+ All Categories
Home > Documents > Writing Words

Writing Words

Date post: 07-Nov-2015
Category:
Upload: chymyaa
View: 221 times
Download: 2 times
Share this document with a friend
Description:
words
25
For continuing a common line of reasoning: consequently clearly, then furthermore additionally and in addition moreover because besides that in the same way following this further also pursuing this further in the light of the... it is easy to see that To change the line of reasoning (contrast): however on the other hand but yet nevertheless on the contrary For opening a paragraph initially or for general use: admittedly assuredly certainly granted no doubt nobody denies obviously of course to be sure true undoubtedly unquestionably generally speaking in general at this level in this situation Transitional chains, to use in separating sections of a paragraph which is arranged chronologically: first... second... third... generally... furthermore... finally in the first place... also... lastly in the first place... pursuing this further... finally to be sure... additionally... lastly in the first place... just in the same way... finally basically... similarly... as well
Transcript

For continuing a common line of reasoning:

consequentlyclearly, thenfurthermoreadditionallyandin additionmoreoverbecausebesides thatin the same wayfollowing this furtheralsopursuing this furtherin the light of the... it is easy to see that

To change the line of reasoning (contrast):

howeveron the other handbutyetneverthelesson the contrary

For opening a paragraph initially or for general use:

admittedlyassuredlycertainlygrantedno doubtnobody deniesobviouslyof courseto be suretrueundoubtedlyunquestionablygenerally speakingin generalat this levelin this situation

Transitional chains, to use in separating sections of a paragraph which is arranged chronologically:first... second... third...generally... furthermore... finallyin the first place... also... lastlyin the first place... pursuing this further... finallyto be sure... additionally... lastlyin the first place... just in the same way... finallybasically... similarly... as wellTo signal conclusion:

thereforethishence in final analysisin conclusionin final considerationindeedFor the aforementioned reasonsFor the aforementioned reasons, there is no doubt thatTo sum up the foregoing,Given these factsIn conclusionIn closingTo conclude

To summarize

OverallTo summarizeIn summaryTo sum upParaphrasedBrieflyIn briefSumming up

To put it brieflyprcis - A sketchy summary, Make a summary (of)synopsis - A sketchy summaryapercu - A short synopsis

For the final points of a paragraph or essay:

Finally lastly

To restate a point within a paragraph in another way or in a more exacting way:

in other wordspoint in factspecifically

Sequence or time

afterafterwardsas soon asat firstat lastbeforebefore longfinallyfirst... second... thirdin the first placein the meantimelatermeanwhilenextsoonthen

To indicate time

AfterBeforeCurrentlyDuringEventuallyFinallyFirst, Second, etc.FormerlyImmediatelyInitiallyLastlyLaterMeanwhileNextOncePreviouslySimultaneouslySoonSubsequentlySubsequent - Following in time and orderHitherto, Heretofore - Used in negative statement to describe a situation that has existed up to this point or up to the present time, The sun hasnt rose hitherto.In due timeHenceforth

To indicate a result or an effect

Accordingly - because of the reason givenConsequentlyHenceSoThereforeThusThusly - In the way indicatedThence - From that fact or reason or as a resultTherefrom - From that circumstance or sourceThereof - Of or concerning this or that, From that circumstance or sourceCorollary - A practical consequence that follows naturally, "blind jealousy is a frequent corollary of passionate love"

To indicate more information

Besides - Making an additional point; anywayFurthermoreIn additionMoreoverLikewiseIndeed In truthIn factAlsoAs wellForemost - Ranking above all others; Preceding all others in spatial positionFirst, Second, Third, FinallyFirstly, Secondly, Thirdly

To indicate an example

For exampleFor instanceIn particularParticularly - Specifically or especially distinguished from othersSpecificallyTo illustrate

To demonstrateTo indicate a cause or reason

SinceBecauseBecause ofDue toForFor the reason thatAsInasmuch as - SinceWhereby - As a result of which, By which, "the means whereby we achieved our goal"

