+ All Categories
Home > Documents > carrborocitizen.com u Carrboro’s CommUnitY newspaper u … · lic libraries across the county...

carrborocitizen.com u Carrboro’s CommUnitY newspaper u … · lic libraries across the county...

Date post: 10-Jul-2019
Category:

Documents
Upload: dokhanh
View: 214 times
Download: 0 times
Download Report this document
Share this document with a friend
10
This Weekend FRIDAY 40% Chance of Rain 88/68 SATURDAY 40% Chance of Rain 88/70 SUNDAY 40% Chance of Rain 90/68 carrborocitizen.com JULY 17, 2008 u CARRBORO’S COMMUNITY NEWSPAPER u VOLUME II NO. XVIII FREE INSIDE Girls Rock the Cradle See page 2 INDEX Music Calendar ................................................................................... 2 News ............................................................................................................. 3 Community ................................................................................ 4 Obituary ......................................................................................... 5 Opinion ......................................................................................... 6 Commentary ........................................................................................7 Land & Table ............................................................................. 8 Real Estate .................................................................................. 9 Classifieds .............................................................................. 9 False-foxglove? N ow, how can a flower be false? A flower either is or it isn’t! It seems ir- reverent to call any plant “false.” But I’m getting ahead of myself. I was all set to focus on yellow roadside composites (flowers in the aster and sunflower family) for this week’s Flora when I was redirected by a chance spotting of a different yellow wildflower on MLK Boulevard. They are just now coming into peak flowering. Driving north you will find them on the right woods-edge just beyond Blossom Lane. There is a little satellite dish just inside the woods-edge behind a sizeable population of Aureolaria virginica, false-foxglove. The common name, false-fox- glove, refers to the similarity to the cultivated pink foxgloves of western Europe. A more recently used com- mon name is oak-leach, a refer- ence to the plant’s association as a parasite on the roots of oak trees. Unlike most parasitic plants that lack significant foliage and depend on the host plant for sustenance, the Aureolaria sports numerous oppositely paired leaves on three-to-six-foot-high stems. Thus endowed, Aureolarias must be only semi-parasitic, caus- ing little if any harm to the host plant. Be assured, however, that, as with all things in nature, there is a significant, necessary associa- tion going on between these two plants. SEE FLORA PAGE 10 FLORA By Ken Moore Inside Commentary: Future of library services Page 7 Washing cars for running money RECENTLY . . . By Valarie Schwartz Even the abundance of recent rain could not remove the grunge from our drought-dirty vehicles, so the car wash at Carrboro High School last Satur- day brought an easy clean and helped the school’s cross country team raise funds for camp, travel and supplies. A new school builds a reputation on many levels, and according to assis- tant coach Sarah Hallenbeck the cross country team started its first year out on the right foot. “We had a very successful season even without seniors,” she said Sat- urday while taking a break from helping the students clean the per- petual line of cars that arrived dur- ing their four hours in the sun on the school parking lot. Coach Jay Crocker was out of town, but Hal- lenbeck happily spoke for the team. “We had some strong showings, with one student making it into the state meet,” swiftly carrying the new school’s name out of the region. It’s a small team, with only 45 on the roster, which for some students provided appeal. Rising junior Jacob Carl transferred from Chapel Hill High School, where he had found cross country too competitive because of the team’s size. “Carrboro gave me a chance to run more,” he said, adding that another reason for joining was to help him stay in shape for swimming and lacrosse, where he also participates. “I like run- ning. It’s good exercise to continue.” He has running role models in his father and grandfather. “My dad runs marathons — my grandpa ran two marathons this year.” Hanna Miller, also a rising junior, started running in eighth grade. “I like being part of a team,” she said. She also came from Chapel Hill High, where “it was really hard to get attention from the coach with 70 people on the team.” As one of 15 girls, she has enjoyed building the team. “ere are no divisions or cliques, it’s a good team.” SEE RECENTLY PAGE 5 PHOTO BY VALARIE SCHWARTZ Cross country runners of Carrboro High School washed cars Saturday with assistant coach Sara Hallenbeck (in black shirt) helping out PHOTO BY KEN MOORE False-foxglove, Aureolaria, is found beneath the canopy of oak trees. Carrboro Branch Library cuts under review by Susan Dickson Staff Writer Following public outcry regarding a recent slash in hours of operation at the Carrboro Branch Library, county officials say some of those hours could be restored. In late June, Orange County li- brary officials announced that due to cuts in temporary staff funding, pub- lic libraries across the county would reduce their hours of operation start- ing July 1. Although each branch manager made the decision as to how the cuts were allocated, Carrboro Branch Library director Jake Lehrer said because Carrboro relies so heav- ily on temporary employees he had no choice but to reduce the library’s hours of operation. e library cut its hours from 24 to 17 hours a week, with the library closed all day on Mondays and Fridays. “It basically cut our hours by 36 per- cent, right in the middle of summer, right when people need libraries the most,” he said. “Libraries are one of the very few things that are open to all people of all income levels.… ey’re one of the great equalizers, and when that is not available, that seems the most unfair.” County Manager Laura Black- mon said she was working with mem- bers of the Orange County Board of Commissioners and county staff to reallocate funding to the libraries. “We’re working on trying to rees- tablish those hours,” she said. “What I’m trying to work on now is to fig- ure out how to reinstate the hours for Carrboro and Cedar Grove. “We’re trying to pull funds to- gether.” e Cedar Grove Branch Li- brary reduced its hours from 36 to 28 hours per week and the Central Library reduced its hours from 64 to 60 hours per week. e Carrboro Cybrary did not reduce its hours. Blackmon said that each branch of the library has its own level of funding and that branch directors could choose how to allocate that funding. At the Carrboro Cybrary, for example, the di- rector chose to cut programs instead of hours, she said. Overall, the county budget cut fund- ing levels for non-permanent person- nel by an average of about 66 percent. Funding for temporary employees at all county libraries was reduced, with the Carrboro Branch Library’s funding re- duced by the highest percentage, about 63 percent. At the Carrboro Cybrary and at the Cedar Grove Branch Library, funding for temporary employees was reduced about 61 percent. SEE LIBRARY PAGE 7 Mission on Weaver St. by Catherine Rierson Staff Writer If you’ve been on Weaver Street at all in the past four months, you’ve probably seen a sign that reads, “e Episcopal Church of the Advocate.” Curious as to what that is? e Episcopal Church of the Ad- vocate is a mission church and an extension of the Episcopal/Anglican tradition, but the building on Weaver Street is just the vicar’s office. e Ad- vocate doesn’t have a permanent place to hold worship services yet, so it rents out space in the Chapel Hill Kehillah synagogue – an arrangement that ad- vances one of the church’s primary ob- jectives: reaching out to those drawn to less traditional worship. e house on Weaver Street and the space in Chapel Hill Kehillah are only temporary, though. According to the church’s vicar and its website, on April 1, 2008, with an initial payment of $500,000, the Advocate entered into a contract to buy land in Orange County on Homestead Road. SEE ADVOCATE PAGE 5 PHOTO BY JORDAN TIMPY Reverend Lisa Fischbeck, right, discusses passages from the Bible with Alane Kasrawi, far left, and Lauren Kilbourn Gaudett at a relaxed service at The Episcopal Church of the Advocate on Weaver Street Wednesday morning. Campaign finance bill approved by Kirk Ross Staff Writer e General Assembly authorized the Town of Carrboro to set a limit on campaign contributions for town races this week. e new legislation allows the town to change its election ordinances to limit contributions from individu- als to $250. e bill passed the state Senate in mid-May. e House passed a slightly different version in early July with a conference committee working out the differences in the versions, which mainly involved a timeline for action by the town in the House version. e legislation is scaled down com- pared to a bill that was held up last year after two candidates for local office — Sharon Cook and Katrina Ryan — and other residents petitioned Rep. William Faison to try and stop the measure. ey said the bill did not get a full hearing, a criticism that was disputed by town officials who said the bill was discussed as part of the proposed legislative agenda. Faison represents two precincts in northern Carrboro. SEE BILL PAGE 5 by Susan Dickson Staff Writer For more than 40 years, the Eno River Association has been working to protect the land that surrounds the Eno River, and within a year, the association could reach a long- sought goal: complete the missing links in the Eno River State Park. e Eno River Association has been working to protect the land around the river and in the water- shed area since 1966, with the goal of completing the gaps in the Eno Riv- er State Park to create a 6,000-acre park with 16 miles of river frontage. In addition, the association works to acquire land outside of the state park as well, to protect as much of the watershed area as possible and mini- mize the amount of sediment and nutrients that flow into the river. e association was started by a group of concerned citizens trying to prevent Durham from damming the river to create a reservoir. e group’s efforts were successful, and the state got involved with the group in pro- tecting the land around the river and created the state park. e 33-mile river, which winds through northern Orange County into Durham, flows into Falls Lake, a major source of drinking water for Wake County residents. e state park stretches along the river from Pleasant Green Road in Or- ange County to Roxboro Road in Durham. Occoneechee Mountain, though not adjacent, is part of the state park as well. According to Klugh Jordan, di- rector of land protection with the Eno River Association, the associa- tion is working on a number of land acquisitions that could complete the gaps in the state park. “We joke around about the fact that our mission is to work ourselves out of a job,” she said. “We really are steadily working toward completing the state park.” e state park, which now in- cludes 4,200 acres, features trails, campsites and more, with wide buf- fers to urban or residential areas. SEE ENO PAGE 10 Eno land protection close to major milestone PHOTO BY STEVE CLARKE Eno River State Park could include 6,000 acres and 16 miles of river frontage if the Eno River Association reaches its goal of filling in the missing links by next year. A CITIZEN SERIES F ollowing the River ENO
Transcript

  • This WeekendFriday 40% Chance of Rain 88/68

    SaTurday 40% Chance of Rain 88/70

    Sunday 40% Chance of Rain 90/68

    carrborocitizen.com JULY 17, 2008 u Carrboros CommUnitY newspaper u VoLUme ii no. xViii Free

    inSide

    Girls Rock the Cradle

    See page 2

    index

    Music Calendar ...................................................................................2News .............................................................................................................3Community ................................................................................4Obituary .........................................................................................5Opinion .........................................................................................6Commentary ........................................................................................7Land & Table .............................................................................8Real Estate .................................................................................. 9Classifieds .............................................................................. 9

    False-foxglove?

    Now, how can a flower be false? A flower either is or it isnt! It seems ir-reverent to call any plant false.

    But Im getting ahead of myself. I was all set to focus on yellow roadside composites (flowers in the aster and sunflower family) for this weeks Flora when I was redirected by a chance spotting of a different yellow wildflower on MLK Boulevard.

    They are just now coming into peak flowering. Driving north you will find them on the right woods-edge just beyond Blossom Lane. There is a little satellite dish just inside the woods-edge behind a sizeable population of Aureolaria virginica, false-foxglove. The common name, false-fox-glove, refers to the similarity to the cultivated pink foxgloves of western Europe.

    A more recently used com-mon name is oak-leach, a refer-ence to the plants association as a parasite on the roots of oak trees. Unlike most parasitic plants that lack significant foliage and depend on the host plant for sustenance, the Aureolaria sports numerous oppositely paired leaves on three-to-six-foot-high stems. Thus endowed, Aureolarias must be only semi-parasitic, caus-ing little if any harm to the host plant. Be assured, however, that, as with all things in nature, there is a significant, necessary associa-tion going on between these two plants.

    SEE FLOra PAGE 10

    FLORA By Ken Moore

    insideCommentary: Future of library services

    Page 7

    washing cars for running moneyrecenTLy . . . By Valarie Schwartz

    Even the abundance of recent rain could not remove the grunge from our drought-dirty vehicles, so the car wash at Carrboro High School last Satur-day brought an easy clean and helped the schools cross country team raise funds for camp, travel and supplies.

    A new school builds a reputation on many levels, and according to assis-tant coach Sarah Hallenbeck the cross country team started its first year out on the right foot.

    We had a very successful season even without seniors, she said Sat-urday while taking a break from helping the students clean the per-petual line of cars that arrived dur-ing their four hours in the sun on the school parking lot. Coach Jay Crocker was out of town, but Hal-lenbeck happily spoke for the team. We had some strong showings, with one student making it into the state meet, swiftly carrying the new schools name out of the region.

    Its a small team, with only 45 on

    the roster, which for some students provided appeal. Rising junior Jacob Carl transferred from Chapel Hill High School, where he had found cross country too competitive because of the teams size.

    Carrboro gave me a chance to run more, he said, adding that another reason for joining was to help him stay in shape for swimming and lacrosse, where he also participates. I like run-ning. Its good exercise to continue. He has running role models in his father and grandfather. My dad runs marathons my grandpa ran two marathons this year.

    Hanna Miller, also a rising junior, started running in eighth grade. I like being part of a team, she said. She also came from Chapel Hill High, where it was really hard to get attention from the coach with 70 people on the team. As one of 15 girls, she has enjoyed building the team. There are no divisions or cliques, its a good team.

    SEE recenTLy PAGE 5

    PHOTO By VALARIE SCHwARTzCross country runners of Carrboro High School washed cars Saturday with assistant coach Sara Hallenbeck (in black shirt) helping out

    PHOTO By KEN MOOREFalse-foxglove, Aureolaria, is found beneath the canopy of oak trees.

    carrboro Branch Library cuts under reviewby susan DicksonStaff Writer

    Following public outcry regarding a recent slash in hours of operation at the Carrboro Branch Library, county officials say some of those hours could be restored.

    In late June, Orange County li-brary officials announced that due to cuts in temporary staff funding, pub-lic libraries across the county would reduce their hours of operation start-ing July 1. Although each branch manager made the decision as to how the cuts were allocated, Carrboro Branch Library director Jake Lehrer said because Carrboro relies so heav-

    ily on temporary employees he had no choice but to reduce the librarys hours of operation. The library cut its hours from 24 to 17 hours a week, with the library closed all day on Mondays and Fridays.

