit of RNApolymerase. J Bacteriol 182: 5076–5081.
Ditta, G., Stanfield, S., Corbin, D., and Helsinki, D.R. (1980)Broad host range DNA cloning system for Gram-negativebacteria: construction of a gene bank of Rhizobium meliloti.Proc Natl Acad Sci USA 77: 7347–7351.
Dombrecht, B., Vanderleyden, J., and Michiels, J. (2001)Stable RK2-derived cloning vectors for the analysis of geneexpression and gene function in Gram-negative bacteria.Mol Plant Microbe Interact 14: 426–430.
Fraysse, N., Couderc, F., and Poinsot, V. (2003) Surfacepolysaccharide involvement in establishing the Rhizobium-legume symbiosis. Eur J Biochem 270: 1365–1380.
Freiberg, C., Fellay, R., Bairoch, A., Broughton, W.J.,Rosenthal, A., and Perret, X. (1997) Molecular basis ofsymbiosis between Rhizobium and legumes. Nature 387:394–401.
Grant, S.R., Fisher, E.J., Chang, J.H., Mole, B.M., and Dangl,J.L. (2006) Subterfuge and manipulation: type III effectorproteins of phytopathogenic bacteria 60: 425–449.
Herrera, J.E., and Chaires, J.B. (1994) Characterization ofpreferred deoxyribonuclease I cleavage sites. J Mol Biol236: 405–411.
Hubber, A., Vergunst, A.C., Sullivan, J.T., Hooykaas, P.J.,and Ronson, C.W. (2004) Symbiotic phenotypes and trans-located effector proteins of the Mesorhizobium loti strainR7A VirB/D4 type IV secretion system. Mol Microbiol 54:561–574.
Hueck, C.J. (1998) Type III protein secretion systems inbacterial pathogens of animals and plants. Microbiol MolBiol Rev 62: 379–433.
Jones, K.M., Kobayashi, H., Davies, B.W., and Walker, G.C.(2007) How rhizobial symbionts invade plants: theSinorhizobium-Medicago model. Nat Rev Microbiol 5: 619–633.
Kobayashi, H., Naciri-Graven, Y., Broughton, W.J., and
Perret, X. (2004) Flavonoids induce temporal shifts ingene-expression of nod-box controlled loci in Rhizobiumsp. NGR234. Mol Microbiol 51: 335–347.
Kovács, L.G., Balatti, P.A., Krishnan, H.B., and Pueppke,S.G. (1995) Transcriptional organization and expressionof nolXWBTUV, a locus that regulates cultivar-specificnodulation of soybean by Rhizobium fredii USDA257. MolMicrobiol 17: 923–933.
Krause, A., Doerfel, A., and Göttfert, M. (2002) Mutationaland transcriptional analysis of the type III secretion systemof Bradyrhizobium japonicum. Mol Plant Microbe Interact15: 1228–1235.
Krishnan, H.B., Lorio, L., Kim, W.S., Jiang, G., Kim, K.Y.,DeBoer, M., and Pueppke, S.G. (2003) Extracellularproteins involved in soybean cultivar-specific nodulationare associated with pilus-like surface appendages andexported by a type III protein secretion system in Sinorhizo-bium fredii USDA257. Mol Plant Microbe Interact 16: 617–625.
Kumagai, Y., Cheng, Z., Lin, M., and Rikihisa, Y. (2006)Biochemical activities of three pairs of Ehrlichia chaffeensistwo-component regulatory system proteins involved ininhibition of lysosomal fusion. Infect Immun 74: 5014–5022.
Lewin, A., Cervantes, E., Wong, C.-H., and Broughton, W.J.(1990) nodSU, two new nod genes of the broad host rangeRhizobium strain NGR234 encode host-specific nodulationof the tropical tree Leucaena leucocephala. Mol PlantMicrobe Interact 3: 317–326.
Lindeberg, M., Cartinhour, S., Myers, C.R., Schechter, L.M.,Schneider, D.J., and Collmer, A. (2006) Closing the circleon the discovery of genes encoding Hrp regulon membersand type III secretion system effectors in the genomes ofthree model Pseudomonas syringae strains. Mol PlantMicrobe Interact 19: 1151–1158.