To express an opinionIn all due fairnessWith good judgment, (one/we may)To describe or make

vividportraydepictexhibitillustrateexposepresentpaint a portraitlimn - Trace the shape of, make a portrait ofdelineaterepresentdemonstrateconstitute - Form or composeembodied - (adj) Expressed byembody - (v) Represent or express in tangible formembodiment

To provemanifest - Provide evidence for; stand as proof ofattest - Provide evidence fortestify - Provide evidence forcertify - Provide evidence forendorse, indorse - Give support or one's approval toshew - Establish the validity of something, as by an example, explanation or experimentestablishinstance - (v) Clarify by giving an example ofexemplify - (v) Clarify by giving an example ofTo compare or contrast

WhereasIn comparisonIn contrastHoweverAlthoughOn the other handLikewiseSimilarlyButYetWithal - Despite anything to the contrary (usually following a concession)Withal - Together with thisNevertheless - Despite anything to the contraryNonetheless - Despite anything to the contraryNotwithstanding - Despite anything to the contraryEven so - Despite anything to the contraryAll the same - Despite anything to the contrary

To indicate certainty

TrulySincerelyGenuinelySurelyRightfullyAbsolutelyIndubitablyCertainlyWithout doubtNeedless to say

To indicate doubt

Most likelyMore likelyPossiblyProbablyDubitable - Open to doubt or suspicionDubious - Distressed with uncertainty or doubt

To provide a condition

provision, proviso - A stipulated conditionstipulate - Specify as a condition or requirement in a contractgivenifwhetherwheneverwhenwhile

To express positive words

magnificentgrandeur - The quality of being magnificent or splendid or grand, the quality of being exalted in character or ideals or conductmagnanimous - The quality of being exalted in character or ideals or conductFantasticfantasticalphenomenalwonderfulextraordinarymarveloussuperbgoodfinegreatavid - Emotionally desirableavid ambition to succeedexcellentspectacularprodigiousgrandbrilliantglorious - Bringing great happiness and thankfulnessillustrious - Widely known and esteemednotable - Worthy of noticerespectedimpressivesplendidsplendiferous - Having great beauty and splendorresplendent - Having great beauty and splendor, Richly and brilliantly colorfulflamboyant - Elaborately or excessively ornamented, Richly and brilliantly colorfulredoubtable - Having or worthy of prideformidable - Extremely impressive in strength or excellenceprowesssuperiorterrifictremendouswondrous - Extraordinarily goodwonderfulsublime - Inspiring awe, Lifted up or set highflair - natural talentknack - A special way of doing somethingoutshine - Attract more attention and praise than othersparamount - Having superior power and influencepredominantpreponderatingprevailing

To show intelligence

profoundshrewd hardheaded (practical experience and observation) intelligenceastuteacumen - Shrewdness shown by keen insightinsightfulsavvy - The cognitive condition of someone who understandscognition - The psychological result of perception, learning and reasoninggeniussmartsharpkeenmastermindEinstein - Someone who has exceptional intellectual ability and originalitywork of artfine artmaven - Someone who is dazzlingly skilled in any fieldmavin - Someone who is dazzlingly skilled in any fieldadept - Someone who is dazzlingly skilled in any fieldwhiz - Someone who is dazzlingly skilled in any fieldwizard - Someone who is dazzlingly skilled in any field

To intensify

incrediblyexceedinglytoppingly - extremely wellextremelyextraordinarilytrulyreallyveryutterly - Completely and without qualification; used informally as intensifiers, With sublimity; in a sublime mannerabsolutelyperfectlysublimelydramaticallysheer - (adj.) Complete and without restriction or qualification; sometimes used informally as an intensifier; (adv.) Directly "he fell sheer into the water"