    It basically cut our hours by 36 per-cent, right in the middle of summer, right when people need libraries the most, he said. Libraries are one of the very few things that are open to all people of all income levels. Theyre one of the great equalizers, and when that is not available, that seems the most unfair.

    County Manager Laura Black-mon said she was working with mem-bers of the Orange County Board of

    Commissioners and county staff to reallocate funding to the libraries.

    Were working on trying to rees-tablish those hours, she said. What Im trying to work on now is to fig-ure out how to reinstate the hours for Carrboro and Cedar Grove.

    Were trying to pull funds to-gether.

    The Cedar Grove Branch Li-brary reduced its hours from 36 to 28 hours per week and the Central Library reduced its hours from 64 to 60 hours per week. The Carrboro Cybrary did not reduce its hours.

    Blackmon said that each branch of the library has its own level of funding and that branch directors could choose

    how to allocate that funding. At the Carrboro Cybrary, for example, the di-rector chose to cut programs instead of hours, she said.

    Overall, the county budget cut fund-ing levels for non-permanent person-nel by an average of about 66 percent. Funding for temporary employees at all county libraries was reduced, with the Carrboro Branch Librarys funding re-duced by the highest percentage, about 63 percent. At the Carrboro Cybrary and at the Cedar Grove Branch Library, funding for temporary employees was reduced about 61 percent.

    SEE LiBrary PAGE 7

    Mission on Weaver St.by Catherine rierson Staff Writer

    If youve been on Weaver Street at all in the past four months, youve probably seen a sign that reads, The Episcopal Church of the Advocate. Curious as to what that is?

    The Episcopal Church of the Ad-vocate is a mission church and an extension of the Episcopal/Anglican tradition, but the building on Weaver Street is just the vicars office. The Ad-vocate doesnt have a permanent place to hold worship services yet, so it rents

    out space in the Chapel Hill Kehillah synagogue an arrangement that ad-vances one of the churchs primary ob-jectives: reaching out to those drawn to less traditional worship.

    The house on Weaver Street and the space in Chapel Hill Kehillah are only temporary, though. According to the churchs vicar and its website, on April 1, 2008, with an initial payment of $500,000, the Advocate entered into a contract to buy land in Orange County on Homestead Road.

    SEE adVOcaTe PAGE 5

    PHOTO By jORDAN TIMPyReverend Lisa Fischbeck, right, discusses passages from the Bible with Alane Kasrawi, far left, and Lauren Kilbourn Gaudett at a relaxed service at The Episcopal Church of the Advocate on weaver Street wednesday morning.

    campaign finance bill approvedby Kirk rossStaff Writer

    The General Assembly authorized the Town of Carrboro to set a limit on campaign contributions for town races this week.

    The new legislation allows the town to change its election ordinances to limit contributions from individu-als to $250.

    The bill passed the state Senate in mid-May. The House passed a slightly different version in early July with a conference committee working out the differences in the versions, which mainly involved a timeline for action by the town in the House version.

    The legislation is scaled down com-pared to a bill that was held up last year after two candidates for local office Sharon Cook and Katrina Ryan and other residents petitioned Rep. William Faison to try and stop the measure. They said the bill did not get a full hearing, a criticism that was disputed by town officials who said the bill was discussed as part of the proposed legislative agenda. Faison represents two precincts in northern Carrboro.

    SEE BiLL PAGE 5

    by susan DicksonStaff Writer

    For more than 40 years, the Eno River Association has been working to protect the land that surrounds the Eno River, and within a year, the association could reach a long-sought goal: complete the missing links in the Eno River State Park.

    The Eno River Association has been working to protect the land around the river and in the water-shed area since 1966, with the goal of completing the gaps in the Eno Riv-er State Park to create a 6,000-acre park with 16 miles of river frontage. In addition, the association works to acquire land outside of the state park as well, to protect as much of the watershed area as possible and mini-mize the amount of sediment and nutrients that flow into the river.

    The association was started by a group of concerned citizens trying to prevent Durham from damming the river to create a reservoir. The groups efforts were successful, and the state got involved with the group in pro-tecting the land around the river and created the state park.

    The 33-mile river, which winds through northern Orange County into Durham, flows into Falls Lake, a major source of drinking water for Wake County residents. The state park stretches along the river

    from Pleasant Green Road in Or-ange County to Roxboro Road in Durham. Occoneechee Mountain, though not adjacent, is part of the state park as well.

    According to Klugh Jordan, di-rector of land protection with the Eno River Association, the associa-tion is working on a number of land acquisitions that could complete the gaps in the state park.

    We joke around about the fact that our mission is to work ourselves out of a job, she said. We really are steadily working toward completing the state park.

    The state park, which now in-cludes 4,200 acres, features trails, campsites and more, with wide buf-fers to urban or residential areas.

    SEE enO PAGE 10

    eno land protection close to major milestone

    PHOTO By STEVE CLARKEEno River State Park could include 6,000 acres and 16 miles of river frontage if the Eno River Association reaches its goal of filling in the missing links by next year.

    A CITIzEN SERIES

    Following t he RiverENO

  • 2 thursday,JuLy17,2008 theCarrboroCitizen

    THURSDAY JULY 17ArtsCenter: 10by10inthetriangle:aninternationalfestivalofnew,10-minuteplays.8pm

    Local 506: brettharris,oscarbegat.

    Nightlight: irata,darwindeez,Lakeinferior.9:30pm

    The Cave: earLy:andybrasher.Late:ifyouWannas,sugarinthedirt.

    Reservoir: sicalps,Minchia,Jokes&Jokes&Jokes.

    Blue Horn Lounge:billWest.

    General Store Caf: JazzwiththetonyGalaniband.8pm

    FRIDAY JULY 18ArtsCenter: 10by10inthetriangle:aninternationalfestivalofnew,10-minuteplays.8pm

    Cats Cradle: dubConscious,dJrasJ.9:30pm

    Local 506: Caltrop(Cdrelease),theCurtainsofnight,diamondstuds.10pm

    The Cave: earLy:tammyro-chelle.Late:sleepsound,GoodnightMan.

    Blue Horn Lounge:davidspen-cerband.10pm

    General Store Caf: onesun.8:30pm

    SATURDAY JULY 19 ArtsCenter: 10by10inthetriangle:aninternationalfestivalofnew,10-minuteplays.8pm

    Cats Cradle: GirlsrocknC:nCGirlsrockCampshowcase.7pm

    Local 506: timbre,thebusyWorld,elfowl.9pm

    Nightlight: bellflur,VinylCordova.10pm

    The Cave: earLy:Cory&theGiants.Late:Puritanrodeo,thehotdamns.

    Open Eye Caf: rodieray.8pm

    Blue Horn Lounge:steveJackband.10pm

    General Store Caf: Leroysav-ageband.8:30pm

    SUNDAY JULY 20ArtsCenter: 10by10inthetriangle:aninternationalfestivalofnew,10-minuteplays.3pm

    Local 506: theXyzaffair,adamarcuragi.9:30pm

    The Cave: Gretel

    The Station: doViFoundationCancerbenefit.4pm

    MONDAY JULY 21Local 506: bearColony.9:30pm

    Nightlight: Futureislands,earPWr,rongorongo.

    The Cave: stuCole&robertGriffin.

    TUESDAY JULY 22Local 506: tooth,tournament,ratJackson.9pm

    Nightlight: olafurarnalds,Pacificbeforetiger,GrossGhost.9:30pm

    The Cave: earLy:FeMMeFest.Late:PinkFlag,thehomewreckers.

    Reservoir: bloodcow,Colossus.10pm

    The Station: robertGriffinPiano.8pm

    Blue Horn Lounge:tokyorosen-thal.9pm

    wEDNESDAY JULY 23Nightlight: Vagabond,headline,oldFolks.9:30pm

    The Cave: earLy:FeMMeFestfeat.toriParks.Late:LamLam,thenewsouthtour.

    General Store Caf: Lovelyhouses.7pm

    THURSDAY JULY 24ArtsCenter: theMusicMan.7pm

    Cats Cradle: hieroglyphics,bluescholars,Knobody,Musab,tanyaMorgan.9:30pm

    Local 506: Popstomp(indiedancenightwithdJMixcake)

    The Cave: earLy:FeMMeFest.Late:tazhalloween,Valyumm.

    The Station: nearblindJames&harmonicabob.

    Blue Horn Lounge:torisparks.

    General Store Caf: Jazzw/boLankenau&Friends.8pm

    FRIDAY JULY 25ArtsCenter: theMusicMan.7pm

    Cats Cradle: tillyandtheWall,therubysuns,dolytoro.9:30pm

    Local 506: thestrugglers,Citified,Grayyoung.9:30pm

    Nightlight: newartica,rundanrun,easyCompany.9:30pm

    The Cave: earLy:FeMMeFestfeat.Comedyw/Michelle.Late:Jimmy&theteasers.

    The Station: PotatoGun,nikibarrband.

    Blue Horn Lounge:adrianduke.10pm

    Open Eye Caf: Catbirdseat.8pm

    General Store Caf: theMay-hawks.9pm

    Blue Bayou Club: spoonfulofsoul.9:30pm

    SATURDAY JULY 26ArtsCenter: theMusicMan.7pm

    Local 506: Fantan.10pm

    Nightlight: belovedbinge,LightPollution,saintPeterPocketVeto.10pm

    The Cave: earLy:FeMMeFestfeat.theLonesomedeparted.Late:MaryJohnson&therockers.

    Reservoir: transportation,bastardsword.10pm

    The Station: Clockworkballw/dJs.10pm

    Blue Horn Lounge:MarlaVickersband.10pm

    Open Eye Caf: theWatercallers.8pm

    General Store Caf: Maryrocap&Liseuyanik.8:30pm

    Blue Bayou Club: daMuthas.9:30pm

    MusiCCaLendar

    fr 7/18**($8/$10)dubconscious

    W/ dj ras jsa 7/19 nc GiRLs RocK cAMP

    sHoWcAsE(AGEs 10-17)**($5 donation)

    tH 7/24**($15)HiERoGLYPHics touR

    W/souls of miscHief, pep love, casual W/guests blue scHolars, knoWbody, musab, tanya morgan

    fr 7/25 tiLLY AndtHE WALLW/ruby suns anddoly toro**($12/$14)

    mo 7/28sHE & HiMfeaturing zooey

    descHanel & m. Ward W/freakWater**($16/$18)

    tu 7/29 iMMoRtALtEcHniquE (HiP HoP)

    W/dj gi joe, poison pen,da circle, j arcH**($12/$15)

    We 7/30 **($10)cosMic cHARLiE

    2 sEts GRAtEfuL dEAdsa 8/2 don dixon

    and tHe jump rabbits**We 8/6 MotHER

    tRucKERs**($8/$10)fr 8/8**($10/$12)

    sARAH LEEGutHRiL And joHnnY iRion

    W/jeff craWfordsa 8/9**($25)

    conoR obERst And tHE MYstic

    vALLEY bAndW/evangelicals

    tu 8/12tHE HoLdstEAdY**($15/$17)

    W/loved onesWe 8/13tHE

    HonoRARY titLEW/neW frontiers, paper rival**($10/$12)

    cAtscRAdLE.coM 919.967.9053 300 e. main street**AstERisKs dEnotEAdvAncE ticKEts @ scHooLKids REcoRds in RALEiGH, cd ALLEY in cHAPELHiLL, buLL citYREcoRds in duRHAM oRdER tix onLinEAt Etix.coM WE sERvE cARoLinA bREWERY bEER on tAP! WEAREA non-sMoKinG cLub

    LocAL 506 (cH)tu 8/12 cass mccombs

    fr 8/22 oneidaW/dirty faces

    fr 10/1o joHnatHan ricHman

    su 10/12 tHe Wedding present

    KoKA bootHAMPitHEAtRE (cARY)sA 7/26 - ($22.50/$37.50)

    AvEtt bRotHERsfR 8/8 - ($22.50/$37.50)WiLco W/bon ivERLincoLn tHEAtRE (RAL)

    tu 7/29 - ($18)WoLf PARAdE

    W/WintERsLEEP

    tH 11/6 REvEREnd HoRton HEAt

    W/nAsHviLLE PussY,REcKLEss KELLY

    ALso PREsEntinG

    tHE ARtscEntER (cAR)

    sA 8/16 tHE nEvERW/un dEux tRois &cARY Ann HEARst

    disco RodEo (RAL)su 10/5 - ($22/$25)

    tHE bLAcK KEYsW/RoYAL bAnGs

    MEYMAndi HALL (RAL)sA 10/18 - on sALE 7/18tHE MAGnEtic

    fiELds

    cARoLinA tHEAtRE (duR)tu 10/7 - ($20/$25 REsERvEd)

    of MontREAL

    fr 8/8 Wilcokoka bootH ampitHeatre (cary) fr 8/15 tHE fAint

    W/jaguar love,sHy cHild**($20/$22)

    sa 8/16**($16/$18)tHE MELvins

    W/big businesstH 8/21 virginia coalition

    W/alexa Wilkinsonand luego

    fr 8/22 PERPEtuALGRoovE**($15/$20)

    sa 8/23**($16/$18)ARRoGAncE

    su 8/31 pre-labor daydAncE PARtY

    fr 9/5 tHE oLdcEREMonY**($10)We 9/10 stEPHEn

    KELLoGG & tHEsixERs W/gabe dixon

    band**($12/$15)tH 9/11**($12/$15)

    siLvER jEWsWe 9/17**($12/$14)

    toubAb KREWEfr 9/19WHos bAd?

    sa 9/20**($12 on sale 7/19)stREEt doGs

    W/time again, flat foot 56tu 9/23 revival tour:

    cHucK RAGAn(Hot Water music),bEn nicHoLs

    (lucero),tiM bARRY (avail)tH 9/25bLAcK KidsW/tHe virgins**($15/$17)

    fr 9/26RAtAtAt**($16/$18 on sale 7/18)

    sa 9/27**($9/$12)boMbAdiL

    mo 9/29 **($17)stEREoLAb

    W/atlas soundmo 10/13GiRL tALK

    W/grand buffet,Hearts of darkness**

    fr 10/17**($12/$15) cHAtHAMcountY LinE

    mo 10/20**($15/$17)coLd WAR Kids

    tH 11/13bAdfisHtribute to sublimeW/scotty dont**($16/$18)

    fr 12/5stEEP cAnYon RAnGERs**($12)

    mo 9/29 stereolab

    sa 8/2 don dixon and tHe jump rabbits

    sPotLiGht

    GIRLS ROCk NCthisnonprofitorganizationoffersprogramsthatencouragegirlstobeconfident,creativemembersoftheircommunities.theGirlsrocknCCampprogramprovidescamperswiththeopportunitytoorganizebandsandparticipateinworkshopsonsongwriting,recording,zine-making,diyclothingandmore.thecampfinaleisashowcaseperformanceatCatsCradleonsaturday,July19featuring8bandscomprisedofcampersages10andupperformingtheiroriginalsongswiththeirnewbands.theshowkicksoffat7p.m.anda$5donationisrequested,withallproceedsgoingtowardstheGirlsrocknCprogramandscholarshipsforgirls.