MacLellan, S.R., MacLean, A.M., and Finan, T.M. (2006)Promoter prediction in the rhizobia. Microbiology 152:1751–1763.
Makino, K., Amemura, M., Kim, S., Nakata, A., and Shina-gawa, H. (1993) Role of the Sigma 70 subunit of RNApolymerase in transcriptional activation by activator proteinPhoB in Escherichia coli. Genes Dev 7: 149–160.
Marie, C., Broughton, W.J., and Deakin, W.J. (2001) Rhizo-bium type III secretion systems: legume charmers oralarmers? Curr Opin Plant Biol 4: 336–342.
Marie, C., Deakin, W.J., Viprey, V., Kopcinska, J., Goli-nowski, W., Krishnan, H.B., et al. (2003) Characterisationof Nops, Nodulation Outer Proteins, secreted via the typeIII secretion system of NGR234. Mol Plant Microbe Interact16: 743–751.
Marie, C., Deakin, W.J., Ojanen-Reuhs, T., Diallo, E., Reuhs,B., Broughton, W.J., and Perret, X. (2004) TtsI, a keyregulator of Rhizobium species NGR234 is required fortype III-dependent protein secretion and synthesis ofrhamnose-rich polysaccharides. Mol Plant Microbe Interact17: 958–966.
Miller, J.H. (1972) Assay of b-galactosidase. In Experimentsin Molecular Genetics. Miller, J.H. (ed.). Cold SpringHarbor, NY: Cold Spring Harbor Laboratory Press, pp.352–355.
Miller, W.G., Leveau, J.H., and Lindow, S.E. (2000) Improved
12 R. Wassem et al.
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology
gfp and inaZ broad-host-range promoter-probe vectors.Mol Plant Microbe Interact 13: 1243–1250.
Mole, B.M., Baltrus, D.A., Dangl, J.L., and Grant, S.R. (2006)Global virulence regulation networks in phytopathogenicbacteria. Trends Microbiol 15: 363–371.
Mudgett, M.B. (2005) New insights to the function of phyto-pathogenic bacterial type III effectors in plants. Annu RevPlant Biol 56: 509–531.
Nissan, G., Manulis, S., Weinthal, D.M., Sessa, G., andBarash, I. (2005) Analysis of promoters recognised byHrpL, an alternative sigma-factor protein from Pantoeaagglomerans pv. gypsophilae. Mol Plant Microbe Interact18: 634–643.
Perret, X., Kobayashi, H., and Collado-Vides, J. (2003) Regu-lation of expression of symbiotic genes in Rhizobium sp.NGR234. Indian J Exp Biol 41: 1101–1113.
Perret, X., Staehelin, C., and Broughton, W.J. (2000) Molecu-lar basis of symbiotic promiscuity. Microbiol Mol Biol Rev64: 180–201.
Pueppke, S.G., and Broughton, W.J. (1999) Rhizobium sp.strain NGR234 and R. fredii USDA257 share exceptionallybroad, nested host-ranges. Mol Plant Microbe Interact 12:293–318.
Quandt, J., and Hynes, M.F. (1993) Versatile suicide vectorswhich allow direct selection for gene replacement in Gram-negative bacteria. Gene 127: 15–21.
Reuhs, B.L., Relic, B., Forsberg, L.S., Marie, C.,Ojanen-Reuhs, T., Stephens, S.B., et al. (2005) Structuralcharacterization of a flavonoid-inducible Pseudomonasaeruginosa A-band-like O antigen of Rhizobium sp. strainNGR234, required for the formation of nitrogen-fixingnodules. J Bacteriol 187: 6479–6487.
Saad, M.M., Kobayashi, H., Marie, C., Brown, I., Mansfield,J.W., Broughton, W.J., and Deakin, W.J. (2005) NopB, atype III secreted protein of Rhizobium sp. strain NGR234,is associated with pilus-like surface appendages.J Bacteriol 187: 1173–1181.