Said

enounced, enunciated - Speak, pronounce, or utter in a certain waypronounced - Speak, pronounce, or utter in a certain wayarticulated - Express or state clearlyvocalized - Express or state clearlyposited - Put firmlystatedexpressedreportedalleged - Declared but not provedaverred - Report or maintain, To declare or affirm in a grave manner and formally as trueaffirmed, assertedwrotecomposedindited - Produce a literary workpenned - Produce a literary workspelt - Indicate or signifyvoiced, sounded - Give voice todemean - Reduce in worth or character, usually verbally

Noted (said)

remarkeddenoted - Be a sign or indication of, "Her smile denoted that she agreed"observedcommentedmentionedreferredannouncednoticed

VARIATIONS ON 'SAID'

announcedansweredarguedbeganbeggedbellowedbraggedchokedcalledclaimedcommandedcomplainedcrieddeclareddemandedexclaimedexplainedgaspedgiggledgroanedgrowledgrumbledgruntedhissedhootedinformedinquiredinsistedinterruptedjabberedjokedmentionedmurmuredmutteredorderedpleadedpledgedpoutedpromisedquestionedrambledremarkedreportedshoutedsighedsnappedspokesobbedstatedstormedstutteredsworetattledtoldutteredvoicedwarnedweptwhisperedyelled

Precisely

explicitlyaccuratelyexpresslyexactlyincisively

Numerous

innumerablemanyvariousseveraldiverseumpteenumteenmyriad (noun and adj.)

Praise

extol - (v) Praise, glorify, or honorexaltglorifylaudproclaimrevereidolizeworshipvenerate

Call Forth

evoke - Call forth (emotions, feelings, and responses)arouse - Call forth (emotions, feelings, and responses)elicit - Call forth (emotions, feelings, and responses)enkindle - Call forth (emotions, feelings, and responses)provoke - Call forth (emotions, feelings, and responses)inflame - Arouse or excite feelings and passionsawake - Stop sleepingconjure - Evoke or call forth, with or as if by magicinvoke - Evoke or call forth, with or as if by magicsummon - Gather or bring togetherinstill - deposit gradually