    Jimmyandtheteasers/theCave/July24

  • The Carrboro CiTizen News Thursday, JuLy 17, 2008 3Schools win grant

    ChapelHill-CarrboroCitySchoolsrecentlyreceiveda2008Carol M. White Physical Education Program grant totalingmore than $800,000 from the United States Department ofEducation.Thegrantwillbeawardedoverthreeyears,andisintendedtostrengthenthedistrictsphysicaleducationandac-tivityprograms.

    ChapelHill-CarrboroCitySchoolsisoneof98schooldis-trictsnationwideselected for thegrant.Thegrant isaimedathelpingschoolsmakeprogresstowardmeetingstatestandardsforPEforkindergartenthrough12th-gradestudentsbyprovid-ingequipmentandsupportforstudents,aswellasfundingforstaffandteachertrainingandeducation.

    ThegrantwillallowstudentstobenefitfromnewresourcesforPEinstruction,suchasclimbingwalls,circuittrainingequip-ment,heartratemonitors,andmore.Inaddition,thefundswillprovidedistrictPEteacherswiththeopportunitytoattendpro-fessionaldevelopmentprograms.

    Blood donors neededTheAmericanRedCrosssaysthatbloodinventorylevelsare

    low that it cannotmeet thedemandsof localhospitals. It iscallingforimmediatedonations,particularlyofOandAbloodtypes.TheblooddriveschedulefortheremainderofJulyisasfollows:

    July16 at theUNCStudentUnion from11 a.m. to3:30p.mandbehindUNCHospitalsfrom10a.m.to2:30p.m.Seeunc.givesblood.org; July 17 at Piedmont Electric in Hillsbor-oughfrom1to5:30p.m.Call732-2123.July18attheChurchofJesusChristofLatterDaySaintsInstituteonCountryClubRoadinChapelHill.Call660-2890.July26attheNewHopeVolunteerFireDepartmentonWhitfieldRoadinChapelHillfrom8a.m.to12:30p.m.Call493-3551.

    Toscheduleanappointmentcall1-800-448-3543.

    County library head retiresOrange County Library director Brenda Stephens has an-

    nouncedshewillretirefromherpositiononNov.1.Stephensbeganher librarycareer inOrangeCountymore

    than30yearsago,drivingthebookmobile.Shehasservedasli-brarydirectorsince1993,whenthelibrarysystemmovedunderOrangeCountygovernment.Inaddition,StephenshasservedastheregionaldirectorfortheHyconeecheeRegionalLibrarySystemgoverningCaswell,OrangeandPersoncounties.

    Withanewlibraryslatedtoopeninthespring,thesearchforanewdirectorwillstartimmediately.

    Green sneaksAlthoughitsprobablynotwithoutpinchednoses,eventhe

    kidsatUNCsCarolinaKidsCamparegoinggreentheyrerecyclingusedathleticshoes.

    Thecamptheme,CarolinaGoesGreen,isteachingchil-drenages6-12aboutrecyclingandotherenvironmentally-soundpractices.Aspartofthegreentheme,thechildrenarecollectingusedathleticshoestodonatetoNikesReuse-A-Shoeprogramtomaketherubbersolesintomaterialsforplaygroundsurfaces.

    BringanytiredexerciseshoestoPaulGreenTheatreDrive,off Country Club Road, during camp drop-off and pick-upfrom7:30a.m.to8:30a.m.and4:30p.m.to5:30p.m.weekdaysthroughAug.4.ShoescanalsobeleftduringthedayinRoom2416intheFrankPorterStudentUnion.

    News Briefs

    how to reaCh uS

    the Carrboro Citizen advertisingP.o. box 248 [email protected], nC 27510 919-942-2100919-942-2100 (phone)919-942-2195 (FaX) Classified & real estate [email protected] carrborocitizen.com/classif ieds 919-942-2100, 8 :30-3 M-F deadline is midnight Tuesday.onlinecarrborocitizen.com/mainstories are published online every Thursday. carrborocitizen.com/foodandfarm carrborocitizen.com/politics carrborocitizen.com/mill

    SubscriptionsThe Carrboro Citizen is free to pick up at our many locations around town, but if you would like to have us deliver your paper to your home, please visit carrborocitizen.com/subscribe

    W I N E B A R W I N E S H O P K I T C H E N

    Open Monday-Saturday Serving Dinner, 5-10 pm

    106 South Greensboro StreetCarrboro, North Carolina 27510

    919.967.9784 www.glasshalfull.net

    DOWNTOWN C ARRBORO SOWN OPTIMISTIC

    WINE BAR ,WINE SHOP& KITCHEN

    GHF carrboro citizen 3/5/08 2:05 PM Page 1

    Listen to community radio wcom 103.5fm

    Peck andArtisansgreen builders9338485

    Artisan: Ted Melchorfeliz cumpleaos a ti

    by Rich FowlerStaff Writer

    ChapelHillofficialssaytheyrepleasedtoseethataslateoflocalmeasurestheysoughthavenowclearedtheGeneralAssembly.

    Legislatorsrecentlypassednewlawsthatgivethetownthepowertoraisevehiclefees,regulatethedemolitionofhistoricbuildingsand better deal with parks and recreationneedsinnewdevelopments.

    Thetownnowhasthepowertoraiseve-hicleregistrationfeesbyanother$10,to$30per year. According to the N.C. Depart-mentofTransportation,therearemorethan36,000vehiclesregisteredinChapelHill,sotheextrafeewouldaddover$360,000ayeartoChapelHillTransitsbudget.Themoneywill go tohelppayoperatingcosts andex-pand services. Carrboro recently raised itsvehicleregistrationfeeby$10aswell.

    ChapelHillMayorKevinFoysaidthatinatimewhenmoreandmorepeopleareusingpublictransit,peoplewantmoreservices.

    We havent been able to add routes onSaturdays and Sundays, routes in the lateevening,thattypeofthing.Sothatwillgiveusmoreflexibility,hesaid.

    Thetownalsonowhasthepowertopasslaws to regulate the demolition of historicbuildings.

    Wewantedtobeabletoprovideasmuchprotection as possible for historic structures,and sohopefully that legislationwill giveussomemoreflexibilitywithregardtoprovidinganincentiveforsomebodywhoownsanhis-toricbuildingnottoknockitdown,Foysaid.

    He said that the town tries to provideincentives toprotecthistoricbuildings,butwhentheycantdothattheyneedtoprovidedisincentives to keep those buildings frombeingtorndown.

    The town can also pass an ordinancerequiring developers to pay the town in-steadofsettingasidelandinnewdevelop-mentsforparksandrecreation.ThemoneywouldgototheParksandRecreationDe-partment.

    Foysaidthatbecausemostnewdevel-opmentsintownarebeingbuiltinestab-lished neighborhoods, there are alreadyparksandrecreationfacilitiesinplace.

    Whatweneednowistobeabletoim-provetheparksandtobeabletoaccom-modatedifferentkindsofactivitiesintheparks,hesaid.

    Wehavea lotofneedsforourparks.Weneedimprovedsoftballfields,weneednewsoccerfieldsandwemayevenbeableto cobble together more land for a smallregionalparkthatwouldservealotofdif-ferentplaces.

    Chapel Hill council gets expanded powers

    by Catherine RiersonStaff Writer

    More than two dozen com-muters have returned to areapark and ride lots to discoverthattheirvehiclesnolongerhadacatalyticconverter.

    According to UNC policespokesperson Randy Young,in the last week of June, 13catalytic converters were sto-lenfromvehiclesattheFridayCenter park and ride lot andtheChathamCountyparkandride lot on US 15-501. Youngsaidthereweretwotheftsafter

    that,butsincethentherobber-ieshavethinnedout.

    We posted an officer downtheretopatrol and toassure aphysical presence in the lots,Youngsaid,addingthatUNCofficialsarealsoreviewingtheadditionofmoresecuritycam-erasaswellasadaypatrol.

    Catalytic converters areemissions-controldevicesmadewith small amounts of valuablemetals.Theycanfetchupto$200atscrapyards.Stealingaconvert-erisquickworkforthieveswithbattery-powered saws. SUVs areoftentargetedbecausetheirhigh-

    erclearancemakestheconverterseasiertogetat.

    The converter thefts adda new wrinkle to an ongoingproblem with thieves at thelots. Just from the Chathamlot alone at least $5,000 inauto parts have been stolensinceJune2007,andthatsnotincludingthemostrecentrashofrobberies.

    In12differentincidents,pa-trons of the Friday Center lothave seen more than $3,000worth of auto parts, includingstereoequipmentandsparetires,gomissing.

    Converter thefts plague park and ride lots Accident takes lifeof teenby Catherine RiersonStaff Writer

    Lilli Manis just gradu-atedfromChapelHillHighSchool inJuneandwasgo-ingtobeafreshmanatEarl-hamCollege,inRichmond,Ind. An artist, writer, avidfilm fan and musician cap-tivated by Japanese culture,sheplannedonmajoring inartandAsianstudies.

    Lillian Broox Manis, 17,waskilledonGlenwoodAv-enueinRaleighjustbefore5a.m.Saturday.AccordingtoRaleighpolice,aForddriverranaredlightonLynnRoadand hit the Honda Maniswasridingin.Herboyfriend,PhilipIavorovJurov,also17,ofDurham,drovetheHon-daandwasseriouslyhurt.

    The driver of the Ford,Justin Caleb Crouse, 19, ofRaleigh, was charged withdeathbymotor vehicle andassaultwith adeadlyweap-on.HewasreleasedfromtheWake County jail Mondayafterposting$50,000bail.

    According to the policereport,Crousewasapproach-ingGlenwoodonLynnRoadwhen he lost control of hiscarandranofftherightsideof the road. The car thenentered the intersection ofGlenwood, hitting the pas-senger side of the Honda.Both cars were going about50mphwhentheycollided.

    See the full obituary on page 5.

    Lilli Manis

    tents of hopeThe united Church

    of Chapel hill will host Tim nonn, national coordinator of Tents of hope, an advocacy movement for the people of darfur. nonn will give a sermon, themed We are all Connected, on July 27 at 8:45 and 11 a.m.

    The united Church of Chapel hill has a Tent of hope on its front lawn, designed and painted by churchgoers. The tent is intended to be symbolic of the tents used by the millions of refugees displaced by violence.

    UNC News Services

    Thesizeofthefinancialbur-den on families with disabledchildren largely depends onwhichstatetheylivein,accordingtoanewstudyconductedbytheschools of social work at UNCChapel Hill and WashingtonUniversityinSt.Louis,Mo.

    According to researchers,parents in states with higheraverage incomes face smallerburdens meaning in con-trast, more vulnerable fami-lies in poorer states often paymore of their own money tocover their disabled childrenshealth-carecosts.

    ThestudyfoundfamiliesinGeorgia fared the worst, pay-inganannualaverageof$972

    out-of-pocket to care for theirdisabledchildren.Thatsnearly$200 more, on average, thanfamilies spend nationwide onchildren with special health-careneeds.

    In North Carolina, out-of-pocketcostsalsoexceededthenationalaverage,withfamiliesspending$856annually.

    These are disturbing find-ings that highlight the highcosts families face in raisingtheir childrenwithdisabilitiesand health conditions, and itshows that the state in whicha family lives reallydoesmat-ter, said Susan Parish, an as-sistant professor at the UNCSchoolofSocialWork.Parishco-authored the study withPaul Shattuck, the reports

    lead investigator and an assis-tantprofessorofsocialworkatWashington University in St.Louis,Mo.

    Thestudy,whichwasfund-edbytheNationalInstituteofChildHealthandHumanDe-velopment,appearsintheJulyissueoftheAmericanAcademyofPediatricsjournal.

    Parishsaidthecostsofcar-ing for children with specialhealth-care needs are high,relative to those for typicallydeveloping children, becauseof their greater requirementsforbothprimaryandspecialtymedical care, aswell as thera-peutic and supportive servicessuch as rehabilitation, assis-tivedevicesandmentalhealth,homehealthandrespitecare.