Sambrook, J., Fritsch, E.F., and Maniatis, T. (eds). (1989)Molecular Cloning: A Laboratory Manual, 2nd edn. ColdSpring Harbor, NY: Cold Spring Harbour Laboratory Press.
Schlaman, H.R., Phillips, D.A., and Kondorosi, E. (1998)Genetic organization and transcriptional regulation ofrhizobial nodulation genes. In The Rhizobiaceae. Spaink,H.P., Kondorosi, A., and Hooykaas, P.J.J. (eds). Dor-drecht: Kluwer Academic Press, pp. 361–386.
Skorpil, P., Saad, M.M., Boukli, N.M., Kobayashi, H., Ares-Orpel, F., Broughton, W.J., and Deakin, W.J. (2005) NopP,a phosphorylated effector of Rhizobium sp. strain NGR234,is a major determinant of nodulation of the tropical legumesFlemingia congesta and Tephrosia vogelii. Mol Microbiol57: 1304–1317.
Soto, M.J., Sanjuan, J., and Olivares, J. (2006) Rhizobia andplant-pathogenic bacteria: common infection weapons.Microbiology 152: 3167–3174.
Spaink, H.P., Okker, R.J.H., Wijffelman, C.A., Pees, E., andLugtenberg, B.J.J. (1987) Promoters in the nodulationregion of the Rhizobium leguminosarum Sym plasmidpRL1JI. Plant Mol Biol 9: 27–39.
Stock, A.M., Robinson, V.L., and Goudreau, P.N. (2000)Two-component signal transduction. Annu Rev Biochem69: 183–215.
Suss, C., Hempel, J., Zehner, S., Krause, A., Patschkowski,T., and Göttfert, M. (2006) Identification of genistein-inducible and type III-secreted proteins of Bradyrhizobiumjaponicum. J Biotechnol 126: 69–77.
Tang, X., Xiao, Y., and Zhou, J.-M. (2006) Regulation of thetype III secretion system in phytopathogenic bacteria. MolPlant Microbe Interact 19: 1159–1166.
Tsai, C.M., and Frasch, C.E. (1982) A sensitive silver stain fordetecting lipopolysaccharides in polyacrylamide gels. AnalBiochem 119: 115–119.
Van den Eede, G., Deblaere, R., Goethals, K., van Montagu,M., and Holsters, M. (1992) Broad host range and promoterselection vectors for bacteria that interact with plants. MolPlant Microbe Interact 5: 228–234.
Vartanian, J.P., Henry, M., and Wain-Hobson, S. (1996)Hypermutagenic PCR involving all four transitions and asizeable proportion of transversions. Nucleic Acids Res 24:2627–2631.
Viprey, V., Del Greco, A., Golinowski, W., Broughton, W.J.,and Perret, X. (1998) Symbiotic implications of type IIIprotein secretion machinery in Rhizobium. Mol Microbiol28: 1381–1389.
Viprey, V., Rosenthal, A., Broughton, W.J., and Perret, X.(2000) Genetic snapshots of the Rhizobium speciesNGR234 genome. Genome Biol 1: 1–17.
Wei, W., Plovanich-Jones, A., Deng, W.L., Collmer, A.,Huang, H.C., and He, S.Y. (2000) The structural protein ofthe Hrp pilus is required for coordinate regulation of thetype III secretion system and secretion of Hrp and Avrproteins in Pseudomonas syringae pv. Tomato. Proc NatlAcad Sci USA 97: 2247–2252.
Wickstrum, J.R., and Egan, S.M. (2004) Amino acid contactsbetween sigma 70 domain 4 and the transcription activa-tors RhaS and RhaR. J Bacteriol 186: 6277–6285.
Supplementary material
This material is available as part of the online article from:http://www.blackwell-synergy.com/doi/abs/10.1111/j.1365-2958.2008.06187.x(This link will take you to the article abstract).
Please note: Blackwell Publishing is not responsible for thecontent or functionality of any supplementary materials sup-plied by the authors. Any queries (other than missing mate-rial) should be directed to the corresponding author for thearticle.
TtsI-mediated regulation 13
© 2008 The AuthorsJournal compilation © 2008 Blackwell Publishing Ltd, Molecular Microbiology