+ All Categories
Home > Documents > Sub-floor Preparation and Adhesive Products · wood floor bonding range. ... keying old ceramic...

Sub-floor Preparation and Adhesive Products · wood floor bonding range. ... keying old ceramic...

Date post: 29-Apr-2018
Category:
Upload: dodien
View: 218 times
Download: 2 times
Share this document with a friend
28
| www.schoenox.co.uk | | Sub-floor Preparation and Adhesive Products | | Primers and DPMs | Levelling Screeds | Adhesives | Ancillaries | Specialist Wood Flooring | | SCHÖNOX Catalogue 2018 Edition 1
Transcript

| www.schoenox.co.uk |

| Sub-floor Preparation

and Adhesive Products |

| Primers and DPMs | Levelling Screeds | Adhesives | Ancillaries | Specialist Wood Flooring |

| SCHÖNOX Catalogue 2018 Edition 1

SCHÖNOX® is a brand name synonymous with quality products for the building and renovation

industry. These products are designed for use during the installation of all types of floor tiles

and coverings with a range which includes high quality levelling screeds, floor adhesives,

primers and waterproof membranes, many of which can be used in conjunction with the Sika®

wood floor bonding range.

All of the SCHÖNOX® products are developed and produced to the highest quality using state of

the art manufacturing facilities; we also have extensive R&D capabilities and constantly work

to ensure that innovation is always at the forefront of the products we bring to market.

| SCHÖNOX is a Sika brand

Place an order

Tel no: 01707 358588

Email: [email protected]

Technical

Tel no: 01707 363864

Email: [email protected]

| Contact our Dedicated Team for

Specification, Technical or Design Advice |

| Contact us

6 - 7Primers and DPMs

8 - 11Gypsum & Cement Based Levelling Screeds

12 - 15Adhesives

16 - 17Ancillaries

18 - 22Specialist Wood Flooring

23Pictogram Key

24 - 26Sika Standard Terms and Conditions

Content |

6 Primers and DPMs

Whether you are priming an old cement based substrate without a damp proof

membrane, a new anhydrite screed, keying old ceramic tiles or isolating adhesive

residues, SCHÖNOX® has a top of the range product to ensure your requirements are

met in full.

| The right problem solvers for every situation

7Primers and DPMs

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487645 4016447011444 Light blue 10kg Single 60 pcs

| SCHÖNOX® VDUniversal acrylic primer for use prior to application of the SCHÖNOX underlayments on porous and non porous substrates

in interior areas. Suitable for pre-treating on walls and floors following the recommended dillution rates.

USES

n Internal use n To reduce absorbency of cement screeds, concrete, rapid cement screeds, calcium sulphate based screeds,

gypsum boards and wooden substrates n To improve adhesion of the levelling screeds n To reduce moisture ingress into

substrate

Storage: not below +5˚CCoverage: 50-80 g/m2

Shelf life: 1 year

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483398 4016447017798 Yellow 10kg Single 60 pcs

| SCHÖNOX® SDGSCHÖNOX® SDG is a rapid drying, ready mixed special dispersion based damp-proof membrane for interior use. It is

suitable for the fast pre-treatment of unheated cement based substrates with a residual moisture up to 90% RH as a

2 coat application and 93% RH as a 3 coat application. No additional primer is required prior to applying Schonox floor

levelling sreeds. It has high coverage and short waiting times: just 15 min for the 1st coat and approx. 45-90 min for the

2nd and 3rd coats.

USES

n As a damp-proof membrane on moisture resistant substrates with increased residual moisture n Under SCHÖNOX® floor

levelling screeds with subsequent laying of textile, elastic coverings, parquet

Storage: not below +5˚CCoverage: approx. 100-150g/m2/layer (30-40m2/ 10kg for 2 coat system)Shelf life: 1 year

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483203 4016447010454 Blue 5kg Single 90 pcs

A solvent-free, 1-component acrylate dispersion primer for interior applications. SCHÖNOX® SHP is a special primer for

sound, smooth and non-absorbent substrates. Especially suitable for application over old well bonded vinyl sheet, tiles,

steel access floors and all non porous substrates. With short waiting times, and easy roller application, this product

provides optimum adhesion. It has low consumption/high coverage rates, and can be used on both floors and walls. It has

low emissions, and is also odourless, making it pleasant to use.

USES

n As a primer to improve adhesion on smooth and sound substrates n As a primer over Sikafloor®-156

| SCHÖNOX® SHP

Storage: not below +5˚CCoverage: approx. 100-150g/m2 (6.5-10m2/kg)Shelf life: 1 year

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet1458 N/A Clear 10kg Single 30

82671 N/A Clear 25kg Single 21

14921493

N/AN/A

ClearClear

180kg Part A (Kit is 3A:1B)180kg Part B

Single 22

3093330934

N/AN/A

ClearClear

1000kg Part A (Kit is 3A:1B)1000kg Part B

Single 11

A 2-part, solvent-free, low viscosity, epoxy resin primer suitable for use in conjunction with all SCHÖNOX® adhesives and

levelling compounds. Controls moisture on damp cementitious substrates with a moisture content up to 99% RH. Provides

substrate consolidation and adhesion promotion on weak or friable surfaces. Sikafloor®-156 is suitable for refurbishing

existing substrates against the egress of moisture which can damage floor finishes.

USES

n Moisture regulator for cementitious substrates n Substrate consolidator on concrete, cement and refurbished substrates

n Adhesion promoter on broadcast mastic asphalt and most adhesive residues.

| Sikafloor®-156

Storage: not below +5˚CCoverage: approx. 400-600g/m2 (concrete/cementitious screed) approx. 250-350g/m2 (broadcast mastic asphalt)Shelf life: 2 years

8 Gypsum Levelling Screeds

Levelling screeds today are far more technically advanced than they have ever

been. SCHÖNOX®, part of the Sika® Group of companies are at the forefront

of this development and bring to you not only products with exceptional

smoothing and levelling properties, but they are also fast drying which enables

final flooring finishes to be applied in as little as two hours after application.

| Quality guarantee for your substructure

9Gypsum Levelling Screeds

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487578 4016447022198 White 25kg Single 42

A synthetic gypsum self-levelling superflat screed for use from 1 to 45 mm. Especially suitable on all gypsum and cement

based substrates, as well as on cast asphalt screeds according to DIN 18 560. Suitable for use with underfloor heating

systems, and for castor wheel loading, Used in thicknesses of 1 to 30mm (without aggregate), or 10-45mm (when bulked

out with 3mm granite chippings). It boasts high strength values (40 N/mm2 compressive strength), is stress free, while

also being protein-free, and low in emissions (EC1). Used in conjunction with SCHÖNOX® SHP primer it can also be used to

overlay old, firmly bonded, resilient floor coverings. After adding of 6 litres of water to 25kg of powder, it is ready to use.

USES

n Interior use n For use under textile and elastic coverings, as well as parquet

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483099 4016447017637 White 25kg Single 42

| SCHÖNOX® AP

Storage: not below +5˚CCoverage: approx. 6.5m2 per bag at 3mm thicknessShelf life: 1 year15804

| SCHÖNOX® APFSynthetic gypsum fibre-reinforced, self-levelling screed for use from 3-15mm in internal areas.It is especially suited for

use with wooden floor boards, chipboard (V100), mastic asphalt screeds and other critical substrates in combination with

elastic and textile coverings. Ready for foot traffic after approx. 3 hours, it has a particularly high coverage rate, as well

as very low emissions. It boasts high flexural strength, and is particularly suited for use with electric underfloor heating

systems. It provides an extremely smooth and flat surface and easily achieves SR1 smooth surface which is ideal for use

with soft floor coverings where every defect in the substrate will reflect through to the finished floor. It is ready to use

with addition for 6.0 litres of water; can be poured or pumped.

USES

Storage: not below +5˚CCoverage: approx. 6.5m2 per bag at 3mm thicknessShelf life: 1 year

15804

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483097 4016447022594 White 25kg Single 42

Very low emission, calcium sulphate based superflat levelling screed especially suitable for all calcium sulphate based

subfloors as well as mastic asphalt screeds according to EN 13 813. Also for interior use on cementitious subfloors

and for application on subfloor heating systems. Layerthickness is 1 to 10mm without aggregates and 10 to 30mm

with aggregates. After adding 6l water for 25kg powder, SCHÖNOX® XA is ready for use.

USES

n Interior use n For filling, smoothing, evening and levelling of substrates under textile and elastic coverings n For use

under parquet (layer thickness above 3mm)

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487737 4016447023966 White 4.5kg 4 50

| SCHÖNOX® AST

| SCHÖNOX® XA

Synthetic gypsum based rapid drying, feather edge and patching compound suitable to provide a smooth finish on

calcium sulphate based substrates in interior areas. SCHÖNOX® AST can be installed as a true featheredge. It is fast drying

independent of the layer thickness and is ready for foot traffic after approx. 60 minutes. Suitable for underfloor heating

systems, as well as for castor wheels loadings according to DIN EN 12529.