    Health-care costs for disabled children vary by state

  • 4 Thursday, JuLy 17, 2008 Community The Carrboro CiTizen

    AniversariodeWeaverStreet

    La cooperativa celebre suvigsimo aniversario. Parti-cipeenlacelebracinycrearsu propia marioneta despusdeverelshowdemarionetas.Compartepastelconlosem-pleadosyotrosclientesmien-trasescuchenalamsicama-rimba.Actividadesempiezanalas1430h.Elsbado,19dejulio, 1430-1730h. WeaverStreet Market en SouthernVillage. 716 Market Street,ChapelHill,NC27516

    LosRayadosEl Club de Futbol Mon-

    terreylosrayadosdeMxi-co participe en un partidoamistoso con los Carolina-Railhawks este domingo, el20 de julio a las 1600h enWakeMed Soccer Park enCary.Entrada$10-50.Com-prarbilleten:101SoccerParkDrive,Cary,NC27511lunesaviernes,1000-1800h,findesemana,1000-1400h o llamealTicketmaster834-4000(ovisiteaLowesFoods).Caro-linaRailhawks859-5425.Pa-trocinadoporTECATE.

    CitizenCryptoquote By Martin BrodyFor example, YAPHCYAPLM is WORDSWORTH. One letter stands for another. In this sample, A is used for the two Os, Y for the two Ws, etc.. Apostrophes, punctuation, the length and formation of the words are all hints.

    Wise Coach

    F A I F M A I P R A B X I G Z A W L X M X S V

    U I R A S X R A U W G J X AYA I T S U S W H B X H D

    U T G G A U U L A G W T U A S J AV B I H S C H I Q

    Q J A H S I O T X S . R I U S R A H U T G G A A B

    L A G W T U A S J AV W Z A B A S A Z R X H A B

    S I . - D A I Z D A W M M A H , P I I S L W M M

    G I W G JThis weeks answer appears on page 8.

    SupeRcRoSSWoRd IWItneSS

    SpecialeventsLocallyGrown July 25, Cha-pel hill hosts a downtown event highlighting local food, crafts and music from 8-10:30pm.

    computerclasses free computer classes: internet, email, Word, excel, Powerpoint, nC Live. registration required. Wednesdays, through aug. 6, 7pm Century Center 918-7387 [email protected]

    FaithBuddhism buddhist teachings and meditation with Gen Tilopa of the Kosala buddhist Center 7-8:30pm Wednesday evenings. $10. First class free. 711 W. rosemary st (above Carrburritos). meditationinchapelhill.org 967-1861.

    tibetanBuddhistMeditation&Mindtraining Wednesdays, 7:30-9pm in July. Piedmont KTC Tibetan buddhist Meditation Center, 35 Perkins drive off Weaver dairy road in Chapel hill across from Timberlyne shopping Center. www.piedmontktc.org. 933-2138.

    AdventLutheran summer sunday worship 10am. 230 erwin rd, Chapel hill. 968-7680. adventlutheranch.org

    outdooractivitiesGuidedtours of the n.C. botanical Gardens Plant Collec-tions, every saturday at 10am. Free.

    GardeningAdvice The orange County Master Garden-ers provide a variety of garden-ing and landscaping information. home Garden Clinic at the nC botanical Gardens Totten Center

    on Wednesdays and Fridays from noon to 2pm. Call in questions at 962-0522 or speak in person. bring cuttings or photographs of damaged or stressed plants.

    Kidstoddlertime at the Car-rboro branch Library. every sa-truday at 10:15am. 969-3006 July 19: Miz Moon; July 26: baseball stories.

    preschoolStorytime at the Carrboro branch Library. saturdays at 11am.

    expressYourself! art program for ages 3-8 & their caregivers. saturdays, 10:45-11:15am, 11:30am-noon. $2 Kidzu Childrens Museum 105 e Franklin st 933-1455 kidzuchildrensmuseum.org

    VolunteersRSVp55+Volunteerpro-gram seeks volunteers to match other volunteers with opportunities for public service. 968-2056

    MealsonWheels seeks vol-unteers to deliver meals and/or bake simple desserts for recipi-ents in the Chapel hill/Carrboro area. 942-2948

    englishasaSecondLan-guageconversationclub seeks volunteers to talk with groups of international students Fridays from 11:30am-1:30pm. university Methodist Church on Franklin st. 967-1448, [email protected]

    Health&Wellnesscancersupport Weekly support free of charge for cancer patients and family. cornucopia-house.org

    thecompassionateFriends:Self-helpsupportafterthedeathofachild free and open to all adults grieving the loss of a child or sibling. Third Mondays, 7-8:30pm. evergreen united Method-ist Church. 967-3221. chapelhilltcf.org

    MuseumsGallerytour tour hecho a Mano: book arts of Latin america with curator Teresa Chapa. 5:45pm, Wednesday, July 23, Wilson Library. 962-4207.

    danceSwing July 19: music by edsel 500. $9 members, $11 others, $4 students. 7-8pm lesson with paid admission. dance 8-11:30pm. Triangle dance studio, 2603 south Miami blvd, durham. triangleswing-dance.org

    Havananights Cuban salsa. 1st and 3rd Thursdays, 10pm. Mansion 462, 462 W Franklin st, 967-7913, www.mansion462.net

    Salsa/Mambo 3rd saturdays, lesson 8pm, dance 8:30-11pm. $7, 358-4201, [email protected]. Fred astaire dance studio, 4702 Garrett rd, durham.

    Ballroom 4th & 5th Thursdays, 7-9:30pm, $2. 933-8982. seymour senior Center, 2551 homestead rd, Chapel hill, 968-2070

    carrborodanceJam free-style dance to an eclectic mix of music. First Fridays. balanced Move-ment studio. 304 W Weaver st, upstairs. smoke & alcohol free. Call 968-8776 for more info.

    Lectures,discussions&openMicsopenMic poetry, music & short fiction. Tuesdays, 7pm, Market street books & Maps, southern Village. 933-5111, mar-ketstreetbooks.com

    LiterarynewLibraryHours Car-rboro branch Library: closed Monday and Friday. Tuesday-Thurs 5-8pm, saturday 10am-2pm, sun-day 1-5pm.

    theBookthief Contempo-rary Fiction book Club meets to discuss the Markus zusak novel. July 29, 7pm. Carrboro Cybrary, 918-7387. [email protected]

    Journeytothecenteroftheearth The Movie/book Club meets to discuss the film and Jules Verne novel. see the movie or read the book and join in. Carr-boro Cybrary. 918-7387. [email protected] July 31, 7pm

    eat,pray,Love on Thursday, aug 14, 7:00pm, the Carrboread-ers non-Fiction book Club meets to discuss Eat, Pray, Love: One Womans Search for Everything Across Italy, India, and Indonesia by elizabeth Gilbert. Carrboro Cybrary. 918-7387.

    everythingisIlluminated Contemporary Fiction book Club meets to discuss the Jonathan safran Foer novel. august 28, 7pm. Carrboro Cybrary. 918-7387. [email protected]

    FilmtheVenusInstitute French w/ english subtitles. July 20, 5pm. ChiCLe, third floor,101 e Weaver st.

    politicsorangecountydemocraticWomen Meeting and discus-sion July 24, 7:30pm, at the Chapel hill Museum. discussion of taxes w/ guest speaker. all welcome.

    Smallispossible august 14, 7pm. Mcintyres Fine books. author Lyle estill discusses his book Small is Possible: Life in a Local Economy. Fearrington Village. 542-3030, www.fearrington.com

    communitycalendar

    doyouhaveanythingforoneofourcalendars?send your submissions to [email protected]

    noticiasenbreve

    petSoFtHeWeeKApSoFoRAnGecountY Hey!MynamesBosco,and i am full of personality and spunk! i often hear people ask around me, Who is that cat? and thats because i am always running through the halls or after a feather wand, making people shriek with delight. i can easily leap a persons height to catch toys and other objects of interest. i like other cats but have no problems occupying myself with anything i can bat around. you will enjoy me as your new family member if you like entertainment plus pizazz to spare. Come see me at animal Protection society of orange County, 6311 nicks road, Mebane, or call 304-2300. you can also go online at www.animalprotectionsociety.org

    oRAnGecountYAnI-MALSeRVIceSSnowWhite is more than just a beauty! This sweet girl is the whole fairy tale. shes around a year old and one of the most affectionate cats around. she is good with people of all ages, including kids, and even likes dogs! stop by orange Countys animal shelter, 1081 MLK Jr. blvd, Chapel hill or call 919-967-7383. you can also see her online at www.co.orange.nc.us/animalservices/adoption.asp

    iLLusTraTion by PhiL bLanK

    in season

    Comentarios, sugerencias y preguntas al [email protected] 1. What american bandleaders plane went missing over the english Channel

    in 1944 and was never recovered?

    2. What american author of The devils dictionary and The occurrence at owl Creek bridge disappeared in Mexico 1914?

    3. What was the last known location of edward V of england and his brother richard of shrewsbury, 1st duke of york, last seen in 1483?

    4. in what state did the Lindbergh kidnapping occur?

    5. What american aviator was reported missing on september 3, 2007 and although never found, declared dead in February 2008?

    6. What was the name of the american teenager that disappeared in aruba in 2005?

    7. What year did Jimmy hoffa disappear?

    8. The creator and host of americas Most Wanted was inspired by the kidnapping and murder of his 7 year old son. What was the sons name?

    9. Who was the 14 year old salt Lake City girl kidnapped in 2002 and found 9 months later in the company of a mentally bereft couple charged in the abduction?

    10. Megans Law was adopted after the kidnapping and murder of Megan Kanka. What does Megans Law do?

    tRIVIAAnSWeRS:1. Glenn Milller 2. ambrose bierce 3. Tower of London 4. new Jersey 5. steve Fossett 6. natalie holloway 7. 1975 8. adam Walsh 9. elizabeth smart 10. requires registration/monitoring of convicted sex offenders

    MARKdoRoSInStRIVIAFRoMHeLL This WeeKs hinT: :

    Carrboro resident Mark dorosin is the quizmaster each Wednesday at Trivia night at The station.

    COMMUNITY RADIOWHEN YOU ARENT READING

    YOUR CITIZEN, HOW DO YOU KNOW WHATS GOING ON IN TOWN?

    LISTEN TO COMMUNITY RADIO! WCOM 103.5 FM, YOUR COMMUNITY RADIO STATION!

    LISTEN ONLINE AT COMMUNITYRADIO.COOP.

  • The Carrboro CiTizen Thursday, July 17, 2008 5

    Tents of HopeThe United Church of Cha-

    pel Hill will host Tim Nonn, national coordinator of Tents of Hope, an advocacy move-ment for the people of Darfur, Sudan. Tents of Hope are artis-tic tents created by congrega-tions and other communities as focal points for learning about and helping war-torn Darfur. Tim Nonn will give a sermon, themed We are All Connect-ed, on July 27 at 8:45 and 11 a.m.

    The United Church of Cha-pel Hill has a Tent of Hope on its front lawn, designed and painted by churchgoers. The tent is intended to be symbolic of the tents used by the millions of refugees displaced by the vio-lence.

    Tents of Hope started in 2007 from a partnership be-tween churches and Sudan advocacy group Dear Sudan. The project encourages com-

    munities to shape the project and reach others to raise aware-ness of the ethnic warfare there, called genocide by the U.S. State Department.

    International saleInternationalist Books and

    Community Center will be holding a yard sale fundraiser on August 9 at 2408 Honey-suckle Road in Chapel Hill. The bookstore is accepting do-nations of books, clothes, furni-ture and other household goods and odds and ends at the store. Call 942-1740 first if you plan to donate large furniture. The sale starts early.

    Femme FestFrom July 22 to 26 The

    Cave and Mansion 462 will host Femme Fest to benefit the Girls Rock Camp of NC and the Rape Crisis Center of Cha-pel Hill. Each venue will host two bands each night, all with

    female leads, and donate the proceeds.

    Church lecturesThe Community Church of

    Chapel Hill, Unitarian Uni-versalist, will present its 2008 Straley lecture series on Sun-days in July and through Au-gust 10. The lectures start at noon with a lunch and end by 1:30 p.m. To register for child-care or for more information call 929-5983 or 942-5735. Speakers are members of the church that have volunteered or done outreach in fields like the environment, the Orange County Organizing Comittee, race relations and for South America.

    Youth leaguesThe Carrboro Recreation

    and Parks Department is spon-soring and co-sponsoring a number of sports opportunities for kids. Classes and leagues in-volve:

    The Mini-kickers Soccer Camp, July 21-24 from 8:30 to

    9:30 a.m. for ages 3-5. $35.Half Day Soccer Camp, July

    21-24 from 8:30-11:30 a.m. for ages 6-12. $95.

    Soccer C.L.A.S.S. (Children Learning Athletic Sports Skills) for kids and parents. Children age 4-6 and parents can learn the basic skills of soccer. Satur-days, 9 to 10 a.m. from Septem-ber 6 to October 11. The fee is $47 per child.

    Sandlot baseball for ages 9-12, weekly mornings in July.

    Fall baseball for ages 6-15 with a fee of $52 for County residents and $91 for those liv-ing outside the county.

    For more information on any program or to register call the Recreation and Parks de-partment at 918-7364.

    Coaches neededThe Carrboro Recreation

    and Parks Department is ac-cepting volunteer coach appli-cations for youth baseball and basketball programs. For infor-mation and an application, call 918-7364.

    Community Briefs

    reCenTlYfrom page 1

    Even with parents and car owners observing them, the students seemed relaxed and comfortable with each other as they worked together under the blazing sun.

    Rising sophomore Josie Hollingsworth said, I used to prefer solitary running by far over running with a group, but in the past sea-son with cross country Ive found group running to be much more enjoyable as well as challenging. People that do cross country are known as the loners, but training with the Carrboro team has proven to be quite the opposite.