SYNONYMS FOR WORDS COMMONLY USED IN STUDENT'S WRITINGS

Amazing- incredible, unbelievable, improbable, fabulous, wonderful, fantastic, astonishing, astounding, extraordinaryAnger- enrage, infuriate, arouse, nettle, exasperate, inflame, maddenAngry- mad, furious, enraged, excited, wrathful, indignant, exasperated, aroused, inflamedAnswer- reply, respond, retort, acknowledgeAsk- question, inquire of, seek information from, put a question to, demand, request, expect, inquire, query, interrogate, examine, quizAwful- dreadful, terrible, abominable, bad, poor, unpleasantBad- evil, immoral, wicked, corrupt, sinful, depraved, rotten, contaminated, spoiled, tainted, harmful, injurious, unfavorable, defective, inferior, imperfect, substandard, faulty, improper, inappropriate, unsuitable, disagreeable, unpleasant, cross, nasty, unfriendly, irascible, horrible, atrocious, outrageous, scandalous, infamous, wrong, noxious, sinister, putrid, snide, deplorable, dismal, gross, heinous, nefarious, base, obnoxious, detestable, despicable, contemptible, foul, rank, ghastly, execrableBeautiful - pretty, lovely, handsome, attractive, gorgeous, dazzling, splendid, magnificent, comely, fair, ravishing, graceful, elegant, fine, exquisite, aesthetic, pleasing, shapely, delicate, stunning, glorious, heavenly, resplendent, radiant, glowing, blooming, sparklingBegin - start, open, launch, initiate, commence, inaugurate, originateBig - enormous, huge, immense, gigantic, vast, colossal, gargantuan, large, sizable, grand, great, tall, substantial, mammoth, astronomical, ample, broad, expansive, spacious, stout, tremendous, titanic, mountainousBrave - courageous, fearless, dauntless, intrepid, plucky, daring, heroic, valorous, audacious, bold, gallant, valiant, doughty, mettlesomeBreak - fracture, rupture, shatter, smash, wreck, crash, demolish, atomizeBright - shining, shiny, gleaming, brilliant, sparkling, shimmering, radiant, vivid, colorful, lustrous, luminous, incandescent, intelligent, knowing, quick-witted, smart, intellectualCalm - quiet, peaceful, still, tranquil, mild, serene, smooth, composed, collected, unruffled, level-headed, unexcited, detached, aloofCome - approach, advance, near, arrive, reachCool - chilly, cold, frosty, wintry, icy, frigidCrooked - bent, twisted, curved, hooked, zigzagCry - shout, yell, yowl, scream, roar, bellow, weep, wail, sob, bawlCut - gash, slash, prick, nick, sever, slice, carve, cleave, slit, chop, crop, lop, reduceDangerous - perilous, hazardous, risky, uncertain, unsafeDark - shadowy, unlit, murky, gloomy, dim, dusky, shaded, sunless, black, dismal, sadDecide - determine, settle, choose, resolveDefinite - certain, sure, positive, determined, clear, distinct, obviousDelicious - savory, delectable, appetizing, luscious, scrumptious, palatable, delightful, enjoyable, toothsome, exquisiteDescribe - portray, characterize, picture, narrate, relate, recount, represent, report, recordDestroy - ruin, demolish, raze, waste, kill, slay, end, extinguishDifference - disagreement, inequity, contrast, dissimilarity, incompatibilityDo - execute, enact, carry out, finish, conclude, effect, accomplish, achieve, attainDull - boring, tiring,, tiresome, uninteresting, slow, dumb, stupid, unimaginative, lifeless, dead, insensible, tedious, wearisome, listless, expressionless, plain, monotonous, humdrum, drearyEager - keen, fervent, enthusiastic, involved, interested, alive toEnd - stop, finish, terminate, conclude, close, halt, cessation, discontinuanceEnjoy - appreciate, delight in, be pleased, indulge in, luxuriate in, bask in, relish, devour, savor, likeExplain - elaborate, clarify, define, interpret, justify, account forFair - just, impartial, unbiased, objective, unprejudiced, honestFall - drop, descend, plunge, topple, tumbleFalse - fake, fraudulent, counterfeit, spurious, untrue, unfounded, erroneous, deceptive, groundless, fallaciousFamous - well-known, renowned, celebrated, famed, eminent, illustrious, distinguished, noted, notoriousFast - quick, rapid, speedy, fleet, hasty, snappy, mercurial, swiftly, rapidly, quickly, snappily, speedily, lickety-split, posthaste, hastily, expeditiously, like a flashFat - stout, corpulent, fleshy, beefy, paunchy, plump, full, rotund, tubby, pudgy, chubby, chunky, burly, bulky, elephantineFear - fright, dread, terror, alarm, dismay, anxiety, scare, awe, horror, panic, apprehensionFly - soar, hover, flit, wing, flee, waft, glide, coast, skim, sail, cruiseFunny - humorous, amusing, droll, comic, comical, laughable, sillyGet - acquire, obtain, secure, procure, gain, fetch, find, score, accumulate, win, earn, rep, catch, net, bag, derive, collect, gather, glean, pick up, accept, come by, regain, salvageGo - recede, depart, fade, disappear, move, travel, proceedGood - excellent, fine, superior, wonderful, marvelous, qualified, suited, suitable, apt, proper, capable, generous, kindly, friendly, gracious, obliging, pleasant, agreeable, pleasurable, satisfactory, well-behaved, obedient, honorable, reliable, trustworthy, safe, favorable, profitable, advantageous, righteous, expedient, helpful, valid, genuine, ample, salubrious, estimable, beneficial, splendid, great, noble, worthy, first-rate, top-notch, grand, sterling, superb, respectable, edifyingGreat - noteworthy, worthy, distinguished, remarkable, grand, considerable, powerful, much, mightyGross - improper, rude, coarse, indecent, crude, vulgar, outrageous, extreme, grievous, shameful, uncouth, obscene, lowHappy - pleased, contented, satisfied, delighted, elated, joyful, cheerful, ecstatic, jubilant, gay, tickled, gratified, glad, blissful, overjoyedHate - despise, loathe, detest, abhor, disfavor, dislike, disapprove, abominateHave - hold, possess, own, contain, acquire, gain, maintain, believe, bear, beget, occupy, absorb, fill, enjoyHelp - aid, assist, support, encourage, back, wait on, attend, serve, relieve, succor, benefit, befriend, abetHide - conceal, cover, mask, cloak, camouflage, screen, shroud, veilHurry - rush, run, speed, race, hasten, urge, accelerate, bustleHurt - damage, harm, injure, wound, distress, afflict, painIdea - thought, concept, conception, notion, understanding, opinion, plan, view, beliefImportant - necessary, vital, critical, indispensable, valuable, essential, significant, primary, principal, considerable, famous, distinguished, notable, well-knownInteresting - fascinating, engaging, sharp, keen, bright, intelligent, animated, spirited, attractive, inviting, intriguing, provocative, though-provoking, challenging, inspiring, involving, moving, titillating, tantalizing, exciting, entertaining, piquant, lively, racy, spicy, engrossing, absorbing, consuming, gripping, arresting, enthralling, spellbinding, curious, captivating, enchanting, bewitching, appealingKeep - hold, retain, withhold, preserve, maintain, sustain, supportKill - slay, execute, assassinate, murder, destroy, cancel, abolishLazy - indolent, slothful, idle, inactive, sluggishLittle - tiny, small, diminutive, shrimp, runt, miniature, puny, exiguous, dinky, cramped, limited, itsy-bitsy, microscopic, slight, petite, minuteLook - gaze, see, glance, watch, survey, study, seek, search for, peek, peep, glimpse, stare, contemplate, examine, gape, ogle, scrutinize, inspect, leer, behold, observe, view, witness, perceive, spy, sight, discover, notice, recognize, peer, eye, gawk, peruse, exploreLove - like, admire, esteem, fancy, care for, cherish, adore, treasure, worship, appreciate, savorMake - create, originate, invent, beget, form, construct, design, fabricate, manufacture, produce, build, develop, do, effect, execute, compose, perform, accomplish, earn, gain, obtain, acquire, getMark - label, tag, price, ticket, impress, effect, trace, imprint, stamp, brand, sign, note, heed, notice, designateMischievous - prankish, playful, naughty, roguish, waggish, impish, sportiveMove - plod, go, creep, crawl, inch, poke, drag, toddle, shuffle, trot, dawdle, walk, traipse, mosey, jog, plug, trudge, slump, lumber, trail, lag, run, sprint, trip, bound, hotfoot, high-tail, streak, stride, tear, breeze, whisk, rush, dash, dart, bolt, fling, scamper, scurry, skedaddle, scoot, scuttle, scramble, race, chase, hasten, hurry, hump, gallop, lope, accelerate, stir, budge, travel, wander, roam, journey, trek, ride, spin, slip, glide, slide, slither, coast, flow, sail, saunter, hobble, amble, stagger, paddle, slouch, prance, straggle, meander, perambulate, waddle, wobble, pace, swagger, promenade, lungeMoody - temperamental, changeable, short-tempered, glum, morose, sullen, mopish, irritable, testy, peevish, fretful, spiteful, sulky, touchyNeat - clean, orderly, tidy, trim, dapper, natty, smart, elegant, well-organized, super, desirable, spruce, shipshape, well-kept, shapelyNew - fresh, unique, original, unusual, novel, modern, current, recentOld - feeble, frail, ancient, weak, aged, used, worn, dilapidated, ragged, faded, broken-down, former, old-fashioned, outmoded, passe, veteran, mature, venerable, primitive, traditional, archaic, conventional, customary, stale, musty, obsolete, extinctPart - portion, share, piece, allotment, section, fraction, fragmentPlace - space, area, spot, plot, region, location, situation, position, residence, dwelling, set, site, station, status, statePlan - plot, scheme, design, draw, map, diagram, procedure, arrangement, intention, device, contrivance, method, way, blueprintPopular - well-liked, approved, accepted, favorite, celebrated, common, currentPredicament - quandary, dilemma, pickle, problem, plight, spot, scrape, jamPut - place, set, attach, establish, assign, keep, save, set aside, effect, achieve, do, buildQuiet - silent, still, soundless, mute, tranquil, peaceful, calm, restfulRight - correct, accurate, factual, true, good, just, honest, upright, lawful, moral, proper, suitable, apt, legal, fairRun - race, speed, hurry, hasten, sprint, dash, rush, escape, elope, fleeSay/Tell - inform, notify, advise, relate, recount, narrate, explain, reveal, disclose, divulge, declare, command, order, bid, enlighten, instruct, insist, teach, train, direct, issue, remark, converse, speak, affirm, suppose, utter, negate, express, verbalize, voice, articulate, pronounce, deliver, convey, impart, assert, state, allege, mutter, mumble, whisper, sigh, exclaim, yell, sing, yelp, snarl, hiss, grunt, snort, roar, bellow, thunder, boom, scream, shriek, screech, squawk, whine, philosophize, stammer, stutter, lisp, drawl, jabber, protest, announce, swear, vow, content, assure, deny, disputeScared - afraid, frightened, alarmed, terrified, panicked, fearful, unnerved, insecure, timid, shy, skittish, jumpy, disquieted, worried, vexed, troubled, disturbed, horrified, terrorized, shocked, petrified, haunted, timorous, shrinking, tremulous, stupefied, paralyzed, stunned, apprehensiveShow - display, exhibit, present, note, point to, indicate, explain, reveal, prove, demonstrate, exposeSlow - unhurried, gradual, leisurely, late, behind, tedious, slackStop - cease, halt, stay, pause, discontinue, conclude, end, finish, quitStory - tale, myth, legend, fable, yarn, account, narrative, chronicle, epic, sage, anecdote, record, memoirStrange - odd, peculiar, unusual, unfamiliar, uncommon, queer, weird, outlandish, curious, unique, exclusive, irregularTake - hold, catch, seize, grasp, win, capture, acquire, pick, choose, select, prefer, remove, steal, lift, rob, engage, bewitch, purchase, buy, retract, recall, assume, occupy, consumeTell - disclose, reveal, show, expose, uncover, relate, narrate, inform, advise, explain, divulge, declare, command, order, bid, recount, repeatThink - judge, deem, assume, believe, consider, contemplate, reflect, mediateTrouble - distress, anguish, anxiety, worry, wretchedness, pain, danger, peril, disaster, grief, misfortune, difficulty, concern, pains, inconvenience, exertion, effortTrue - accurate, right, proper, precise, exact, valid, genuine, real, actual, trusty, steady, loyal, dependable, sincere, staunchUgly - hideous, frightful, frightening, shocking, horrible, unpleasant, monstrous, terrifying, gross, grisly, ghastly, horrid, unsightly, plain, homely, evil, repulsive, repugnant, gruesomeUnhappy - miserable, uncomfortable, wretched, heart-broken, unfortunate, poor, downhearted, sorrowful, depressed, dejected, melancholy, glum, gloomy, dismal, discouraged, sadUse - employ, utilize, exhaust, spend, expend, consume, exerciseWrong - incorrect, inaccurate, mistaken, erroneous, improper, unsuitable