USES

n Interior use only n For smoothing and levelling of: gypsum based screed boards and levelling screeds, gypsum substrates,

old substrates such as ceramic tiles, water-resistant adhesive residues, wooden substrates

Storage: not below +5˚CCoverage: approx. 6.5m2 per bag at 3mm thicknessShelf life: 1 year

Storage: not below +5˚CCoverage: approx. 7m2 per bag as a feather edgeShelf life: 1 year

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

10 Cement Based Levelling Screeds

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet505287 4016447024789 Grey 25kg Single 40

503002 4016447016647 White 4.75L 4 24

High Performance two component latex levelling screed. A protein free, two-component self-levelling screed for interior

use that can be laid at a thickness of 3-40mm without aggregates, and 10-60mm with aggregates. 4.75 litres of SCHÖNOX®

LC LIQUID is applied to a 25kg bag of SCHÖNOX® LC POWDER to create a latex- and polymer- modified levelling screed that

is ideal for use below textile and other flexible floor coverings, as well as parquet flooring. It is ideal for use with underfloor

heating systems, and can be used on concrete, rapid-hardening cement systems, cement screeds, gypsum screeds, new

mastic asphalts IC10/15 (layer thickness up to 5 mm), and also old substrates such as ceramic/terrazzo.

USES

n Interior use n Under textile and other flexible coverings n Under parquet (layer thickness above 5mm)

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487679 4016447008369 Grey 25kg Single 42

A self levelling moisture tollerant levelling screed for use from 3-50mm without aggregate and 10-60mm with aggregate.

Noted for its rapid hardening, high strength, and low shrinkage, SCHÖNOX® FPL PLUS can be used for both interior and

exterior applications, as it is both frost resistant and waterproof. Suitable for use with underfloor heating systems,

SCHÖNOX® FPL PLUS is both pourable and pumpable, and is ready for covering after approx. 4 hours, for ceramic tiles on

concrete floors. It has low VOC emissions, and is regulated under EMICODE EC1 Plus. After adding 4.5-5.0 litres of water to

25 kg of powder, SCHÖNOX® FPL PLUS is ready to use.

USES

n Interior and exterior n On balconies and terraces n As a repairing mortar for filling holes

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483292 4016447022914 Grey 25kg Single 42

| SCHÖNOX® LC POWDER AND LIQUID

BA

Storage: not below +5˚CCoverage: approx. 5-6m2 per bag at 3mm thicknessShelf life: 1 year

| SCHÖNOX® FPL PLUS

Storage: not below +5˚CCoverage: approx. 5m2 per bag at 3mm thicknessShelf life: 1 year

15804

| SCHÖNOX® ZM RAPIDRapid setting self-levelling screed with very low emissions, for internal applications. For layer thicknesses 1 to 10mm wit-

hout aggregates and 5 to 25mm with added aggregates. Suitable for almost all internal substrates, SCHÖNOX® ZM RAPID

allows coverings to be laid after approximately 90 minutes. With very low shrinkage and good absorptivity, SCHÖNOX®

ZM RAPID is suitable for underfloor heating applications. It is also suitable for castor wheels loading with layer-thicknesses

great than 1mm (according to EN 12 259).

USES

n Interior use n For filling, smoothing and levelling of sustrates n For full surface levelling under wooden floors

Storage: not below +5˚CCoverage: approx. 5.5m2 per bag at 3mm thicknessShelf life: 6 months15804

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483232 4016447008925 Grey 25kg Single 42

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

| SCHÖNOX® DSPVery low emission, premium levelling screed for direct use on all suitable substrates in exterior and interior areas, parti-

cularly for levelling of industrial floors as well as garages and cellars. SCHÖNOX® DSP is characterised by a

low material shrinkage, very good flow properties and a homogeneous concrete grey appearance. It can be laid at

a thickness of 4-15mm without aggregates and 15-50mm with aggregates. Ready for foot traffic after approx. 3 hours.

USES

n Interior and exterior use n For filling, smoothing and levelling n For under coatings, ceramic or other coverings, interior

and exterior

Storage: not below +5˚CCoverage: approx. 5.5m2 per bag at 3mm thicknessShelf life: 6 months

15804

11Cement Based Levelling Screeds

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487660 4016447021788 Grey 4.5kg 4 50

| SCHÖNOX® SLCement based rapid drying, feather edge, smoothing and finishing compound, suitable to provide a smooth finish on

various substrates in interior areas. Moisture resistant. SCHÖNOX® SL can be installed as a feather edge. It is characterised

by quick drying time, independent of the layer thickness and is ready for foot traffic or covering (up to 20mm) after

approx. 20 minutes.

USES

n Interior use n For patching, smoothing and levelling of concrete, cement substrates, floor levelling screeds, old sub-

strates such as ceramic tiles, old, water-resistant adhesive residues, wooden substrates n For filling, smoothing and level-

ling of unheated, cement based substrates under SCHÖNOX® Moisture Mitigation Systems

Storage: not below +5˚CCoverage: approx. 7m2 per bag as a feather edgeShelf life: 6 months13813

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483234 4016447004088 Grey 25kg Single 42

Storage: not below +5˚CCoverage: 1.6kg/m2/mmShelf life: 6 months

| SCHÖNOX® RRRapid setting repair mortar for use from 1 to 50mm, suitable for direct bonding of coverings in interior areas.

SCHÖNOX® RR is ideal for use on subfloor heating systems, and can be used on concrete, cement and rapid

cement screeds, as well as on ceramic tiles, natural stones and terrazzo. Foot traffic can be accepted after 30 minutes

and is suitable for castor wheels loading with layer-thickness more than 1mm according to EN 12 529. After adding

of 5.5l of water to 25kg of powder, SCHÖNOX® RR is ready to use.

USES

n Interior use n For patching, filling, repairing and levelling staircase steps and platforms, wall breakouts n As a repairing

mortar for filling holes

15804

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

| For every covering there is a

professional solutionSCHÖNOX® has a full range of technically advanced dispersion adhesives to suit every ap-

plication. From pressure sensitive to the unique roller applied iFloor® system for installing

luxury vinyl tiles and planks in a quarter of the time, SCHÖNOX® adhesives will provide the

installer with greater flexibility in all aspects of their installation.

12 Adhesives

13Adhesives

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet484590 4016447004255 Beige 14kg Single 44

A universal pressure sensitive dispersion adhesive for all flexible coverings including textile, linoleum, vinyl, cork, rubber

and impact sound underlay in interior areas. Suitable for both wet and pressure sensitive adhesion. Solvent-free. It is is

easily spread, has short waiting time and rapidly develops a strong bonding strength. It is also particularly suited for use

with difficult floor coverings (please see data sheet).

USES

For bonding: n Textile wall and floor coverings n Woven fabrics, needlefelt, natural fibre coverings n PVC and CV wall

and floor coverings, LVT n Impact sound insulation underlays n Linoleum coverings in sheets, cork linoleum, corkment

n Synthetic rubber coverings

| SCHÖNOX® EMICLASSIC

Storage: not below +5˚CCoverage: By Roller: approx. 200g/m2 (5m2/kg).By notched trowel A1-A4 200-300g/m² (3.33-5 m2 per kg). By notched trowel B1-B4 300-500g/m2 (2 - 3.33m2 per kg)Shelf life: 1 year

SCHÖNOX GmbHD-48720 Rosendahl

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487741 4016447018627 Beige 14kg Single 44

| SCHÖNOX® UNITECHSolvent-free dispersion adhesive for bonding flexible coverings in interior areas. SCHÖNOX® Unitech is suitable for wet

adhesion, has short waiting times, high coverage rates, strong stringiness and has a rapid development of adhesion

strength. Suitable for use over all SCHÖNOX® levelling screeds, this product is suitable for use with underfloor heating

systems, and can be used in areas subjected to castor wheel loading.

USES

For bonding: n PVC floor coverings n CV floor coverings n Textile wall and floor coverings n Single or multi-layer needlefel

n Natural fibre coverings n Linoleum sheet coverings

Storage: not below +5˚CCoverage: Trowel size A1-A2 - 300-350g/m2

Trowel size B1-B2 400-500g/m2

Shelf life: 1 year

| SCHÖNOX® LINO XTREME

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet493369 4016447024147 Beige 14kg Single 44

Very low emission linoleum dispersion adhesive for one-side gluing linoleum in sheets, cork-linoleum and corkment on

absorbent substrates in interior areas. It is suitable for use over all SCHÖNOX® levelling screeds, also ideal for

application on subfloor heating systems and areas where castor wheels will be used. It is easy to apply and rapidly

develops the adhesion strength. It also has strong stringiness and high coverage rate.