    They were looking for-ward to next week when 22 members of the team will travel to Brevard for camp in preparation for a state meet in Clemmons. The car wash, which raised $630, will help pay the transpor-tation costs of those trips as well as competitions in Greensboro and Charlotte later in the school year.

    Cross country run-ning is an efficient way for busy kids to exercise one hour of daily prac-tice as opposed to the usual two-plus hours of other sports, Josie said. As much as wed like to say that the team has all different personalities, it takes a certain breed of person to want to run three miles as hard as they can and call it fun.

    Contact Valarie Schwartz at 923-3746 or [email protected] .

    OBITUArYlillian Broox Manis

    Lillian (Lilli) Broox Manis died in a tragic car collision in the early morning of July 12, 2008 on Glenwood Ave in Raleigh, NC. She was just one month shy of her 18th birthday, and was set to go to Earlham College in Richmond In-diana at the end of August. She is survived by her mother, Elizabeth, her father, Paul, and her younger brother, Cameron, her cat, Millo, her maternal grandmother, Lil-lian Hughes Webster, her paternal grandmother, Doris Manis, her uncles Mike Webster, Will Web-ster, Luke Manis, Thomas Manis, and her many friends from SAYF, Duke Young Writers Camp, Cha-pel Hill High School, and her many other friends whose lives she touched and loved throughout her short life. She was preceded in death by her maternal grandfather, Willie Broox Webster and her paternal grandfather, Jaye Parke Manis.

    Lilli was born at Johns Hop-kins Hospital in Baltimore Md. She spent her early years living in Columbia Md, where she at-tended Young School and Fulton Elementary. Lilli was talented at many things, and began playing viola in third grade, practicing with her father. After moving to Chapel Hill in 1999, she went on to play in the McDougle Middle School and Chapel Hill High School orchestras, and went on the Mozart 250th concert tour in Aus-tria in 2006. She graduated from Chapel Hill High School in June, 2008. She has been described by her family and friends as creative, independent, thoughtful, kind, sensitive, insightful, artistic, tal-ented, humorous, easy-going and beautiful. The family is very grate-ful for the memories and photos posted on the Facebook Web-site: Rest In Peace Lilli Manis (http://www.facebook.com/group.php?gid=22711931265).

    Lilli also loved Asian Studies, and especially Japanese culture. When she was just 3, she had her first Kimono and fans. She loved manga and Japanese movies. Her favorite animals were pandas and owls, and she had a large collection of owls from around the world.

    She was a talented artist in many ways, and worked in char-coal, pencil, watercolors, as well as digital media. Her favorite subjects were people, although she also drew animals, flowers and land-scapes. She had a tremendous eye for light, shape and shadow. Lilli learned to draw manga both on paper and on her computer.

    Lilli was a very talented writer. She attended Duke Young Writ-ers Camp for four years, and has many close friends from there. She especially liked to write poetry, and

    went to the poetry readings at the Regulator many times. She wrote wonderful essays and had tremen-dous insight into how to present her arguments, support them, and convince you of her viewpoint. She really enjoyed writing and consid-ered it as possible career. She had a web site that she worked on, and it will have her art work, poetry and short stories in the near future (http://www.hxresurrection.net).

    Lilli was an avid movie fan; her favorites being the Indiana Jones series, and all Harrison Ford mov-ies in particular. She was a big fan of the BBC TV series Dr. Who, and had the whole recent series on DVD and enjoyed watching it with her family, and then over again and again with her friends. Her musical tastes were diverse, running from classical to Mojave 3, the Decem-berists and the Grateful Dead, to Indie and more punk genres.

    Lilli was a great sailboat crew, racing on 2-person dinghys such as 420s for the RTP High School Sailing team, and on Tanzer 16s with her father and other sailors. She loved the higher winds with the spray and wind in her face, and could roll-tack and hike out with the best. She and her brother crewed together at the SAISA Gold Regatta in March, 2008, sailing for Chapel Hill High School. She designed the logo that appeared on the RTP High School sailing shirts and website. Lilli also participated in martial arts, earning a Red Belt in Taekwondo.

    Lilli was going to be a freshman at Earlham college, in Richmond Indiana, to major in art and Asian studies. She always wanted to go visit Japan, and had taken 4 years of Japanese in high school.

    She was loved very much and is missed by her Mom, Dad and brother Cameron tremendously.

    Memorial service for Lilli will take place on Saturday, July 19, 2008 at 1 p.m. in the Upper School Meeting Hall at the Caro-lina Friends School. The link to the CFS website which has directions is http://www/cfsnc.org/AboutCFS/directions.htm The exact location will be posted on the Facebook site (Rest In Peace Lilli Manis), or you may call Donna Hughes at 932-5832 with questions about the ser-vice or things that they might do.

    In lieu of flowers, the family asks that donations may be made to the Lillian Broox Manis Schol-arship Fund, at Earlham College, Alumni and Development Office, 801 National Road West, Rich-mond, Indiana, 47374, tel (765) 983-1313.

    Arrangements by Walkers Fu-neral Home of Chapel Hill, 120 W. Franklin Street, Chapel Hill, NC 27516 (919) 942-3861

    Condolences may be sent to www.walkersfuneralservice.com

    Deadline for early submissions is August 29Deadline for late submissions is September 22

    HAVE AN OPINION ABOUT BICYCLING IN AND AROUND

    CARRBORO?

    We want to hear it.

    WEDNESDAY, JULY 23, 20084 7 pm (drop in format)

    CARRBORO TOWN COMMONS(at the Wednesday FarmersMarket)

    For more information go to:www.greenways.com/pages/CarrboroBicycle.htmlOr call 918 7329.

    Community Realty

    Real Estate with a Real Purpose

    201 N. Greensboro Street, Carrboro919.932.1990

    Thursday, July 24 at 7 pm:Your Second Home and Beyond

    Saturday, August 2 at 10 am:100% Financing Workshop

    Call 932-1990 to register

    CommunityRealtync.com

    ADVOCATefrom page 1

    The 15-acre site includes a modest brick house, a small pond and thick woods. The re-maining $445,000 is to be paid by closing in April 2010 and the church is fundraising for an ad-ditional $300,000 for other im-provements on the site.

    The Episcopal Church of the Advocate was established by three surrounding Episcopa-lian churches: Saint Matthews Church in Hillsborough and the Chapel of the Cross and the Church of the Holy Fam-ily, both in Chapel Hill. Ac-cording to the Advocates vicar, Rev. Lisa Fischbeck, the three

    churches wanted a new type of Episcopalian presence in the Chapel Hill-Carrboro area that reflected the unique culture of the community.

    She said the words printed at the bottom of the Advocates sign Compassion, Justice, Transformation are at the core of the Advocates values, with Advocate denoting the Holy Spirit.

    Radical hospitality is equal-ly important to the Advocates purpose, Fischbeck said. The church focuses on community involvement, like the English as a Second Language classes they offer Tuesdays and Thursdays or the collaboration it has with Club Nova, where congregation members work with mentally

    ill citizens to understand their needs and to participate in ef-forts toward mental health care reform.

    Advocate members are also involved with the Orange Coun-ty Organizing Committee, an organization also in its embry-onic stage, working together for change in areas such as affordable housing, reducing the achieve-ment gap in the school system and environmental racism.

    We engage in advocacy for the community but engaged more as individuals with other individuals rather than an orga-nization, Fischbeck said. Its a different way to support those in the community, because ev-erything we do is based on rela-tionships.

    PhoTo by Jordan TimPymembers of The episcopal Church of the advocate gather Wednesday morning on the front porch of the congregations office building on Weaver Street. The church, lead by reverend Lisa fischbeck, center, recently purchased land on Homestead road to construct a more permanent place of worship.

    BIllfrom page 1

    Since then, Faison, Rep. Ver-la Insko, the bills main sponsor, and board of aldermen mem-bers Dan Coleman and Lydia Lavelle worked to find language agreeable to all parties.

    The measure allows the town

    to set contribution limits for the 2009 town elections, but expires 60 days prior to the filing start for the 2011 elections. In order for limits to apply to that and subsequent elections the board of aldermen will have to approve limits prior to each town election.

    Mayor Mark Chilton said he expects the board to discuss the legislation once it reconvenes af-

    ter the summer break. Chilton said that if the board decides to change the ordinance it would hold a public hearing, a require-ment under town rules.

    The limit on contributions mirrors similar legislation autho-rized for Chapel Hill, but does not include that towns requirement that require campaigns to report the source of donations over $20.

  • 6 Thursday, JuLy 17, 2008 Opinion The Carrboro CiTizen

    editorial

    robertdickson,[email protected]

    Kirkross,[email protected]

    Susandickson,[email protected]

    taylorSisk,[email protected]

    lizHolm,[email protected]

    JackCarley,[email protected]

    richFowler,[email protected]

    Michellelangston,[email protected]

    lucyButcher,editorialintern

    BetsyMcClelland,editorialintern

    Catherinerierson,editorialintern

    Jordantimpy,editorialintern

    advertiSing

    anneBillings,[email protected]

    oPerationS

    JacobMader,distributionChuckMorton,distribution

    Published Thursdays by Carrboro Citizen, LLC.

    letterSPoliCy

    Lettersshouldbenomorethan425wordsinlengthandmustbeaccompaniedbytheauthorsname,addressandcontactinformation.Wewillpublishoneletterperauthorpermonth.Lengthyletterswritteninlonghandwillmysteriouslybecomelost.Typedlettersarepreferredandemailevenmoreso.Thatsaid,sendyourlettersto:

    letterStotHeeditorBox248Carrboro,northCarolina27510

    eMail:[email protected]

    Fax:919-942-2195

    for The reCord

    Comprehensivesexeducationmakesforhealthierkids

    By Paige Johnson

    Kissingbabiesmakesforagreatphotoopwhenpoliti-ciansareonthecampaigntrail.Mostlegislatorsclaimtocareaboutchildren.Butwhathappenswhenyoungpeoplearebeyondtheageofaphotoop,whentheirbehaviorislessthancherubicorwhentheirneedsruncountertoalegisla-torspersonalbeliefs?

    Thechasmbetweenwhatlegislatorssayandwhattheydoispartiallytoblameforthesadstateofchildrenswell-beinginNorthCarolina.TheAnnieE.CaseyFoundationjustreleasedtheirannualreport,KidsCountDataBook,whichmeasureschildwell-beingandranksstatesaccordingly.

    NorthCarolinacamein38thinthenationforchildwell-being.Ourlowrankingisinlargepartduetochild-hoodpovertyandfactorsoftenrelatedtopoverty,liketeenpregnancy,inadequatehealthcareandviolence.

    Tobefair,childreninNorthCarolinahavechampionsintheN.C.legislature.Manyworkdoggedlytoimprovetheeconomicwellbeingofchildrenandtheirfamiliesbypush-ingforpolicieslikealivingwageandpaidsickdayssothatworkersmaycarefortheirfamilies.

    Manylegislatorsfightforgreateraccesstohealthcareforchildrenandtheirparentswhileotherschampionlegislationthatwillmakeschoolssaferbystandingupagainstbullying.

    NorthCarolinahasmadegreatstridesinchildwell-be-ing.In2006,ourstateranked41stintheKidsCountDataBook.Tomakegreaterdentsinchildhoodpoverty,legisla-torsmusttacklesomeoftheissuestheyavoidoutoffearofcontroversy.

    Taketeenagepregnancyforexample.Nationalstudiesshowthat33percentofgirlsand19percentofboyswhodropoutofhighschooldosobecausetheybecomeaparent.TheN.C.GeneralAssemblyhasmadecleartheircommit-menttodosomethingaboutNorthCarolinasalarminghighschooldropoutrate.Nearlyone-thirdofallstudentswhostarthighschoolinNorthCarolinadonotreceiveadiploma.

    AJointLegislativeCommissiononDropoutPreven-tionandHighSchoolGraduationwasconvenedtomakerecommendations.Theyspentmonthshearingabouttherootcausesofthisproblem,includingtheneedforteenagepregnancyprevention,teenageparentingsupportprogramsandmedicallyaccuratesexeducation.

    Theirfinalreportincludedmentionofteenagepregnancypreventionservicesandcomprehensivesexualityeducation.Unfortunately,whenthestateHouserolledaportionoftherecommendationsintothebudget,allmentionofteenagepregnancypreventionwasdeleted.Additionalfundsforsup-portingparentingteenagerswerealsocut.

    InNorthCarolina,53teenagegirlsbecomepregnanteveryday.Wehavethe9thhighestrateofteenpregnancyinthecountry.Almostthirty-percentofteenpregnanciesinNorthCarolinainvolveteenagerswhoarepregnantforasecondtime.Yet,abstinenceuntilmarriageonlyisthestandardhealthylivingcurriculuminourschools.

    Atsomepoint,legislatorsmustgrapplewiththefactthatmedicallyaccuratesexeducationisneededbecauseyoungpeopledeservetheinformationnecessarytomakerespon-sible,life-savingdecisions.

    Noonewantsteenagerstohavesexbutmanydo.Ifweregoingtoconvincemoreofthemtodelayhavingsex,thenweneedtobehonestwiththemabouttheoddstheyareupagainst.Weneedtoengageindifficultconversa-tionsthatincludegivingthemtheskillsnecessarytosaynobutalsotheinformationnecessarytoprotectthemwhentheysayyes.

    Teenagerswhohavebabiesaremorelikelytoliveinpov-erty.Theirchildrenaremorelikelytoliveinpoverty.Stand-ingupforthehealthandwell-beingofteenagersisnevergoingtobeaseasyaskissingbabies.ButNorthCarolinawillneverreachthenationalrankweaspiretountilwefacethechallengesfacingteenagers.