ADJECTIVES FOR WRITING REVIEWSThe AuthorCultured, intellectual, well-read, erudite.Sage, sensible, rational.Philosophic, analytical, imaginative, perspective, visionary, prophetic.Optimistic, broad-minded, idealistic, religious, orthodox, sympathetic.Sophisticated, unsophisticated.Original, clever, witty, humorous, whimsical.Conservative, progressive, radical, reactionary, unprejudiced, realistic, romantic.Uncultured, unintellectual, shallow, superficial.Bigoted, opinionated, intolerant, critical, fanatical.Provincial, narrow-minded, pessimistic, cynical, egotistical, sentimental.GeneralLucid, graphic, intelligible.Explicit, precise, exact.Concise, succinct, condensed, pithy.Poetic, plain, simple. homely, pure.Vigorous, forceful, eloquent, fluent, clean, clear.Natural, restrained.Smooth, polished, classical, artistic.Bombastic, extravagant, pompous, grandiose, obscure, vague.Diffuse, verbose.Ungraceful, harsh, abrupt, awkward, unpolished, crude, vulgar.Formal, artificial.The DictionPrecise, exact, concrete.Plain, simple, homespun.Learned, cultured, literal, figurative.Connotative, symbolic, picturesque, sensuous.Literary, provincial, colloquial, slangy.Inexact, non-specific.Bombastic, trite, artificial, obscure, grotesque, vulgar.The SentencesLoose, periodic, balanced, antithetical.Long, short.Euphonic, rhythmical.Forceful, emphatic.Varied.Ungrammatical, un-unified, incoherent.Involved, rambling, awkward, jerky.Cacophonic.Monotonous, dull.