USES

n Interior use n For bonding of linoleum coverings in sheets, cork linoleum and corkment

Storage: not below +5˚CCoverage: notched trowel TKB B1: approx.400g/m2

Shelf life: 1 year15804

SCHÖNOX GmbHD-48720 Rosendahl

14 Adhesives

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet484591 4016447013608 Crème Beige 14kg Single 44

| SCHÖNOX® DUROCOLLMulti purpose dispersion adhesive for bonding all types of soft floor coverings in internal areas. It is an adhesive ideally

suited for use with problematic, high movement soft floor coverings. This high quality, fibre reinforced adhesive is

appropriate for use with underfloor heating systems, and has a low consumption with high coverage. It is easy to apply

and rapidly builds to a very high final strength. This product compensates for the higher plasticity of some imported vinyl

products.

USES

For bonding of: n Luxury vinyl tiles (LVT) n PVC and CV coverings n Textile coverings n Single multi-layer needlefelt

Storage: not below +5˚CCoverage: Trowel (Size A1-A2): approx. 250-300g/m2². Trowel (Size B1-B2): approx. 350-450g/m2Shelf life: 1 year15804

SCHÖNOX GmbHD-48720 Rosendahl

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet481685 4016447012458 Creme -Beige 7.05kg (A:6kg; B:1.05kg) Single 60

| SCHÖNOX® PU 900A solvent-free 2-component polyurethane adhesive for bonding elastic coverings in interior areas or sheltered exterior

areas. Especially suited for bonding PVC and rubber coverings, as well as a variety of other materials. This adhesive can

be used on either absorbent or non-absorbent substrates. PU 900 is easily spread, can be used with underfloor heating

systems, as well as in areas expecting castor wheel loading. A long open time makes it easy to work with. It hardens

quickly and reaches a high bonding strength.

USES

n For bonding of PVC coverings, synthetic rubber and lino coverings, rubber granulate underlays, grass carpets n As a

repairing compound for cracks in screeds

Storage: not below +5˚CCoverage: approx. 500-1000g/m2 (7-14 m2 per 14kg unit)Shelf life: 6 months

SCHÖNOX GmbHD-48720 Rosendahl

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet487437 4016447019846 Light Green 4.5kg Single 24

487438 4016447019037 Light Green 11kg Single 18

| SCHÖNOX® iFLOORA revolutionary new system for laying of all types of luxury vinyl tiling on levelled substrates by professional fitters.

Unique, dispersion based rollable adhesive provides an extremely clean and fast installation. No excessive adhesive

residues, and no residual adhesive moving up through the joints, leaves the vinyl surface and installer’s hands clean. By

forming a flat adhesive bed instead of adhesive notches, this product will not cause point load deformation. As only a thin

layer is required, it boasts particularly high coverage rates. It bonds the vinyl immediately, allowing for immediate foot

traffic, and therefore a very fast installation.

USES

n For bonding LVT on levelled substrates

Storage: not below +5˚CCoverage: adhesive : 80g/m2 50m2 kit and 125m2 kit); primer: 25m2/kgShelf life: 1 year

15804

SCHÖNOX GmbHD-48720 Rosendahl

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

15Adhesives

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet485560 4016447018498 White 10kg Single 60

Roller applied anti-slip tackifier for fixing all types of carpet tiles. Used internally, this product is easily applied by roller

to fix all types of carpet tiles to most substrates. It has low consumption and high coverage rates. By remaining wet

(tacky) for a very long period, the product holds carpet tiles in place, but also allows for the easy replacement of tiles

when required. The product is suitable for use with underfloor heating systems and in areas where castor load bearing

is expected

USES

For fixing: n Textile tiles without surface tension n Conductive and antistatic textile carpet tiles n Loose laid textile sheet

coverings

| SCHÖNOX® TACKIFIER

Storage: not below +5˚CCoverage: approx. 75-120g/m2

Shelf life: 1 year

SCHÖNOX GmbHD-48720 Rosendahl

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet539397 - Light Brown 5 litre 2 45

| SCHÖNOX® DOUBLE STICKA multipurpose polychloroprene based contact adhesive, suitable for a wide range of applications. These include Cap and

Cove installation, bonding of vinyl, CV, Carpet and textiles coverings. It is a high strength brushable contact adhesive which

offers the contractor many benefits such as minimising task time, reducing waste and costs.

USES

For bonding: n For bonding PVC and rubber edgings, covings and nosings, floor and wallcoverings with backings of PVC,

rubber cork and all textiles. rigid PVC, foam, leather, rubber, glass fibre, wood and metals

Storage: not below +5˚CCoverage: 5.5m2/lShelf life: 1 year

15804

| Round off your equipment

Sika® supplies a number of accessories that are an important tool when installing

flooring. SCHÖNOX® TS provides sound and heat insulation and living comfort in

modern and old buildings for wall and floor areas. While Tramex Moisture Meter is an

essential tool for any installer to have in their toolbox, and can prevent costly damage

from warping if there is too much moisture in a substrate or the wood flooring.

16 Ancillaries

17Ancillaries

| Sika® TRAMEX HYGROMETER

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet116022 - - - Single 100

This pocket sized Digital Hygrometer provides fast and accurate measurement of relative humidity, ambient temperature

and dew point of the environment.

| Sika® TRAMEX MOISTURE METER

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet5450 - - - Single N/A

The Hand-Held Moisture Meter is designed to instantly and accurately measure moisture content in concrete/cement

screed, prior to laying wood floors.

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483535 4016447021832 Brown-Black 20m2 Single 12

| SCHÖNOX® TSA special cork-PU granulate underlay for improving impact sound insulation, heat insulation and living comfort in modern

and old buildings for wall and floor areas. It also reduces the formation of walking lines on textile coverings.

USES

n Under flexible coverings e.g. PVC- and CV coverings and textile coverings n Under parquet and laminate with tongue and

groove by floated laying n Under parquet with tongue and groove by full-surface bonding n Especially suitable on stairs as

well as ready-built houses and timber construction

Mass per unit area: 3 mm approx. 1.65 kg/m2. Acoustic improvement according to ISO 10140 (without covering): 3 mm 17 db; 5 mm 18 db Thermal resistance according to ISO 8302: 3 mm 0.04 m2 K/W

SCHÖNOX GmbHD-48720 Rosendahl

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet483686 4016447008116 - 50.42m2 Single 12

A multiaxial glass fibre fabric to reinforce SCHÖNOX® APF used to screed critical substrates in refurbishment projects,

avoiding the need to replace the existing subfloor It is easy to apply, ideal for projects where height is limited. Perfect

for all kind of carpets and elastic coverings.

USES

n Wooden substrates n Bitumen emulsion and Magnesia screeds n Old existing floors n Coatings

| SCHÖNOX® RENOTEX

Dimensions: 42m length and 1.19m widthConstruction: -AR-glass fibre cloth with polyester/cotton stitching and acrylate coating

| QUARTZ SAND

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet102259 - Greyish/White 25kg Single N/A

102264 - Greyish/White 25kg Single N/A

102267 - Greyish/White 25kg Single N/A

- Greyish/White 1250kg Big Bag 0.7-1.2 Single N/A

A light coloured kiln dried graded quartz sand for use with SIKA® coatings and membranes to provide a mechanical key

for subsequent levelling materials.

AVAILABLE IN THREE GRAIN SIZES:

n Small - 0.06 - 0.3mm n Medium - 0.3 -0.8mm n Large - 0.6 - 1.2mm

pH: pH 5-8 (400 g/l water at +20˚CMelting point/freezing point: > 1610˚CRelative Density: 2-3 g/cm3

Solubility in water: negligible

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

| Sika® Flooring adhesives - suitable for

every application.A varied and quality range of adhesives to complement the application of specialist

wood flooring.

18 Specialist Wood Floor Bonding

19Specialist Wood Floor Bonding

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet7027 7612894079630 White 600ml 20 48

A high viscous one part, ready to use, solvent-free, elastic adhesive used as a high strength construction adhesive, which

is particularly suited for the bonding of solid wooden boards with a maximum width of 160mm. It has good adhesion on

concrete, bricks, stones, tiles, ceramic, wood, aluminium, steel, plaster, hard PVC, GFRP, PU and more.

USES

n For indoor and outdoor for bonding solid wooden boards with max 160mm width for stair steps, skirting boards, base

boards, crash protection boards, covering boards and more

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet424418 7612894887525 Brown 600ml 20 48

427263 7612894905342 Brown 1800ml 6 18

| SikaBond®-52 Wood Floor

| SikaBond® T2 Adhesive

Fast curing elastic wood flooring adhesive for professional use. SikaBond®-52 Wood Floor is perfect for bonding solid

wooden boards with a maximum width of 160mm, using liquid batten/beaded application. It is suitable for most common

types of wood floors, particularly for problematic woods including beech, maple and bamboo. Also compatible with Sika®

AcouBond® System.