    Paige Johnson is the Director of Public Affairs at Planned Parenthood of Central North Carolina.

    letsstoppretending

    ChrisFitzsimon is right tocharacterize my opposition tothe bullying bill as havingnothing todowithbullying.(Standing up for all kids,July10,2008)Theflipsideofthischarge is thatsupport forthe bullying bill has nothingtodowithbullyingeither.Andtherein lies the problem: Theprimary aim of the bullyingbillisnottopreventbullying,buttoaddsexualorientationtothelistofprotectedclassesrec-ognizedbyNorthCarolina.

    Federal law recognizes sev-en protected classes. Sexualorientationisnotoneoftheseclasses, although some statesandlocalitiestreatitasapro-tectedclassthat,bydefinition,receives special protectionagainstdiscrimination.Settingaside the question of whethersexual orientation should ac-tuallybeaprotectedclass,theirony of the bullying bill isthat it has hindered genuinedialogue about sexual orien-tation precisely because ithasobscuredthe issuebehindamaskof pious solicitude forall Gods children. Protect-ing all Gods children wouldhave been better served bythe Senate version of the bill,whichavoided specifying thatcertaintypesofchildrenmeritextra special protection frombullying.

    Every person on earth isachildofGod,deservingofequalprotectionunderthelaw.Nooneisquestioningthisfact,and it is unfortunate that thebullying bills primary spon-sor, Rep. Rick Glazier, choseto frame the debate as beingabout eitherGodor children.Ifweweretobehonestaboutthetrueintentofthebullyingbill, though, itwouldbecomeobviousthattheschoolsystemisaterriblevenueforworkingthisquestionout.

    The bullying bill, for in-stance,doesnotdefine sexualorientationor gender identity.At what point is a teacher oradministratorsupposedtode-terminethatachildisahomo-sexual?Afterheengagesinaho-mosexualact?Howareteacherstoknowthat?Moreover,dontsuchacts,whethertheybeho-mosexualorheterosexual,con-tradictthestatescommitmenttoabstinence-only sexed?So,then, isa studenttobeclassi-fied as a homosexual merelybecausehemighthavecertaintendencies that are not beingacted upon? And what aboutkidswhoarebelowtheageofconsent,nottomentionyoungchildrenwhohavenodiscern-ablesexualorientationatall?Once we begin to ask thesedifficultquestions, it becomesapparent thatwe should leavekids out of this matter alto-gether.Iammorethanwillingtohaveadebateaboutwhethersexualorientationshouldbeaprotected class. But lets stoppretending this legislationhasanything todowith protect-ingchildren.

    dr. Jameson TayLorThe Civitas Institute

    Raleigh

    YourpapersJuly10tharticleonthereinstatementofsomeofthedroppedAPcoursesatCarrboroHighSchool isgoodnews.However, thereintroductionofthese courses for the coming year does not addressthe larger issueof the inevitable limitationsposedbyasmallhighschool,apparentlyplannedonthemodelofthenationalsmallhighschoolmovementheavilyfundedbytheBillandMe-lindaGatesFoundation.

    If, sadly, enrollmentnumbers are to be theprincipal determiningfactor in the number andlevel of course offeringsand teacher assignments,it stands to reason thatCarrboroHighwill nevermatch the wealth of aca-demicopportunitiesfoundin the other two schools,simplybecausetheyhavemorestudents.Thisunavoid-abledisparitywasclearlynotforeseenintheplanningofCarrboroHighSchoolasasmallhighschool.Norwasthedownsideofthisfactmadecleartoacommuni-tywhichtookredistrictinginstrideontheassumptionthat studentsassigned to thenewschoolwouldhaveaccesstothesamelevelofeducationthattheywouldhave received in the other two district high schools.Thatthishasnotturnedouttobesoisthecoreoftheproblemthatstudentsarefacingthisyear,andwillin-

    evitablyfaceinfutureyears,unlessmoreimaginativewaysarefoundtosharetheinstructionalwealthamongthedistrictsthreehighschools.

    Tobesure,somesolutionshavebeenofferedtotheseproblems:takingacourseatanotherschoolortakinganonlinecourse.Students,itisclaimed,canapplytotransfertooneofthedistrictsotherhighschools.Well

    and good, if the parentscanprovideacarandgasmoneyfortransportation,becausetheschoolsystemwill not. That this standis clearly discriminatorydoes not seem to bothertheadministrationatall.As for online courses,theyarenotavailable forall disciplines, and somehave been reported asgrosslyunsatisfactory.

    Muchneedstobedoneifthepressingproblemofaca-demicequityistoberesolvedamongthedistrictsthreehighschools.Thisisacommunitythatisclearlynotwill-ingtotakesecond-bestinoneofitsschools.Unfortunate-ly,thesizeofCarrboroHighSchoolisitselfalargepartoftheproblem.Creative,long-termplanningwillhavetobedonetofindwaysofsharingacademicofferingsacrosstheentiresystemandthesoonerthebetter!

    WiLLiam d. iLgenChapel Hill

    CHriSFitzSiMon

    Internal polls and worries about the Novemberelectionhangovermanyoftheimportantdebatesleftin the General Assembly as lawmakers begin whatmaybethelastweekofthelegislativesession.

    Billstoaddresstheroleofraceinthecapitalpun-ishment system, protect children from bullying atschool andmake itmoredifficult forpeoplewithaseriousmentalillnesstobuyagunareamongthecon-tentiouspiecesoflegislationbeforeHouseandSenatemembersthisweek.

    The issues have galvanized groups that often in-timidatelegislatorsintoworryingaboutretributionatthepolls:theReligiousRight,pro-gungroupsandthestatesdistrictattorneys.

    Thegroupsmaynotbeaspowerfulininfluencingtheoutcomeofelectionsastheyclaim,buteachtimetheyprevail ina legislativedebate theperceptionoftheirpowergrowsandthenbecomesmoreofarealityasthecircleofpoliticalfeartightensinaself-fulfill-ingprophecy,andthegroupsinfluenceinstatepolicybecomesmoreentrenched.

    And theres an even more powerful predictor ofwhowillreallyrunstategovernmentinthenextfouror eight years andwho itwill be run for, informa-tion that ismorepubliclyavailable than ever butlessanalyzedbythemediathaninpastyears.

    In the past few daysstate and federal candi-dates, political parties,and political action com-mitteeshavefiledtheirrequiredreportswithelectionsofficialsinRaleighandWashington.

    Withsomeexceptions,mostofthecoverageaboutthereportshasfocusedonwhoiswinningthemoneychase,whohasraisedthemostinthelastquarterandwhohasthemostcashinthebanktocommercialsthissummer.

    Thats useful information for the horse race.Moneystillequalscredibilityinpolitics,andpoliti-calfundraisinghasmuchincommonwithgettingaloanfromabank.Themoremoneyyouhave,themoremoneyyoucanget.

    Nottoomanyyearsagobeforeallthecampaignre-portswereavailableonline,reportersusedtoflocktotheBoardofElectionsandpainstakinglyporethroughthepaperfilings,withanalysesappearinginthenextdayspaperoronthatnightstelevisionnews.

    TheNews & ObserversUndertheDomeBloghasprovidedsomedetailsaboutthereportsfromthelead-ingcandidatesforgovernorandU.S.Senate,butnotmuchhasappearedinthepapersonortelevisionyet.Thatsnot the fault ofpolitical reporters.Most alsocover theGeneralAssembly as the staffing levels oftraditionaloutletscontinuestoshrink.

    Andthenewsisnotjustaboutthecandidates.In-formation is available about the states most power-ful political action committees.Citizens forHigherEducation,thePACofwealthysupportersofUNC-

    ChapelHillhas$229,000inthebankandhasalreadygiven$223,000tolegislativecandidates.

    Thatmighthelpexplainwhytheabsurdbreakforathletic boosters clubs snuck into the budget a fewyearsagoremainsonthebooks,costingtaxpayers$8millionayear.OrwhyUNCalwaysseemstodobet-ter thanother stateagencies in thefinalbudgetap-provedbytheHouseandSenate.

    OneofthecontributorstotheUNC-CHPACisFredMills,amemberoftheUNCBoardofGover-nors,whichisnotveryreassuringabouthisimpartial-ityontheBoard.

    The PAC of the Realtors Association has almost$1million in thebank ready togive to campaigns.Ithasalreadygiven$135,000tocandidatesthisyear.TheRealtorsbrothersinprotectingtheirprofits,theHomebuildersAssociation,has$390,000inthebankand has already passed on more than $150,000 incampaigncontributions.

    There are hundreds of important details in thecampaignreportsofthePACsandthecandidatesthatvotersshouldknowaboutandunderstandthecontextof,andtheyareallversionsofthesamestory.

    Thereportsexplainwhowillhave influence in thenextGeneralAssemblyandthenextadministrationin

    RaleighandthenextCon-gressinWashington.

    Recent news aboutthepresidentialcampaignsmakesthepointevenmoredirectly. The New York Times recently reportedthat Senator BarackObama had not been asforthcoming as promised

    about thenameof thebundlers tohis campaign, thepeoplewhohaveraisedfrom$50,000to$250,000.

    TheObamacampaignhassincemadethenamesmoreavailableandthereisareasontolookatthemandthesimi-larbigmoneypeoplefortheMcCaincampaign.

    Unless things change dramatically, many of thepeopleon the listswill be thenext administrationsambassadorsandtoppoliticalappointees.Forty-nineofthetopfundraisersforPresidentBushwerelaterap-pointedasambassadors,includingformerN.C.Com-merceSecretaryDavePhillipsandhisbrotherPhil.

    The News & Observer profiled Winston-Salembusinessman Jim Culbertson Sunday, who was re-cently named ambassador to the Netherlands afterraising$10million forBush in the last eight years.Culbertson tells theN & O that hehad repeatedlytoldtheWhiteHousethathedidntwantanythingforthemoneyheraised,thatinsteadhewouldrecom-mendhisfriends.

    Thatshowthenationstopdiplomatsareselected,byhowmuchmoneytheyortheirfriendsraised.Andthatswhowillhavethemostaccesstothenextgover-nor,thenextSenatorandthenextGeneralAssemblytoothepeopleandthecompaniesonthelist.

    Chris Fitzimon is director of NC Policy Watch.

    Its all on the lists

    This is a community that is clearly not willing to take

    second-best in one of its schools. Unfortunately, the size of

    Carrboro High School is itself a large part of the problem.

    Thats how the nations top diplomats are selected, by how

    much money they or their friends raised.

    LeTTer To The ediTor

    SmallsizelimitsCarrboroHigh

  • The Carrboro CiTizen Commentary Thursday, JuLy 17, 2008 7

    Walker BroWn Co.

    roofing andarChiteCtural

    Sheet Metal

    n.C general Contracting license #35623

    [email protected] box 187 carrboro nc 27510phone 942-0776 fax 942-0729

    roofS that Stand the teStS of tiMe

    they should have called

    Walker Brown.

    True CrafTsmenA Full-service Exterior business

    Decks RestoredWashed, Sanded, Sealed

    HousesPower Washed, Gutters Cleaned

    True CraftsmenInstallation, All Types Siding

    Roofing, Windows, DecksRepair Work As Well

    Planting & Flower BedsInstalled & Maintained

    Contact John Barrett919-619-8315/919-420-5013

    UPS & Freight ShippingCustom PackagingMailbox & Postal ServicesColor & BW PrintingeBay Power SellerMoving SuppliesPassport PhotosNotary ServicesBusiness Cards

    Carrboro Plaza Shopping CenterMoN-FRI 8-6:30 SAT 10-5

    919-918-71612003 United Parcel Service, Inc.

    Wednesday

    Copy Special!

    Color: 35BW: 5

    Email it:

    [email protected]

    Well print it out!

    Stay tuned.carrborocitizen.com

    The normally quiet and perhapsunderappreciated Carrboro Branch Library hasbeen much in the news lately. The controversywasprecipitatedbya35percentcut-backOrangeCountymadetothealreadyminimalhourstheCarrborobranchisopen.

    Fortunately,wehaveavigilantFriendsoftheCarrboro Branch Library organization, whichraised the alarm. On behalf of the board ofaldermen,MayorChiltonwrotetoCommissionerJacobs.Inreply,welearnedthatthecut-backwastheinadvertentresultofthecountysacross-the-boardcutintemporary,part-timestaffpositionsand that funds were being sought to restorelibraryhours.

    Throughthiscontroversy,questionshavearisenastothelong-termplansfortheCarrboroBranchLibraryandtherolethatourcitizensandaldermencanplayinensuringtheirexpeditedrealization.

    InNorthCarolina,countylibrarysystemsarethenorm.Thereare51countylibraries,15regional(multi-county libraries) and only nine municipallibraries(includingChapelHill).These75librariesoperateover300branchlibrariesacrossthestate.

    In October 2004, the county commissionersreceived a report on library services. Itrecommendedanewcentral county library,nowunderdevelopmentaspartoftheGatewayCenterinHillsborough,andasouthwestregionalbranch

    library combining the collections, staff, andservices presently located at McDougle MiddleSchoolandattheCenturyCenterCybrary.Thelatterrecommendationwasmadeinrecognitionofthe fact thatCarrboro is the largest town in thestatelackingafree-standinglibrary.

    Sincethen,membersoftheboardofaldermen,mostrecentlyMayorChiltonandAldermanRandeeHaven-ODonnell, have continued to meet withthecountycommissionersondevelopingaplanforlibrary needs. The commissioners have allocated$2.7 million in their future Capital InvestmentPlanfordevelopingalibrary.ChiltonandHaven-ODonnell areadvising themof sites appropriateforredevelopmentandofnewdevelopmentsinthepipeline.Asitehasyettobeidentified.

    We applaud the commissioners for theircommitmenttolibraryservicesandforrecognizing,

    inthewordsofwriterAnnHerbert,thatlibrarieswillgetyouthroughtimesofnomoneybetterthanmoneywillgetyouthroughtimesofnolibraries.