SENSES

TouchcoolcoldicylukewarmtepidwarmhotsteamystickydampwetslipperyspongymushyoilywaxyfleshyrubberytoughcrispelasticleatherysilkysatinyvelvetysmoothsoftwoollyfurryfeatheryfuzzyhairypricklygrittysandyroughsharpthickpulpydrydullthinfragiletenderTasteoilybutterysaltybitterbittersweetsweetheartymellowsugarycrispripeblandtastelesssourvinegaryfruitytangyunriperawalkalinemedicinalfishyspicypepperygingeryhotburntoverripespoiledrottenSmellsweetscentedfragrantaromaticperfumedheadyfreshbalmyearthypineyodorouspungenttemptingspicysavorysharpgamyfishybrinyacidacridburntgaseousreekingputridrottenspoiledsourrancidsicklystagnantmoldymustymildeweddampdankstenchLoud soundscrashthudbumpthumpboomthunderbangsmashexploderoarscreamscreechshoutyellwhistlewhinesquawkbarkbraybawlblusterrageblarerumblegrateslamclapstompstampnoisediscorddinjangleraspclashclamortumultriotracketbrawlbedlampandemoniumhubbubblatantdeafeningraucousearsplittingpiercingrowdydisorderlySoft soundssighmurmurwhisperwhirrustletwitterpatterhummuttersnaphisscracklebleatpeepbuzzzinggurgleswishrushchimetinkleclinkhushstillspeechlessmutefaintinaudiblemelodyresonanceharmonymusicalSpeech soundsstutterstammergiggleguffawlaughsingyellscreamscreechsnortbellowgrowlchattermurmurwhisperwhimpertalkspeakdrawl

Sightdottedfreckledspottedblotchedwrinkledpatternedmottledflowerystripedbrightclearshinyglowingglossyshimmeringfluidsparklingiridescentglassyflashyglazedsheertransparenttranslucentopaquemuddygrimyyoungdrabdingydulldarkdismalrottedoldusedwornuntidyshabbymessytiredexhaustedaridawkwardcrookedloosecheapuglyramshacklecurvedstraightorderlyformalcrispprettyheavyflatstoutwiderigidnarrowoverloadedcongestedclutteredcrowdedjammedpackedbruisedtiedstretchedtallerectleanslendersupplelithelivelymuscularsturdyrobusthardystronghealthyfrailfragilepalesicklysmalltinyminiaturetimidshynervousfrightenedwildbolddramatictantalizingirresistibleenergeticanimatedperkyarrogantimposingregalstatelyelegantlargehugeimmensemassivegiganticshowydecorativedazzlingopulentjeweledlavishexoticradiantfieryblazingfreshcleanscrubbedtidyhandsomepleasantcalmserene


Recommended