USES

n For bonding wood floors using liquid batten/beaded application n Full surface bonding using SikaBond®

Dispenser-1800/-5400 n For use with the Sika® AcouBond® System n Use with solid, engineered, parquet wood floors and

chip board n Suitable for most common types of wood floors

| SikaBond® MS Wood Floor Gun Grade

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet467798 5055492700933 Brown 600ml 12 55

A high quality, gun applied MS adhesive for bonding wooden floors to all common substrates. Being permanently elastic it

accommodates differential movement caused by changes in humidity and climatic conditions. Solvent and moisture free,

will not cause cupping of wood flooring. It is also quick to install and Ideal for use with underfloor heating when part of

the Sika® AcouBond® System.

USES

n Gun applied bonding of wood floors n For bonding directly to all common substrates n Suitable for use with under floor

heating when used with Sika® Silent Layer Mat (Sika® AcouBond® System)

Storage: not below +5˚CCoverage: 44 ml approx. per running meter (with triangular nozzle)Shelf life: 1 year

Storage: not below +5˚CInstallation: (+23˚C / 50% r. h. up to 1 mm adhesive thickness dependent on climatic conditions and adhesive layer thickness).Shelf life: 1 year

Storage: not below +5˚CCoverage: 2m2/600ml sausage (beaded application) Shelf life: 1 year

| SikaBond® Silent Layer Mat

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet50368 5055047210252 - 25m Single 1655606 5055047210269 - 20m Single 11

SikaBond® Silent Layer Mat is a footfall sound reducing polyethylene mat for use with SIKABOND® gun grade adhesives.

Available 3mm or 5mm thick, and 3 differing sizes to cover 12.5m2, 20m2, 25m2. Ideal for use with SikaBond®-52 Wood

Floor Gun Grade and SikaBond®-52 Wood Floor to deliver high performance insulation and adhesion for a variety of

flooring.

USES

n Fixation and insulation of hard flooring such as wood and laminate n Integral part of the Sika® AcouBond® System used

to bond solid wood boards and 3-ply engineered wood floors

Footfall sound reduction: Up to 16dbCoverage: SILENT0316: 3mm thick, 16.66m x 1.5m roll = 25m2; SILENT0513: 5mm thick, 13.33m x 1.5m roll = 20m2

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

* Special order only

20 Specialist Wood Floor Bonding

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet27784 7612894907285 Brown 13kg Single 33

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet183195 7612894760415 Brown 17kg Single 33

| SikaBond® AT-80

| SikaBond®-54 Wood Floor

| SikaBond® MS Wood Floor

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet466914 5055492700902 - 14kg Single 24

A high quality, trowel applied MS adhesive for bonding wooden floors to all common substrates, eliminating the need

for battens. The formulation is completely water and solvent-free thereby alleviating the likelihood of wooden boards

cupping or crowning. With an extended open time in excess of 40 minutes, this product is ideal for larger application

areas.

USES

n Trowel applied bonding of wood floors n For bonding directly to all common substrates like concrete, anhydrite,

chipboard, plywood, metal, ceramic tiles, and most natural stone floors n Suitable for use with all solid and engineered

wood types up to 180mm wide

| SikaBond®-5500 S

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet165745 5055047210177 - 16kg Single 44

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

A professional wood floor adhesive that is fast curing, solvent-free and elastic. A full stick down adhesive for both solid

and engineered wood floors. Reduces footfall noise. It is also suitable for use with sub-floor heating systems.

USES

n For full surface wood floor bonding n For bonding solid and engineered wood n Suitable for use with most common

types of wood n Suitable for use with underfloor heating

A 1-part easy to use, solvent-free, elastic wood floor bonding system. Can be laid on all mineral substrates such as ce-

ment, wood, ceramic, metal, chipboard, OSB. Particularly suitable for full surface bonding of solid and engineered boards

and mosaic and industrial parquets.

USES

For surface bonding of wood flooring systems including: n Solid and engineered wood floors (strips, longstrips, planks,

panels and boards) n Mosaic and industrial parquet n Wood paving (residential) and chipboard

Storage: not below +5˚CCoverage: 600g/m2 (minimum); Approximately: 18 – 20m2 / pailShelf life: 1 year

Storage: not below +5˚CCoverage: 750g/m2 (minimum), approximately 15 – 80m2 / pailShelf life: 1 year

A solvent based rigid adhesive for bonding wood block parquet and engineered boards onto porous substrates. Ideal for

full surface bonding of wood flooring systems including hardwood, mosaic parquet and industrial use engineered wood

floors. It does not require the complete removal of bitumen and can also be used over underfloor heating installations.d.

USES

n Bonding of hardwood, mosaic parquet and industrial use engineered wood floors n For refurbishment projects where

bitumen adhesive residues are present n Over underfloor heating installations

Storage: not below +5˚CCoverage: 800g/m2 (minimum), approximately 18 – 20m2 / pailShelf life: 1 year

Storage: not below +5˚CCoverage: 800g/m2 (minimum), approximately 18 – 20m2 / pailShelf life: 1 year

21Specialist Wood Floor Bonding

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet57452 7612894581065 - 10kg Single 45

Solvent-free, water dispersed 2-part primer based on epoxy resin used to promote adhesion on new concrete,

cementitious screeds, hardened concrete, existing floor coatings, EpoCem® levelling layers. Easy and fast to apply primer

that is odourless so can be applied in unventilated areas. Especially suitable for highly absorbent substrates.

USES

As a primer and adhesion promoter on properly prepared: n New concrete n Cementitious screeds n Hardened concrete n

Existing epoxy floor coatings n EpoCem® levelling layers n As a primer for Sikafloor®-81 EpoCem® and Sikafloor® Level®-25

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet165745 5055047210177 - 10kg Single 44

7377 7611237126406 - 23kg Single 50

| Sikafloor®-81 EpoCem®

| Sikafloor®-155WN

A 3-part, epoxy modified cementitious, fine textured mortar for use as a temporary damp-proof membrane (min. 2mm

thick), prior to the application of SikaBond® Primer-MB. Can be applied onto green concrete, flood damaged concrete or

where no physical membrane exists. Please see technical data sheets for more details.

USES

n As a Temporary Moisture Barrier (TMB) (min. 2 mm thick) under Epoxy, Polyurethane and PMMA resin floors, over high

moisture content substrates, even green concrete n As a selfsmoothing screed n Extended with quartz sand, as a patching

and repair mortar n Designed for use on cementitious

Storage: not below +5˚CCoverage: 0.3 - 0.5 kg/m2/coat. (2 - 3.3 m2/kg/coat). All values indicated above are internal test results according to DIN 52615 and EN 13892-8. Conforms to the requirements of EN - 13813 SR - B 1.5 Shelf life: 1 year

Storage: not below +5˚CCoverage: approx. 2.25 kg/m2/mm; approx. 4.5 kg/ m2 for a 2mm thick application (minimum as a moisture barrier)Shelf life: 1 year

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet102547 - - - Single 1

| Sika® Barrel GunThe Foil Pack applicator gun is designed for use with foil packs, the enclosed aluminium barrel can also be used for standard cartridges.USES

n As a Temporary Moisture Barrier (TMB) (min. 2 mm thick) under Epoxy, Polyurethane and PMMA resin floors, over high

moisture content substrates, even green concrete n As a selfsmoothing screed n Extended with quartz sand, as a patching

and repair mortar n Designed for use on cementitious

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

22 Specialist Wood Floor Bonding

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet499307 7612894751420 - 3 litre Single 210

| Sika® Thinner CA xylene based thinner and an activating solvent cleaner. It can also be used as a general purpose solvent for cleaning

adhesive from tools and floors etc.

USES

n Component of priming systems n Modification of membrane viscosity n Cleaning of application equipment n Re-

activation of over-exposed membranes

Storage: not below +5˚CCoverage: approx. 250ml/m2

| Sika® Remover-208

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet34288 400392313400 - 1 litre 4 300

A solvent based cleaner for removing traces of uncured adhesives or sealants from application tools or from soiled wood

floors. Also effective as a pre-cleaner for strongly contaminated non-porous substrates and to clean painted surfaces

prior to bonding.

USES

n To remove uncured excess material adhesives or sealants from application tools or from soiled surfaces n For pre-

cleaning of strongly contaminated non-porous substrates n To clean painted surfaces prior to bonding

Storage: not below +5˚CCoverage: 750g/m2 (minimum), approximately 15 – 80m2 / pail

| Sika® Hand Wipes

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet104885 - - 100 wipes N/A 192115767 - - 100 wipes refill N/A 252

Specially designed to easily remove uncured Sikaflex® and SikaBond® products from hands. They can also be used for removing uncured materials from tools and other surfaces, in this handy wipe form they allow for mess free cleaning and easy disposal. Each tub holds 100 wipes.USES

n Clean wet and semi-cured paints, sealants, adhesives, bitumen’s, polyurethanes, expanding foams, polyester fillers and

epoxies from hands, tools and surfaces

Storage: not below +5˚CShelf life: 1 year (if unopened)

Sika Code: EAN Barcode: Colour Pack Size Box Qty Boxes/Pallet180934 - - 10 litre Single 50

| Sika® Thinner EGA dilutent that is mixed with SikaBond®-5500 S at a ratio of 1:1 by volume as a primer over embedded under floor heating

systems prior to the application of the wood block flooring. Quick drying and easy to roller.