    Libraries across the country are increasinglycognizantoftheirroleinhelpingprovideresourcesonawiderangeoftopicsincludinghousing,food,financial literacy,parenting,health, aging, seniorservicesandlegalaid.AbigpartofthatisprovidingtheInternetaccessandassistancetohelppatronsaccess needed, up-to-date information. OrangeCounty has long held a high standard in theprovisioningofsocialservices,andlibraryservicesareincreasinglypartandparcelofthatmission.

    Most of the aldermen, with the exception

    of 20-year-veteran Jacquelyn Gist, are Johnny-come-latelies on the library issue as comparedto the handful of highly engaged citizens whoseinvolvementgenerallyprecedesourtenureinoffice.Ourgoalistojointhemasleadingadvocatesforthebranchlibrary.ButallOrangeCountycitizensareconstituentsofthecountycommissioners,andthosewhocareabout library servicesmustmaketheirvoicesheard.Contactthecommissionersandletyourconcernbeknown.

    Ifyouhaventdoneso,pleasejointheFriendsoftheCarrboroBranchLibrary(pickupamembershipform at the library) and become active. A smallgrouphasshoulderedtheworkforalongtimeandtheyneedyourhelp.

    WeinCarrboromustalsomakecommoncausewithChapelHill.Thisspring,MayorFoyaskedthecommissioners forhelpwith the severalhundredthousanddollarshortfallincountysupporttotheChapel Hill library. The best way to reduce thisburden on Chapel Hill is to complete the free-standingsouthwestlibraryinCarrboro.ThousandstothewestofChapelHillwillbelesslikelytodrivetotheChapelHillPublicLibrarywhentheywillbeabletogetcomparableservicesclosertohome.

    The board of aldermen will continue to stayengagedinthisissue.Weurgeyoutodosoaswell.And,please,letusknowyourconcernsorideas.

    Mark Chilton is the mayor of Carrboro. Dan Cole-man is a member of the Carrboro Board of Aldermen.

    The Carrboro Branch Library needs all our support

    Carrboro Mayor Mark Chilton (left) and alderman dan Coleman

    By Mark Chilton and dan ColeMan

    Library criticisms inaccurateA bumpy ride to a freestanding library

    All Orange County citizens are constituents

    of the county commissioners, and those who care about library services must make their

    voices heard.

    Margot MalaChowski

    I am compelled to respondto the numerous inaccuraciesregarding Orange CountyPublicLibrariesprintedinlocalnewspapers.

    Iunderstandthattheresidentsof Carrboro are upset by therecentcutstothebranchlibrary.ThesecutsarenotahitdirectedsolelyattheCarrboroBranchasimplied. BOCCs Barry Jacobspublicly stated that thecutsarearesultofcounty-wideactiontoreducetemporaryworkerfunds.

    I doubt that the librarydirectorcalledforanimbalancein operating hours in an overteffort to reduce services toCarrboro as implied. Basedupon my years (2004-2007) ofreporting toBrendaStephens, Iamcertain that she empoweredeach branch manager to makedecisions about how to handlethe system-wide cuts. It is verylikely that the manager of theCarrboro Branch made thedecision to close on Mondayswhereas the managers of theMainLibraryandotherbranchesmadedifferentdecisions.

    Linda Browner, on behalfof the Friends of the CarrboroBranch, comments that the2007-2008 budgetary cutseffectivelyremovedtheSpanish-speakingoutreachpositionfromthe library. This comment iscertainly inflammatory, but it

    is not accurate. The HispanicOutreach position originatedas a grant-funded position.When the grant monies ended,this position was paid for byfunds for temporary workers.Therewerenofundsearmarkedfor Hispanic Outreach. Thebilingualstaffmemberwhospenttime providing outreach to theSpanish-speaking communityleft her position in 2007 toacceptanotherjob.Herpositionwasnoteliminatedasimplied.

    The Friends of theCarrboroBranch persist in referring tothelibraryinHillsboroughasabranch.It isnot.It istheMainLibrary of Orange County,locatedinthehistoricdistrictof

    the county seat. That library isthe lifeblood of three branches:Carrboro Branch, the Cybraryand Cedar Grove Branch.Attacks against the MainLibrarytogainadvantageforthesouthernpartof thecountyarecounterproductive.

    I am discouraged thatresidentsofCarrborobelittletheneedsofthenorthernpartofthecountybaseduponthesizeofthepopulation. The needs north ofHillsborougharegreat,especiallyduring the difficult economictimes that Evelyn Danielreferredto.This isapopulationwithoutwirelessaccessavailablein restaurants,coffee shops andpublic spaces;without access toother libraries, bookshops andchildrensmuseums.

    David Hart of The Chapel Hill News notes that, Thepopulation of Carrboro and itsoutlying region is more thansufficient to support a fullyfunctioning library. I have nodoubtthatthepopulationwouldusea library,butclearlyneitherOrangeCountynortheTownofCarrborocanfinanciallysupporta fully functioning library inCarrboro. If that was possible,alltheuglyargumentswouldbemoot.

    Margot Malachowski is a former manager of the Cybrary and Carrboro resident.

    The needs north of Hillsborough are great... This is a population without wireless

    access available in restaurants, coffee shops and public spaces; without access to other

    libraries, bookshops and childrens

    museums.

    Jake lehrer

    When an Orange CountyOfficialreferredtotheCarrboroLibraryastheCarrboroCountryClubin1997,IknewourpathtoafreestandinglibraryinCarrborowouldindeedbebumpy.Thoughourpublic-servicehourshave(orshould I say had) increasedfrom 19 hours per week to 26by2008andourcirculationhadquadrupledduringthattime,nopermanent staff positions havebeen funded for the CarrboroLibrary in over 10 years. Evenwith our dramatic increase inhoursandcirculation,noincreasein permanent personnel hasever been realized. My requestsfor additional staff have beenignoredbylibraryadministrationforoveradecade.

    Howhasthelibrarysurvived,growing in service hours andcirculation so substantially,without any correspondingincreaseinpermanentstaff?Theanswer is, simply, through theconsistentuseofvolunteersandunpaidlibraryinterns.Currentlythe Carrboro Library employs

    1.67 full-time employees, anumbersimilartootherOrangeCounty branches, but ourcirculation figures are 10 timeshigher than either the CedarGrove Library or the Cybrary,and our collection outstripsboth branches by a multiple of20. Carrboro Branch Libraryoperates with approximately

    40hours perweekof volunteerand intern assistance. Thesededicated individuals currentlynumber13,allofwhomdevotebetween two to six hours ofserviceaweek.Thisdoesntcountthe many hours donated byFriendsoftheCarrboroLibrary:Nerys Levy, Mary-FrancesEldridge, Dolly Triantafillou,Martha Tyson, Linda Browner,Karla Reed, Heidi Perry, andAlexandra Brown. Our librarycouldnt functionwithout thesewonderful people, and I amindebtedtotheirselflessness.

    I think the citizens ofsouthwest Orange Countydeserve better library service,andthe36%cutintheCarrboroLibrary hours this fiscal yearis an affront that should notbe tolerated. Please make yourvoicesheard.

    Jake Lehrer will resign as direc-tor of the Carrboro Branch Library in September. He has worked in county libraries since 1984 and the Carrboro branch since 1996.

    I think the citizens of

    southwest Orange County deserve better library

    service, and the 36 percent cut

    in the Carrboro Library hours

    this fiscal year is an affront that should not be

    tolerated.

    liBraryfrom page 1

    Funding for temporary em-ployeeswasreducedbyabout28percentattheCentralLibrary.

    Accordingtocountyofficials,this years county budget wasparticularly tight because thecounty is scheduled toopen11new facilities, plus debt servicepayments on past projects arehigherthaninyeaspast.

    According to Lehrer, 65 per-centoftheCarrboroLibrarystaffaretemporaryorparttime,sothecountyscutstotemporarystaffingwereespeciallyhardonthelibrary.

    Ifeltthattheonlywaythatthe commissioners and OrangeCountywouldunderstandwhatthatdoestouswastoclosethedoors,hesaid.

    Lehrer, who recently an-nounced that he will resign hispositionSept.1,saidhefeelsthattheCarrboroBranchLibraryhasbeen consistently neglected byOrangeCountyLibraryadmin-istrationandgovernment.

    I think Orange County ingeneralhas a chipon its shoul-deraboutCarrboro,hesaid.IthinktheythinkofCarrboroasaprivilegedportionofthecountythatdoesntdeservewhattherestofthecountydeservesjustastheyviewChapelHill.

    Lehrer said the recent fund-ingcutswerethetippingpointforhisdecisiontoresign.HehasservedasdirectoroftheCarrboroBranchLibrarysince1996andhasworkedwiththeOrangeCountyLibrarysystemsince1984.

    Herewe are trying to serve20,000 people, now open 17hoursaweek,hesaid.

    Lehrer added that he has tocometothelibraryonthedaysitisclosedjusttoemptythebookdrop, which gets clogged withbooks.

    The Carrboro Branch Li-braryhasabout5,000registeredborrowers and circulates about5,000bookspermonth.

    Chapel Hill Mayor KevinFoyrequestedadditionallibraryfunding from the county com-missioners this year, citing sta-tistics that about 40 percent ofthelibraryspatronsareresidentsof Orange County outside ofChapel Hill. The Chapel HillLibrary isonlypartially fundedbythecountyabout11percentandmostofitsfundingcomesfromthetown.

    OrangeCountyBoardofCom-missionersChairBarryJacobssaidheexpectsthehourswillberein-statedattheCarrboroBranchLi-brary,addingthatheunderstoodthe concerns of residents regard-ingthereducedhours.

    Wewant toprovidequalitylibraryservicestoeverybody,hesaid. Wehave a system that iskindofdistortedbecauseChapelHillhasbeensogreataboutsup-portingitslibrary.

    Jacobssaidheanticipatesan-other tight county budget nextyear,andthatthecountyneedstofigureoutawaytobetterfunditslibraries.

    Therealityisweneedhelp,

    hesaid.However:Itsnotsome-thingthatcanjustchangeover-night;itsgovernment.

    TheCarrboroBranchLibraryisopenTuesdaythroughThurs-day from5to8p.m.,Saturdayfrom10a.m.to2p.m.andSun-dayfrom1to5p.m.

    They think of Carrboro as a

    privileged portion of the county that

    doesnt deserve what the rest of the county deserves,

    Jake Lehrer, branch Manager, Carrboro branch

    Library

  • 8 Thursday, JuLy 17, 2008 Land&Table The Carrboro CiTizen

    C ar r boro Far m er s mar k e T

    AnnualTomatoDaySaturdayJuly26,2008

    8:30AMuntilthematersrunoutCome find us under the gazebo that morning and explore many

    varieties of both slicing and cherry tomatoes grown by our vendors.

    CheckoutwhatsattheCarrboroYear-RoundFarmersMarket

    JuSTTonAMeAFew...

    blueberries, tomatoes, corn, cantaloupe, watermelons, peaches, blackberries, zucchini, yellow squash, peppers, cucumbers, basil, onions, garlic, pole beans, beets, potatoes, chard, fennel, vegetable and flower starters, sunflowers, lizianthus, snap dragons, sunflowers, zinnias, lilies, campanula, and many more flowers, baked goods (including vegan and gluten free options), breads, jams, wines, grass fed beef, pastured pork, pastured chicken, grass fed lamb, buffalo, sausage, chorizo, ground bison, raw milk cheeses, smoked cheeses, goat cheese, jams, jellies, pottery, hats, rugs and more!

    SATuRDAYS:7 a.m. - NoonweDneSDAYS:3:30 - 6:30 p.m.

    puz

    zle

    solu

    tio

    ns

    CRYpToquoTeAnSweR: People of mediocre ability sometimes achieve outstanding success because they dont

    know when to quit. most men succeed because they are determined to. George al-len, football coach

    Cliffs Meat MarketSizzling SavingS!

    corona extra, negra modelo, pacifico, budweiser!

    All NAturAl Ground Chuck

    $2.99/lb

    rib Eyes $6.99/lb

    All NAturAl Chuck roast

    $2.99/lb

    All NAturAl Chicken Cut to Order $1.29/lb

    baby Back ribs

    $3.99/lb

    NY Strip$6.99/lb

    Maple View Farms Milk!

    $3.95/gallon

    Chorizo Sausage$2.99/lb

    100 WeSt Main St., Carrboro919-942-2196 Mon-Sat 9am-6pm

    Debit& EBT

    Prices good thru 7/24/08

    Organic EggsBrown-$2.99/dozWhite-$1.99/doz

    Burritos, Tacos, Nachos and Margaritas!Burritos, Tacos, Nachos and Margaritas!Mon thru Sat 11am-10pm Closed Sunday 933.8226

    711 W Rosemary St . Carrboro www.carrburritos.com

    nCBGAugusteventsThe North Carolina Botanical Garden will host several

    eventsforthepublicinAugust.On August 2, enjoy a workshop, Local Flora: Summer,

    from9:30a.m.to12:30p.m.Aninstructorwillgiveclassroomlecturesandleadexplorationstoteachaboutavarietyoflocalhabitatsandthesummerswoodyandherbaceousplants.

    OnAugust9,theGardenwillhostKnowingandGrowingCarnivorousPlantsfrom1to3p.m.Staffwillteachabouttheconditionsthatsupportsoutheasternpitcherplantsandhowtogrowthem.Participantswillcreateandtakehomeaportableboggarden.Thereisafeeof$60,or$55forGardenmemberstopayforthetake-homegarden.

    OnAugust16,trainedtourguideswillofferatourofCokerArboretumfrom11a.m.tonoonandspeakonthehistoryofthearboretum.

    environmentalmeetingTheCarrborotownhallwillhostacommunityforumJuly29

    at7p.m.entitledEnvironmentalIssuesinthe2008Elections.TheeventissponsoredbytheTownHallandOWASAprecinctsoftheOrangeCountyDemocraticParty.DanielWhittle,staffattorney at the North Carolina Office of the EnvironmentalDefenseFund,will lead the forumanddiscusskey localandnationalenvironmentalissues,includingDukeEnergysCliff-sidecoalplant,offshoredrillingandglobalwarming.Formoreinformationseewww.owasadems.org.

    TomatotastingTheCarrboroFarmersMarketwillhostitsAnnualTomato

    DayJuly26,startingat8:30a.m.underthegazebo.Youcantrydifferentvarietiesoflocaltomatoes.Comeearlytomakesureyougetataste!

    Happy20,wSMWeaver StreetMarketwill hold its 20thAnniversaryCel-

    ebrationJuly19from2:30to5:30p.m.attheSouthernVillagelocation.Livemusicandentertainmentwillbeprovidedwithbirthdaycakeandballoons.

    LocalbooktalkMcIntyresFineBooksinFearrtingtonVillagewillhostDr.

    LyleEstilltodiscusshisbookSmall is Possible: Life in a Local Economy.ThebookfocusesontruestoriesofpracticalsolutionstonationalandinternationalproblemsfromChathamCounty.EstillisapresidentofPiedmontBiofuelsandlivesinMoncure,NorthCarolina.

    JordanLakeArts&MusicMarkyourcalendars forSaturday,October4andSunday,

    October5forthefirstoftheseasonJordanLakeArts&MusicFestival.SeventeenofNorthCarolinasfinestmusiciansandart-istswillbefeatured,includingtheSteepCanyonRangers,TheJohnBrownQuintet,YoMamasBigFatBooty,BigFatGapandTheUrbanSophisticates.

    Artsandcraftswillbeonexhibitthewholeweekendandfoodforeverypalettewillbeavailablebringyourinstrumentstoo,becausetherellbelotsofopportunitiesforjamming.

    Tohelpraiseawarenessofwaterpollution,therewillbesev-eralenvironmentalagencies,theSierraClubandtheHawRiverAssembly.Highlevelsofpollutionfromwastewaterplantsandfromrunoffthatcausesalgalbloomsandextremechemicalcon-ditionsallaffectJordanLaketheseagencieswillofferinfor-mation,acceptdonationsandvolunteers.

    Gatesopenat9a.m.onSaturdayOct.4,andwillclosethateveningat7:30p.m.Theywillreopenthefollowingmorning,Oct.5,withthesameschedule.CampingatthelocalcampsitesaroundJordanLakeisencouraged.ForFurtherinformationoncampsites, music schedule and band bios, visit: www.jordan-lakefarm.org.

    CommunityBriefs

    Free FridaysoWasa will waive the fee for boat users on university Lake on Fridays from July 18 to august 15. There is still a fee for

    renting an electric trolling motor. For a waiver, bring in a recent bill to prove you are an oWasa customer. if you have oWa-sa service but not a bill, bring identification that can confirm your address. university Lake is open Friday through monday from 6:30 a.m. to 6 p.m. Call oWasa at 942-5790 for more information.

  • The Carrboro CiTizen RealEstate Thursday, JuLy 17, 2008 9real estate

    Place YOUR ad at www.carrborocitizen.com/classifieds 24/7!!

    CaRRbOROWeaver street MarketThe artsCenterMilltownsouthern railCarrburritosamant PizzaVisart VideoPadgett stationMidway barber shopCarolina FitnessThe red henorange County social Clubspeakeasy outside boxWeaver street realtyCarrboro Family VisionWellness allianceCentury CenterCommunity realtyCarrboro business CoopGreat ClipsPhydeauxCybraryCapelliselmos dinerspotted dogPiedmont health servicesnice Price booksCarrboro Town hallCarrboro Town CommonsCarrboro Plaza Park & ride nationwide insuranceCliff s Meat MarketPTa ThriftshopJohnnys sporting GoodsCalvander Food MartCarrboro Mini Martshort stopCarrboro branch LibraryThe beehivedirty south improv

    auto Logicreservoir

    Carrboro Plazanorth american VideoTar heel Tobaccosuper sudsCurvesuPs storeWillow Creek CenterCarolina Clean. Laundromat

    ChaPel hillVisitors CenterJiffy Lubeinternationalist bookshams restaurtantTime outCarol Woods Job development Center3 Cups/CourtyardThe CaveWest Franklin town racks (near Chapel hill Cleaners)east Franklin town racks (near subway)Courthouse alleynorth Columbia st. town racks (at bus stop)breadmansChapel hill senior CenterChamber of CommerceChapel hill Public LibraryunC student unionbullshead bookshopn.C. botanical Gardeneubanks rd Park & ridehunan Chinese restaurantChapel hill Mini MartCup a JoeThat Coffee PlaceCovenant house

    M&r shop QuikCarolina Meadows Caf

    Governors Villagebean & barrelMailboxes, etcVincenzos ristorante

    MeadowmontLarussas deliThe Cedarsbrixx PizzaCaf Carolina

    Southern VillageMarket street booksLa Vita dolcePark & ride bus stopMarket square

    FearringtonMcintyres books

    Chatham CrossingTorrerosChatham CrossingMedical CenterChatham downsstarbucks

    hillSbOROUGhWeaver street MarketVisitors Centerdurham TechChamber of CommerceGovernment Centerorange Cty senior CenterValours PatisserieCup of JoesportsplexPittsboroPittsboro General storeChatham MarketplacePittsboro Public Library

    Pick us up! now at over 100 locations

    carrborocitizen.com

    PhOtO bY jORdan tiMPY

    Help WantedSaleS & marketing

    managerThe Carrboro Citizen, Carrboros community newspaper, is looking for a person with experience, en-thusiasm and an entrepreneurial spirit to take us to the next level. A great opportunity for a person with a background in ad sales and creative marketing. Email [email protected].

    SportSWriter The Car-rboro Citizen is seeking a sports-writer to compose and compile reports from local schools and recreation leagues. Terms and hours for this lightly compensat-ed yet greatly rewarding position are negotiable. Inquiries in writ-ing only to [email protected]

    Student reporterS Wanted Students at all local schools ar


Recommended
u Carrboro’s Community This Weekend Friday 60% Chance of Rain 76/52 SardayTu Partly Cloudy 79/54 Sunday Partly Cloudy 77/54 may 15, 2008 u Carrboro’s Community ... · 2015-4-28

u Carrboro’s Community This Weekend Friday 60% Chance of Rain 76/52 SardayTu Partly Cloudy 79/54 Sunday Partly Cloudy 77/54 may 15, 2008 u Carrboro’s Community ... · 2015-4-28

Documents

UNDERGROUND DD PROG KREMZAR MINE PROP€¦ · u-243 u-244 u-245 u-246 u-247 u-248 u-249 u-250 u-251 u-252 u-253 u-254 u-255 u-256 u-257 u-258 u-259 u-260 u-261 u-262 u-263 u-264 u-265

UNDERGROUND DD PROG KREMZAR MINE PROP€¦ · u-243 u-244 u-245 u-246 u-247 u-248 u-249 u-250 u-251 u-252 u-253 u-254 u-255 u-256 u-257 u-258 u-259 u-260 u-261 u-262 u-263 u-264 u-265

Documents

MILL - ibiblio · Liz holm, aRt DIRectoR zard39@gmail.com Marty cassady, aeDv RtIsIng DIRectoR marty@carrborocitizen.com anne billings, offe Ic ManageR anne@carrborocitizen.com contIR

MILL - ibiblio · Liz holm, aRt DIRectoR [email protected] Marty cassady, aeDv RtIsIng DIRectoR [email protected] anne billings, offe Ic ManageR [email protected] contIR

Documents

Color the pictures that begin with the letter U....Color the pictures that begin with the letter U. Easy Peasy Learners Nam e: Trace! U /u/u/u/u/u/u/ Uu uncle /U/U/U/U/ /U/U/U/U/U

Color the pictures that begin with the letter U....Color the pictures that begin with the letter U. Easy Peasy Learners Nam e: Trace! U /u/u/u/u/u/u/ Uu uncle /U/U/U/U/ /U/U/U/U/U

Documents

...c O c u o c o u u c c u u o 0 u u u c o u u c o c u o u u o C u u o c u u o N c o C c o u O u U u u u u u o u u u o u c c c u o u c u c u o u u c u o c u u o o u u o ...

...c O c u o c o u u c c u u o 0 u u u c o u u c o c u o u u o C u u o c u u o N c o C c o u O u U u u u u u o u u u o u c c c u o u c u c u o u u c u o c u u o o u u o ...

Documents

u experience u The Woodhouse Day Spa · 2019. 11. 27. · u u u u u u u u u u u u u u u u u u u u 2u menu of services t h e wo o d h o u s e day s pa® skin care our holistic approach

u experience u The Woodhouse Day Spa · 2019. 11. 27. · u u u u u u u u u u u u u u u u u u u u 2u menu of services t h e wo o d h o u s e day s pa® skin care our holistic approach

Documents

DIPUTACIÓNbogajo.com/archivos/MapaSalamanca2002.pdf · %u u% %u %u %u %u %u u% %u %u u% %u %u u% u% %u u% %u %u %u u% %u %u %u %u %u u% %u %u %u %u %u u% %u %u u% %u %u %u %u %u

DIPUTACIÓNbogajo.com/archivos/MapaSalamanca2002.pdf · %u u% %u %u %u %u %u u% %u %u u% %u %u u% u% %u u% %u %u %u u% %u %u %u %u %u u% %u %u %u %u %u u% %u %u u% %u %u %u %u %u

Documents

CArrboro Festval - ibiblio · Carrboro Music Festival carrborocitizen.com + September 2008 3 ... Goldberg Jazz - Jazz Improv & standards 5pm Wood, ... 4pm Gypsy Town - Original

CArrboro Festval - ibiblio · Carrboro Music Festival carrborocitizen.com + September 2008 3 ... Goldberg Jazz - Jazz Improv & standards 5pm Wood, ... 4pm Gypsy Town - Original

Documents

carrborocitizen.com u frEE ‘you could see the pride on ... · The 200-year-old persimmon tree on UNC Polk Place is well ... ‘you could see the pride on people’s faces ... the

carrborocitizen.com u frEE ‘you could see the pride on ... · The 200-year-old persimmon tree on UNC Polk Place is well ... ‘you could see the pride on people’s faces ... the

Documents

MILL - . – The Public's Library and Digital Archive DECEMBER 2011 + CaRRBoRoCitizEn.CoM/Mill 3 ROSS’S AlmAnAc rossalmanac.com/journal HOlidAy SpiRit ARt nOteS Maybe you’re not

MILL - . – The Public's Library and Digital Archive DECEMBER 2011 + CaRRBoRoCitizEn.CoM/Mill 3 ROSS’S AlmAnAc rossalmanac.com/journal HOlidAy SpiRit ARt nOteS Maybe you’re not

Documents

carrborocitizen.com FRee Transit tax to appear on Nov. ballot · carrborocitizen.com JUNE 7 2012 fi LOCALLY OWNED AND OPERATED fi VOLUME I NO. III FRee Ths Wi eekend FRiday Chance

carrborocitizen.com FRee Transit tax to appear on Nov. ballot · carrborocitizen.com JUNE 7 2012 fi LOCALLY OWNED AND OPERATED fi VOLUME I NO. III FRee Ths Wi eekend FRiday Chance

Documents

carrborocitizen.com u frEE ‘you could see the pride on ...

carrborocitizen.com u frEE ‘you could see the pride on ...

Documents

· PDF filed o o u o N o o O o . O o u u o o u o u o o u u u u u u u o u u o u o u o o o u o u u o u o o o u u u o u o o o u E o u u u u u o u o o o o o o u c o o u u o u o u

· PDF filed o o u o N o o O o . O o u u o o u o u o o u u u u u u u o u u o u o u o o o u o u u o u o o o u u u o u o o o u E o u u u u u o u o o o o o o u c o o u u o u o u

Documents

This Jaguar’s no powder puff · 2015. 4. 28. · This Weekend Friday Clear See page 4 65/34 SaTurday Clear 67/40 Sunday Partly Cloudy 67/41 carrborocitizen.com november 11, 2010

This Jaguar’s no powder puff · 2015. 4. 28. · This Weekend Friday Clear See page 4 65/34 SaTurday Clear 67/40 Sunday Partly Cloudy 67/41 carrborocitizen.com november 11, 2010

Documents

MILL - ibiblio · Plan something that you both enjoy or ... cupcakes, jewelry, ... line with the business’ name and contact information to margot@carrborocitizen.com

MILL - ibiblio · Plan something that you both enjoy or ... cupcakes, jewelry, ... line with the business’ name and contact information to [email protected]

Documents

HOMEOWNERS’ ASSOCIATIONS 1 AND · PDF filehomeowners Covenants and ... comprehensive document 12. Cedar Court Neighborhood Description ... Better reflect Carrboro’s progressive

HOMEOWNERS’ ASSOCIATIONS 1 AND · PDF filehomeowners Covenants and ... comprehensive document 12. Cedar Court Neighborhood Description ... Better reflect Carrboro’s progressive

Documents

HOMEOWNERS’ ASSOCIATIONS 1 AND ...HOA covenants cannot supersede local, state, or federal law Town of Carrboro’s Land Use Ordinances governing HOA’s: Article IV “Maintenance

HOMEOWNERS’ ASSOCIATIONS 1 AND ...HOA covenants cannot supersede local, state, or federal law Town of Carrboro’s Land Use Ordinances governing HOA’s: Article IV “Maintenance

Documents

carrborocitizen.com Free Hitting new highs

carrborocitizen.com Free Hitting new highs

Documents