USES

n As a primer over embedded under floor heating systems prior to the application of the wood block flooring n Cleaning

of application equipment

Storage: not below +5˚CCoverage: approx. 250ml/m2

All values are approximate, are subject to local climatic fluctuations and vary according to the absorbency of the substrate.

23Explanation of Pictograms

The product fallsIn the said

GISCODE group

BA

2-part product

For interior floors

DIN18 365The corresponding

DIN standard is applicable

Mechanically high loadable

Blue Angel

Steel spatulaNotched trowel Spatula Product hardens fast

Possible to use in combination with underfloor heating

Pinsel

The product fallsIn the said

GISCODE group

The product fallsIn the said

GISCODE group

SCHÖNOX GmbHD-48720 Rosendahl

Product is clearly building permitted.

Suitable for marine equipment

Suitable for castor wheel loading according to DIN

EN 12 529

Reduces dust

Roller

The product complies with the criteria of the above-mentioned GEV emicode

CE-identification

For interior and exterior floors

For interior floors and walls

Product-/Processing Characteristics

Seal of Approval

Areas of Applications

24 Standard Terms and Conditions of Sales of Goods Sold by Sika Limited

1. INTERPRETATION

IntheseTermsandConditionsthefollowingexpressionswillhavethefollowingmeaningsunlessinconsistentwiththecontext:

“BespokeGoods”meansanyGoodswhicharemadetomeasure,bespoke,orotherwisemanufacturedtoauniquespecification.

“Buyer”theperson(s),firmorcompanywhoseorderfortheGoodsorServicesisacceptedbytheCompanyinaccordancewiththeseTermsandConditions.

“Company”SikaLimited(Companynumber:226822)whoseregisteredofficeislocatedatWatchmead,WelwynGardenCity,Herts,AL71BQandwhoseSikaSarnafiloperatingofficeislocatedatWatchmead,WelwynGardenCity,Herts,AL71BQ.

“ConfidentialInformation”meansallinformationinrespectofthebusinessoftheCompanyincluding,butnotlimitedto,know-how,pricesorothermattersconnectedwiththeGoodsorServices(whichshallincludeanyinstructionsorprocedures,instructionmanuals,userguidesandotherinformationwhichissuppliedbytheCompanywiththeGoodsorServices)andanyotherinformationofwhatevernaturewhich,ifdisclosed,willbeliabletocauseharmtotheCompany.

“Contract”anycontractbetweentheCompanyandtheBuyerforthesaleandpurchaseoftheGoodsorServicesformedinaccordancewithCondition2.

“DeliveryPoint”theplacewheredeliveryoftheGoodsisagreedtotakeplace,assetoutintheCompany’swrittenacknowledgementoforder.

“FinalInspectionCertificate”ACertificateissuedforthebenefitofathirdpartyatthecompletionoftheServices.

“Goods”anygoodswhichtheCompanysuppliestotheBuyer(includinganyofthemoranypartofthem)underaContract.

“Guarantee”aguaranteeorFinalInspectionCertificatefororrelatedtotheGoodsinaformtobeprovidedbytheCompanyinfavourofathirdpartynominatedbytheBuyer.

“GuaranteePeriod”theon-goingperiodofprotectionprovidedtoathirdpartyassetoutinaGuarantee.

“IntellectualPropertyRights”allintellectualandindustrialpropertyrightsincludingpatents,know-how,registeredtrademarks,registereddesigns,utilitymodels,applicationsforandrightstoapplyforanyoftheforegoing,unregistereddesignrights,unregisteredtrademarks,rightstopreventpassingoffforunfaircompetitionandcopyright,databaserights,topographyrightsandanyotherrightsinanyinvention,discoveryorprocess,ineachcaseintheUnitedKingdomandallothercountriesintheworldandtogetherwithallrenewalsandextensions

“Services”anyserviceswhichtheCompanyperformsfortheBuyerunderaContract,whichareancillarytothesupplyofGoods.

“ServicePoint”theplaceatwhichtheServicesaretobeperformed,assetoutintheCompany’swrittenacknowledgementoforder.

“SpecificDeliveryRequirement”anygoods,whicharerequiredtobedeliveredbyatypeofvehiclespecifiedbytheBuyer.

“TermsandConditions”thestandardtermsandconditionsofsalesetoutinthisdocumenttogetherwithanyspecialtermsagreedinwritingbetweentheBuyerandtheCompany.

“Trademark”theSARNAFILtrademarkregisteredintheUnitedKingdomundertrademarknumber1046240.

“WorkingDay”anydayotherthanSaturdayorSundayorapublicorbankholidayinEngland.

2. FORMATION AND INCORPORATION

2.1 SubjecttoanyvariationunderCondition14.5,the

ContractwillbeupontheseTermsandConditions,totheexclusionofallothertermsandconditionsandallpreviousoralorwrittenrepresentationsincludinganytermsorconditionswhichtheBuyerpurportstoapplyunderanypurchaseorder,confirmationoforderorsimilardocument,whetherornotsuchdocumentisreferredtointheContract.

2.2 EachorderoracceptanceofaquotationforGoodsorServiceswillbedeemedtobeanofferbytheBuyertopurchaseGoodsorServicesupontheseTermsandConditions.TheContractisformedwhentheBuyerreceivesconfirmationthattheorderisacceptedbytheCompany.Suchconfirmationmayeitherbegivenorallyorinwriting.NocontractwillcomeintoexistenceuntilsuchconfirmationhasbeengivenbytheCompany.

2.3 TheBuyermustensurethatthetermsofitsorderandanyapplicablespecificationarecompleteandaccurate.

2.4 AcceptanceofdeliveryoftheGoodsorcommencementoftheperformanceoftheServiceswillbedeemedconclusiveevidenceoftheBuyer’sacceptanceoftheseTermsandConditions.

2.5 SubjecttoCondition6.5,theBuyermaynotcanceltheContract.TheCompanymaycanceltheContractatanytimepriortodeliveryoftheGoodsorcommencementoftheperformanceoftheServices.

3. DESCRIPTION OF THE GOODS AND SERVICES

3.1 ThedescriptionoftheGoodswillbeassetoutintheCompany’spricelist.Allsamples,drawings,descriptivematter,specificationsandadvertisingissuedbytheCompanyandanydescriptionsorillustrationscontainedintheCompany’scataloguesorbrochuresareissuedorpublishedforthesolepurposeofgivinganapproximateideaoftheGoodsrepresentedbyordescribedinthem.TheywillnotformpartoftheContractandthisisnotasalebysample.

3.2 TheCompanymaymakeanychangetothespecification,design,materialsorfinishesoftheGoodswhichare:

3.2.1 requiredtoconformwithanyapplicablesafety,statutoryorregulatoryrequirement;or

3.2.2 donotmateriallyaffecttheirqualityorperformance.

3.3 TheCompanywillonlyperformServiceswhichareancillaryto,orrelatingto,GoodsprovidedunderaContract.

3.4 TheServiceswillonlybeperformedbytheCompanyattheServicePoint.

3.5 TheCompanyshalluseallreasonableendeavourstoperformtheServices:

3.5.1 tothestandardrequiredfortheissueofaFinalInspectionCertificate;

3.5.2 promptly,buttimeshallnotbetheessencefortheperformanceoftheServices.

3.6 TheCompanyshallhavetherighttomakeanychangestotheServiceswhicharenecessarytocomplywithapplicablesafety,statutoryorregulatoryrequirements,orwhichdonotmateriallyaffectthenatureorqualityoftheServices,andtheCompanyshallnotifytheBuyerinanysuchevent.

4. PRICE AND PAYMENT

4.1 ThepricefortheGoodsorServiceswillbethepricesetoutintheCompany’spublishedpricelistcurrentatthedateofdeliveryofGoodsorperformanceofServicesorasotherwisenotifiedbytheCompanytotheBuyerpriortotheContractbeingmade.OrdersforGoodsvaluedbelow£2000(beforeVAT)areexclusiveofanycostsofpackagingandcarriage,VATandanyotherapplicablesalestaxordutywhichwillbeaddedtothesuminquestion.OrdersforGoodsvaluedgreaterthan£2000(beforeVAT)andwhicharetobedispatchedfromtheCompany’swarehousewithintheUnitedKingdomareinclusiveofanycostsofpackagingandcarriagewithintheUnitedKingdombutexclusiveofVATandanyotherapplicablesalestaxordutywillbeaddedtothesuminquestion.

4.2 TheCompanymayinvoicetheBuyerfortheGoodsonoratanytimeafterdispatch,orfortheServicesonoratanytimeafterperformancecommencesandpaymentisdueinpoundssterlingbythelastdayofthenextcalendarmonthfollowingthedateofinvoice,oruponterminationoftheContract,whicheveroccursfirst.

4.3 Timeforpaymentwillbeoftheessence.Nopayment

willbedeemedtohavebeenreceiveduntiltheCompanyhasreceivedclearedfunds.

4.4 AllpaymentstobemadebytheBuyerundertheContractwillbemadeinfullwithoutanyset-off,restrictionorconditionandwithoutanydeductionfororonaccountofanycounterclaim.

4.5 IfanysumpayableundertheContractisnotpaidwhenduethen,withoutprejudicetotheCompany’sotherrightsundertheContract:thatsumwillbearinterestfromtheduedateuntilpaymentismadeinfull,bothbeforeandafteranyjudgment,atacombinedrateoftheBankofEnglandbaseratefromtimetotimeandtherateprovidedbytheLatePaymentofCommercialDebts(Interest)Act1998asamendedfromtimetotime;andtheCompanywillbeentitledtosuspenddeliveriesoftheGoodsorperformanceoftheServicesuntiltheoutstandingamounthasbeenreceived.

4.6 TheCompanyreservestherighttorecoupanysum,resultingfromcostsincurredfromlegalproceedingstorecoverthesumpayableundertheContract.

4.7 AnyinvoicequeriesmustbecommunicatedtotheCompanywithin10(ten)WorkingDaysofreceiptoftheinvoicebytheBuyer.

5. INSTALMENTS

TheCompanymaydelivertheGoods,orperformServices,byseparateinstalments.EachinstalmentwillbeaseparateContractandnocancellationorterminationofanyoneContractrelatingtoaninstalmentwillentitletheBuyertorepudiateorcancelanyotherContractorinstalmentunlessotherwisenotifiedbytheCompany.EachseparateinstalmentwillbeinvoicedandpaidforinaccordancewiththeprovisionsoftheContract.

6. DELIVERY OF GOODS

6.1 DeliveryoftheGoodswithintheUKmainlandwillbeCPTDeliveryPointINCOTERMS2010(savethatcarriagemaybechargedtotheBuyerinaccordancewithCondition6.4and/orCondition6.5).

6.2 DeliveryoftheGoodstoNorthernIreland,theScottishIsles,theChannelIslandsortheIsleofManwillbemadeFOBDeliveryPointINCOTERMS2010.

6.3 DeliveryoftheGoodsoutsidetheUKwillbemadeFASDeliveryPointINCOTERMS2010,exceptthatriskshallpasstotheBuyeratthetimethattheGoodsleavetheCompany’spremises.

6.4 DeliveryoftheGoodswillbeacceptedatanytimeofday.AtthesolediscretionoftheCompany,overnightdeliveriesordeliveriesatspecifiedtimesmaybeagreedincertaincircumstances.Notwithstandingcondition6.1,suchdeliveriesshallbesubjecttoanadditionalchargebeingraisedbytheCompany.IftheBuyerfailstotakedelivery,orprovideanynecessarydocuments,theGoodswillbedeemedtohavebeendeliveredandtheCompany,withoutprejudicetoitsotherrights,mayatitsoption:

6.4.1 storeorarrangeforstorageoftheGoodsuntilactualdeliveryorsaleandchargetheBuyerforallrelatedcostsandexpenses(including,withoutlimitation,storageandinsurance);and/or

6.4.2 followingwrittennoticetotheBuyer,sellanyoftheGoodsatthebestpricereasonablyobtainableinthecircumstancesandchargetheBuyerforanyshortfallbelowthepriceundertheContract.

ExcessivewaitingtimesmayalsobechargedtotheBuyerincertaincircumstances.

6.5 TheCompanywillusereasonableendeavourstodeliverGoods5(five)WorkingDaysafterthedateonwhichtheorderisconfirmedbytheCompany,butthetimeofdeliverywillnotbeoftheessenceofaContract.Notwithstandingcondition6.1,carriagewillbechargedondeliveriesrequiredwithin5(five)WorkingDays,ordeliverieswithspecifictimeorvehicletypestipulations.If,despitethoseendeavours,theCompanyisunableforanyreasontofulfilanydeliveryofGoodsonaspecifieddate,theCompanywillbedeemednottobeinbreachoftheContract,nor(fortheavoidanceofdoubt)willtheCompanyhaveanyliabilitytotheBuyerfordirect,indirectorconsequentialloss(allthreeofwhichtermsincludes,withoutlimitation,pureeconomicloss,lossofprofits,lossofbusiness,depletionofgoodwillandlikeloss)howsoevercaused(includingasaresultofnegligence)byanydelayorfailureindeliveryofGoodsexceptassetoutinthiscondition.AnydelayindeliveryofGoodswillnotentitletheBuyertocanceltheorder

25

unlessanduntiltheBuyerhasgiven10(ten)WorkingDays’writtennoticetotheCompanyrequiringthedeliveryoftheGoodsandtheCompanyhasnotfulfilledthedeliveryoftheGoodswithinthatperiod.IftheBuyercancelstheorderinaccordancewiththisCondition6.5then,saveasexcludedunderCondition6.6:

6.5.1 theCompanywillrefundtotheBuyeranysumswhichtheBuyerhaspaidtotheCompanyinrespectoftheGoodswhichhavebeencancelled;

6.5.2 andtheBuyerwillbeundernoliabilitytomakeanyfurtherpaymentsunderCondition4inrespectoftheGoodsthathavebeencancelled.

6.6 Notwithstanding,theprovisionsofCondition6.5,theCompanywillbeundernoobligationto:

6.6.1 torefundtheBuyeranysumswhichtheBuyerhaspaidtotheCompanyinrespectoftheBespokeGoodswhichhavebeencancelledunderCondition6.5;and

6.6.2 waiveanyoutstandingfurtherpaymentsduebytheBuyerinrespectofBespokeGoodswhichhavebeencancelledunderCondition6.5.

6.7 TheBuyerwillprovideatitsexpenseattheDeliveryPointadequateandappropriateequipmentandmanuallabourforoff-loadingtheGoods.

6.8 A£10.00handlingchargewillbemadeinadditiontothecarriagechargeforovernightdispatchofGoods.Thisserviceisofferedasresourcesallowandissubjecttoavailabletransport.

6.9 ThetypeofvehicleusedtodeliverGoodsandthemethodofpackagingoftheGoodsfordeliverywillbeatthediscretionoftheCompany.

6.10 AnychangerequiredbytheBuyertothedeliveryvehicleand/orthemethodofpackagingtheGoodsfordeliveryselectedbytheCompanywillconstituteaSpecificDeliveryRequirement.TheBuyerwillincuranyadditionalcostsforaSpecificDeliveryRequirement.

6.11 TheBuyerwillprovideafullandcorrectaddress,includingpostcode,forthedeliveryoftheGoods.

7. RISK/TITLE IN THE GOODS

7.1 RiskofdamagetoorlossoftheGoodswillpasstotheBuyerinaccordancewithCondition6.

7.2 OwnershipoftheGoodswillnotpasstotheBuyeruntiltheCompanyhasreceivedinfull(incashorclearedfunds)allsumsduetoitinrespectof:

7.2.1 theGoods;and

7.2.2 allothersumswhichareorwhichbecomeduetotheCompanyfromtheBuyeronanyaccount,whetherforGoodsorServices.

7.3 UntilownershipoftheGoodshaspassedtotheBuyer,theBuyermust:

7.3.1 holdtheGoodsonafiduciarybasisastheCompany’sbailee;

7.3.2 storetheGoods(atnocosttotheCompany)separatelyfromallotherGoodsoftheBuyeroranythirdpartyinsuchawaythattheyremainreadilyidentifiableastheCompany’sproperty;

7.3.3 notdestroy,defaceorobscureanyidentifyingmarkorpackagingonorrelatingtotheGoods;and

7.3.4 maintaintheGoodsinsatisfactoryconditioninsuredontheCompany’sbehalffortheirfullpriceagainstallriskstothereasonablesatisfactionoftheCompany,andwillwheneverrequestedbytheCompanyproduceacopyofthepolicyofinsurance.

7.4 TheBuyermayreselltheGoodsbeforeownershiphaspassedtoitsolelyonthefollowingconditions:

7.4.1 anysalewillbeeffectedintheordinarycourseoftheBuyer’sbusinessatfullmarketvalueandtheBuyerwillaccounttotheCompanyaccordingly;and

7.4.2 anysuchsalewillbeasaleoftheCompany’spropertyontheBuyer’sownbehalfandtheBuyerwilldealasprincipalwhenmakingsuchasale.

7.5 TheBuyer’srighttopossessionoftheGoodswillterminateimmediatelyifanyofthecircumstancessetoutinCondition11.1occur.

7.6 TheCompanywillbeentitledtorecoverpaymentfortheGoodsnotwithstandingthattitleinanyoftheGoodshasnotpassedfromtheCompany.

7.7 TheBuyergrantstheCompany,itsagentsandemployeesanirrevocablelicenceatanytimeto

enteranypremiseswheretheGoodsareormaybestoredinordertoinspectthem,or,wheretheBuyer’srighttopossessionhasterminated,torecoverthem.

7.8 WheretheCompanyisunabletodeterminewhetheranyGoodsarethegoodsinrespectofwhichtheBuyer’srighttopossessionhasterminated,theBuyerwillbedeemedtohavesoldallgoodsofthekindsoldbytheCompanytotheBuyerintheorderinwhichtheywereinvoicedtotheBuyer.

7.9 OnterminationoftheContract,howsoevercaused,theCompany’s(butnottheBuyer’s)rightscontainedinthisCondition7willremainineffect.

8. LIABILITY OF COMPANY

8.1 TheCompanywill,freeofcharge,withinaperiodof12monthsfromthedateofdeliveryofGoods,orwhereaGuaranteehasbeenissued,fortheGuaranteePeriod,whichareprovedtothereasonablesatisfactionoftheCompanytobemissing,damagedordefectiveduetodefectsinmaterialordesign(otherthanadesignmade,furnishedorspecifiedbytheBuyer),repair,oratitsoptionprovideorreplace,suchGoods.Thisobligationwillnotapplywhere:

8.1.1 theGoodshavebeenimproperlyalteredinanywaywhatsoever,orhavebeensubjecttomisuseorunauthorisedrepair;

8.1.2 theGoodshavebeenimproperlyinstalledorconnected;

8.1.3 anymaintenancerequirementsrelatingtotheGoodshavenotbeencompliedwith;

8.1.4 theBuyerhasfailedtonotifytheCompanyofanydefect(s)ormissingitem(s)fromtheorderacknowledgementwithin48hoursofdeliverywherethedefect(s)ormissingitem(s)shouldbeapparentonreasonableinspection,orwithin48hoursofthesamecomingtotheknowledgeoftheBuyerwherethedefect(s)ormissingitem(s)isnotthatwhichshouldbeapparentonreasonableinspection,andinanyeventnolaterthan12monthsfromthedateofdelivery;

8.1.5 whereaguaranteehasbeenissued,andhasbeenbreachedbythethirdpartybeneficiaryoftheGuaranteewithintheGuaranteePeriod

8.2 AnyGoodswhichhavebeenreplacedbytheCompanywillbelongtotheCompany.AnyrepairedorreplacementGoodswillbeliabletorepairorreplacementunderthetermsspecifiedinCondition8.1fortheunexpiredportionofthe12monthperiodfromtheoriginaldateofdeliveryofthereplacedGoodsorwhereaGuaranteehasbeenissued,fortheGuaranteePeriod.

8.3 IntheeventofanybreachoftheCompany’sexpressobligationsunderConditions6.5,8.1and8.2abovetheremediesoftheBuyerwillbelimitedtodamages.

8.4 TheCompanydoesnotexcludeitsliability(ifany)totheBuyer:

8.4.1 forbreachoftheCompany’sobligationsarisingundersection12SaleofGoodsAct1979orsection2SupplyofGoodsandServicesAct1982;

8.4.2 forpersonalinjuryordeathresultingfromtheCompany’snegligence;

8.4.3 undersection2(3)ConsumerProtectionAct1987;

8.4.4 foranymatterwhichitwouldbeillegalfortheCompanytoexclude(ortoattempttoexclude)itsliability;or

8.4.5 forfraud.

8.5 ExceptasprovidedinConditions6.5and8.1to8.4,theCompany’sliabilitytotheBuyer(whetherincontract,tort(includingnegligence),breachofstatutoryduty,restitutionorotherwise)foranyinjury,death,damageordirect,indirectorconsequentialloss(allthreeofwhichtermsinclude,withoutlimitation,pureeconomicloss,lossofprofits,lossofbusiness,depletionofgoodwillandlikeloss)howsoevercausedarisingoutoforinconnectionwith:

8.5.1 anyoftheGoods,orthemanufactureorsaleorsupply,orfailureordelayinsupply,oftheGoodsbytheCompanyoronthepartoftheCompany’semployees,agentsorsub-contractors;

8.5.2 anyoftheServices,ortheirperformance,orfailureordelayinperformance,oftheServices

bytheCompanyoronthepartoftheCompany’semployees,agentsorsub-contractors;

8.5.3 anybreachbytheCompanyofanyoftheexpressorimpliedtermsoftheContract;

8.5.4 anyusemadeorresalebytheBuyerofanyoftheGoods,orofanyproductincorporatinganyoftheGoods;

8.5.5 anyusemadebytheBuyerofanyoftheServices,orofanyproductincorporatinganyoftheServices;or

8.5.6 anystatementmadeornotmade,oradvicegivenornotgiven,byoronbehalfoftheCompanyorotherwiseundertheContract,

shallbelimitedtotheinvoicedvalueoftheGoods.

8.6 ExceptassetoutinConditions6.5and8.1to8.5,theCompanyherebyexcludestothefullestextentpermissibleinlaw,allconditions,warrantiesandstipulations,express(otherthanthosesetoutintheContract)orimplied,statutory,customaryorotherwisewhich,butforsuchexclusion,wouldormightsubsistinfavouroftheBuyer.

8.7 EachoftheCompany’semployees,agentsandsub-contractorsmayrelyuponandenforcetheexclusionsandrestrictionsofliabilityinConditions6.5and8.3to8.6inthatperson’sownnameandforthatperson’sownbenefit,asifthewords“itsemployees,agentsandsub-contractors”followedthewordCompanywhereveritappearsinthoseconditionssaveeachreferenceinCondition8.5.1.

8.8 TheBuyeragreestoindemnify,keepindemnifiedandholdharmlesstheCompanyfromandagainstallcosts(includingthecostsofenforcement),expenses,liabilities(includinganytaxliability),injuries,direct,indirectorconsequentialloss(allthreeofwhichtermsinclude,withoutlimitation,pureeconomicloss,lossofprofits,lossofbusiness,depletionofgoodwillandlikeloss),damages,claims,demands,proceedingsorlegalcosts(onafullindemnitybasis)andjudgmentswhichtheCompanyincursorsuffersasaconsequenceofadirectorindirectbreachornegligentperformanceorfailureordelayinperformancebytheBuyerofthetermsoftheContract.WhereaGuaranteehasbeenissued,suchindemnityshallcontinueuntiltheendoftheGuaranteePeriod.

9. GUARANTEE

9.1 WheretheCompanyprovidesaWarrantyadditionaltotheguaranteeinConditon8hereof,theBuyermayrequestthattheWarrantybeprovidedinfavourofaninterestedthirdpartynominatedbytheBuyer.

9.2 TheWarrantyshallbeonsuchtermsandinsuchformastheCompanyconsidersappropriate.

9.3 TheWarrantyshallonlybeprovidedwhenallpaymentsduefromtheBuyerhavebeenreceivedandifinassociationwithaFinalInspectionCerficate,whentheCompanyhasbeengivenallreasonableopportunitytocarryoutatechnicalaudit..

9.4 TheBuyeracknowledgesthatintheeventofaclaimbeingbroughtagainsttheCompanyunder,andinaccordancewiththetermsofaWarranty,whichissolelyorpartiallyduetotheinstallationoftheGoodsnothavingbeencarriedoutinaccordancewiththeCompany’srecommendationsorwiththeskillandcareexpectedofanexperiencedcontractor,theBuyershallindemnifytheCompanyandshall;

9.4.1 recognisethecontinuingobligationsoftheCompanyandtheBuyertoremedydefectsintheGoodsfortheGuaranteePeriod;and

9.4.2 notseektorelyonand,ifandtotheextentnecessary,expresslywaiveanyentitlementtorelyontheprovisionsoftheLimitationAct1980indefenceofsuchclaim.

10. FORCE MAJEURE

TheCompanywillnotbeliabletotheBuyerforanyfailureordelayorfortheconsequencesofanyfailureordelayinperformanceoftheContract,ifitisduetoanyeventbeyondthereasonablecontroloftheCompanyincluding,withoutlimitation,actsofGod,war,industrialdisputes,protests,fire,tempest,explosion,anactofterrorismandnationalemergenciesandtheCompanywillbeentitledtoareasonableextensionoftimeforperformingsuchobligationsinsuchcircumstances.

26

11. TERMINATION

11.1 TheCompanymaybywrittennoticeterminatetheContractimmediatelyiftheBuyer:

11.1.1 isinmaterialbreachofanyofthetermsoftheContract.FailuretopayanysumsdueinaccordancewithCondition4.2isamaterialbreachofthetermsoftheContractwhichisnotcapableofremedy.

11.1.2 becomesbankrupt,insolvent,makesanycompositionwithhiscreditors,hasareceiverappointedundertheMentalHealthAct1983ordies;

11.1.3 hasanydistraint,executionorotherprocessleviedorenforcedonanyofitsproperty;

11.1.4 ceasestotradeorappearsinthereasonableopinionoftheCompanylikelyoristhreateningtoceasetrade;

or

11.1.5 theequivalentofanyoftheaboveoccurstotheBuyerunderthejurisdictiontowhichtheBuyerissubject.

11.2 TheterminationoftheContracthowsoeverarisingiswithoutprejudicetotherights,dutiesandliabilityofeithertheBuyerortheCompanyaccruedpriortotermination.Theconditionswhichexpresslyorimpliedlyhaveeffectafterterminationwillcontinuetobeinforcenotwithstandingtermination,whichshallincludebutshallnotbelimitedto,theBuyer’sobligationsinrelationtoanyGuarantee.

12. INTELLECTUAL PROPERTY

12.1 NorightorlicenceisgrantedtotheBuyerinrespectoftheexistingIntellectualPropertyRightsoftheCompany,excepttherighttouse,orre-selltheGoodsintheBuyer’sordinarycourseofbusiness.

12.2 AllIntellectualPropertyRightsinorarisingoutoforinconnectionwiththeperformanceofServicesshallbeownedbytheCompany.

12.3 TheBuyerwillnotwithouttheCompany’spriorconsentallowtheTrademarkoranyothertrademarksoftheCompanyorotherwordsormarksappliedtotheGoodstobeobliterated,obscuredoromittednorwillheaddanyadditionalmarksorwords.

13. DISTRIBUTION

13.1 IftheBuyerpurchasestheGoodsandresellsthemthentheCompanyshallhavenoliabilityfornorshallanyindemnityfromtheCompanytotheBuyerinthesetermsapplytoanyliabilityoftheBuyertotheextentthatsuchliabilitywouldnothaveexistedhadtheBuyersoldthegoodsupontermsnolessfavourablethanthesetermsandconditions.

14. GENERAL

14.1 TimeforperformanceofallobligationsoftheBuyerisoftheessence.TimeforperformanceofallobligationsoftheCompanyisnotoftheessence.

14.2 EachrightorremedyoftheCompanyundertheContractiswithoutprejudicetoanyotherrightorremedyoftheCompanywhetherundertheContractornot.

14.3 IfanyconditionorpartoftheContractisfoundbyanycourt,tribunal,administrativebodyorauthorityofcompetentjurisdictiontobeillegal,invalidorunenforceablethenthatprovisionwill,totheextentrequired,beseveredfromtheContractandwillbeineffective,without,asfarasispossible,modifyinganyotherprovisionorpartoftheContractandthiswillnotaffectanyotherprovisionsoftheContractwhichwillremaininfullforceandeffect.

14.4 NofailureordelaybytheCompanytoexerciseanyright,powerorremedywilloperateasawaiverofit,norwillanypartialexerciseprecludeanyfurtherexerciseofthesame,orofanyotherright,powerorremedy.

14.5 SaveassetoutintheContractandCondition8.1.5,theseTermsandConditionsmayonlybevariedoramendedinwritingandsignedbyaseniormanageroftheCompany.

14.6 TheCompanymayassign,delegate,license,holdontrustorsub-contractalloranypartofitsrightsorobligationsundertheContract.

14.7 TheContractispersonaltotheBuyerwhomaynotassign,delegate,license,holdontrustorsub-

contractalloranyofitsrightsorobligationsundertheContractwithouttheCompany’spriorwrittenconsent.

14.8 TheContractcontainsallthetermswhichtheCompanyandtheBuyerhaveagreedinrelationtotheGoodsand/orServicesandsupersedesanypriorwrittenororalagreements,representationsorunderstandingsbetweenthepartiesrelatingtosuchGoodsand/orServices.TheBuyeracknowledgesthatithasnotreliedonanystatement,promiseorrepresentationmadeorgivenbyoronbehalfoftheCompanywhichisnotsetoutintheContract.NothinginthisCondition14.8willexcludeanyliabilitywhichonepartywouldotherwisehavetotheotherpartyinrespectofanystatementsmadefraudulently.

14.9 SaveassetoutinCondition8.7thepartiestotheContractdonotintendthatanyofitstermswillbeenforceablebyvirtueoftheContracts(RightsofThirdParties)Act1999byanypersonnotapartytoit.

14.10 AnynoticeinconnectionwiththeContractwillbeinwritingaddressedtotheotherpartyatitsregisteredoffice,orprincipalplaceofbusinessandwillbedeliveredbyhand,orfirstclassorspecialdeliverypostorAirmail.Thenoticewillbedeemedtohavebeendulyserved,ifdeliveredbyhand,whenleftattheproperaddressforserviceorifmadebypre-paid,firstclasspostorspecialdeliverypost,48hoursafterbeingpostedorinthecaseofAirmail,14daysafterbeingposted.

14.11 Theformation,existence,construction,performance,validityandallaspectswhatsoeveroftheContractorofanytermoftheContractwillbegovernedbyEnglishlaw.TheEnglishcourtswillhaveexclusivejurisdictiontosettleanydisputewhichmayariseoutof,orinconnectionwiththeContract.Thepartiesagreetosubmittothatjurisdiction.

14.12 WherePartIIoftheHousingGrants,ConstructionandRegenerationAct1996applies,eitherpartymayreferanydisputeordifferencearisingunderthisAgreementtoadjudication.TheadjudicationproceduresandtheagreementfortheappointmentofanadjudicatorshallbesetoutintheModelAdjudicationProcedurespublishedbytheConstructionIndustryCouncilcurrentatthedateofreference.ThenominatingbodyshallbetheTechnologyandConstructionSolicitors’Associationoranysuccessororganisation.

14.13 TheBuyerwillkeepconfidentialanyandallConfidentialInformationthatitmayacquire.TheBuyerwillnotusetheConfidentialInformationforanypurposeotherthantoperformitsobligationsundertheContract.TheBuyerwillensurethatitsofficersandemployeescomplywiththeprovisionsofthisCondition14.13.TheobligationsontheBuyersetoutinthisConditionwillnotapplytoanyinformationwhichispubliclyavailableorbecomespubliclyavailablethroughnoactoromissionoftheBuyeroriftheBuyerisrequiredtodisclosebyorderofacourtofcompetentjurisdiction.

Revised24thNovember2015

E&OE

27INDEX

Quartz Sand 17

SCHÖNOX AP 9

SCHÖNOX APF 9

SCHÖNOX AST 9

SCHÖNOX DOUBLE STICK 15

SCHÖNOX DSP 10

SCHÖNOX DUROCOLL 14

SCHÖNOX EMICLASSIC 13

SCHÖNOX FPL PLUS 10

SCHÖNOX IFLOOR 14

SCHÖNOX LC POWDER & LIQUID 10

SCHÖNOX LINO XTREME 13

SCHÖNOX PU 900 14

SCHÖNOX RENOTEX 17

SCHÖNOX RR 11

SCHÖNOX SDG 7

SCHÖNOX SHP 7

SCHÖNOX SL 11

SCHÖNOX TACKIFIER 15

SCHÖNOX TS 17

SCHÖNOX UNITECH 13

SCHÖNOX VD 7

SCHÖNOX XA 9

SCHÖNOX ZM RAPID 10

Sika Barrel Gun 21

Sika Hand Wipes 22

Sika Remover-208 22

Sika Thinner C 22

Sika Thinner EG 22

Sika Tramex Hygrometer 17

Sika Tramex Moisture Meter 17

SikaBond AT-80 20

SikaBond MS Wood Floor 20

SikaBond MS Wood Floor Gun Grade 19

SikaBond Silent Layer Mat 19

SikaBond T2 Adhesive 19

SikaBond-52 Wood Floor 19

SikaBond-54 Wood Floor 20

SikaBond-5500 S 20

Sikafloor-155WN 21

Sikafloor-81 EpoCem 21

Sikafloor-156 7

WP/2

50

/Ja

nu

ary

20

18

D

R/Flo

ori

ng

/Sik

a_

Sch

on

ox C

om

bin

ed

bro

ch

ure

D

ece

mb

er

20

17

SCHÖNOX is a brand of the SIKA Group

Sika Limited

Watchmead, Welwyn Garden City,

Hertfordshire, AL7 1BQ

Tel.: 01707 394444

E-Mail: [email protected]


Recommended