Steam Boilershot water
Gas, Oil, Wood, Biomass, Coal, and Solid
Hurst Boiler & Welding Company has been designing, engineering and servicing a complete line of solid fuel, solid waste, biomass,
hot water boilers since 1967, for
Hurst also manufactures acomplete line of boiler room
peripherals such as blowdown separator surge tanks, and
pressurized make-up
DIGESTER GASNATURAL GASMETHANEBIO GASOILCOALSLUDGEBIOMASSSOLID WASTE
Join the Conversation
2015 Biomass Industry Directory | 3
Fifth EditionJanuary 2015
Published byBBI International308 Second Ave. N., Suite 304Grand Forks, ND 58203phone: (701) 746-8385fax: (701) 746-5367
Copyright © January 2015All Rights ReservedPrinted in the United States of America
BiomassIndustry Directory2015
TM
directory.biomassmagazine.com
4 | 2015 Biomass Industry Directory
Contents
2015 U.S. BIOMASS POWER PLANT LIST 6
2014 U.S. & CANADA PELLET MILL LIST 9
AG PRODUCTS & SERVICES 14
Feedstock Collection Systems 14
Feedstock Procurement 14
ASSOCIATIONS & ORGANIZATIONS 14
CONFERENCES/TRADE SHOWS & MEETINGS 15
DENSIFICATION & SIZE REDUCTION 15
Balers - Industrial 15
Briquetting 16
Chippers - Brush 16
Chippers - Whole Log 16
Grinders - Horizontal 16
Grinders - Tub 16
Grinders - Vertical 17
Mills - Hammer 17
Pellet Mills 17
Pyrolysis 17
Torrefaction 17
EDUCATION 18
EMPLOYMENT 18
Executive Search 18
ENGINEERING & CONSTRUCTION 19
Anaerobic Digestion Systems 19
Biomethane 19
Buildings 19
Civil Engineering 19
CHP Systems 19
Detailed Design 21
District Heating Systems 21
Electrical 21
EPC 21
Fabrication 21
Gasifi ers 21
Information Technology Services 22
Management Services 22
Piping 22
Plant Optimization 22
Power Plant Construction 22
Pyrolysis 22
Stacks 22
Structural Fabrication 22
Torrefaction 22
Water Treatment 22
FEEDSTOCK SUPPLY 22
Biomass Based Fuel Oil 22
Briquettes 22
Dedicated Energy Crops 22
Pellets 22
Wood Chips 23
Wood Residues 23
LEGAL SERVICES 23
Attorney 23
Intellectual Property 23
MATERIAL HANDLING & STORAGE 25
Bucket Loader 25
Conveyor - Belt 25
Conveyor - Drag 25
Conveyor - Enclosed 25
Conveyor - Mechanical 25
Conveyor - Pneumatic 26
Conveyor - Screw 26
Cranes - Overhead 26
Dryer - Conveyor 26
Dryer - Flash 26
Dryer - Ring 26
Dryer - Rotary Drum 26
Dryer - Spray 27
Dryer - Steam Tube 27
Elevator-Bolts 27
Elevator-Buckets 27
Import/Export Services 27
Loading Equipment 27
Railcar - Moving 27
Scale - Bulk Weigh 27
Scale - Software 27
Screens - Disc 27
Screens - Disc Scalping 27
Screens - Fines 27
Screens - Other 28
Specialty Parts and Equipment 28
Stockyard Equipment 28
Storage-Bins 28
Storage-Other 28
Storage-Silos 28
Storage - Silo Reclaimer 29
Trailer - Moving Floor 29
Transportation - Barge 29
Transportation - Rail 29
Transportation - Truck 29
Truck Receiving/Dumpers 29
Vibration Equipment 29
MEDIA 30
Publications 30
PROCESS EQUIPMENT & SERVICES 30
Air Pollution Control 30
Binders & Surfactants 31
Biogas-Capture 31
Biogas-Purifi cation 31
Boilers - Direct Fired 31
Boilers - Firetube 32
Boilers - Fluidized Bed 32
Boilers - Hot Water 32
Boilers - Parts & Service 32
Boilers - Solid Fuel 33
Boilers - Steam 33
Boilers - Waste Heat Recovery 33
Centrifuges 33
CIP 33
Cleaning 33
Combustion Equipment 33
Condensors 33
Control Systems 33
Cooling Towers 34
Digester-Covers 34
Dust Control - Baghouses 34
Dust Control - Inertial Separators 34
Dust Control - Unit Collectors 35
Dust Control - Wet Scrubbers 35
Energy Management 35
Environmental Testing 35
Fans 35
Filters 35
Fire Protection 35
Furnaces 35
Generator - Diesel / Biodiesel 36
Generator - Natural Gas/Biogas 36
Generator - Steam Turbine 36
Heat Exchangers - Direct Contact 36
Heat Exchangers - Phase-Change 36
Heat Exchangers - Shell & Tube 36
Heat Exchangers - Waste Heat Recovery Unit 36
Hoppers 36
Instrumentation 36
Laboratory Equipment 36
Laboratory Services 36
Lubricants 37
Mixers/Agitators 37
Moisture Analyzers 37
Operations & Maintenance 38
Pipe 38
Pipe-Fittings 38
Pipe-Flanges 38
Pumps 38
Safety 38
Sensors 38
Separators 38
Separators-Magnetic 38
Valves 39
VOC Scrubbers 39
Wastewater Treatment 39
Water Treatment 39
PROJECT DEVELOPMENT & FINANCE 39
Accounting 39
Business Plans 39
Debt Financing 39
Due Diligence 39
Economic Development 39
Feasibility Studies 39
Feedstock Pricing 40
Insurance 40
Market Data 40
Mergers & Aquisitions 40
Permitting - Air 40
Permitting - Other 41
Risk Management 41
Site Selection 41
Software - Accounting 41
RESEARCH & DEVELOPMENT 41
Government 41
Private 41
University 42
ADVERTISER INDEX 44
COMPANY INDEX 45
A POWERFUL
for Biomass Power Plants
RESOURCE
With increasingly high demand for cleaner sources of energy, Babcock Power and its family of advanced technology companies have assembled a team of industry experts in biomass conversion and new plant technology.
With a strength of over 100 years of steam generating equipment experience, the Babcock companies have established themselves as market leaders in planning, designing, fabricating, constructing and commissioning state-of-the-art chute to stack technology.
With proven results of optimum performance and cost-saving ef ciency, this team of elite professionals provides customers with advanced stoker technology boilers, cutting-edge air quality control systems and innovative modular designs.
Contact the Babcock Power professionals at www.babcockpower.com, your single source provider of renewable energy project solutions.
www.babcockpower.com
14488_Biomass_Mag_Full_Pg_Ad.indd 1 12/9/14 11:48 AM
6 | 2015 Biomass Industry Directory
Color Key
Existing Under Construction Proposed Idled
U.S. Biomass Power Facilities List
Abengoa Bioenergy Abengoa Bioenergy Biomass of Kansas LLC Hugoton, KS 21 Yes No Cellulosic ethanol byproductAkeida Capital Management Ampersand Chowchilla Biomass LLC Chowchilla, CA 12.5 No No Agricultural wastesAmador Biomass LLC Buena Vista Biomass Power Ione, CA 18 No No Woody biomassAmeresco Inc. Savannah River Site Biomass Cogeneration Facility Aiken, SC 20 Yes No Forest residueArlington County/ City of Alexandria Covanta Alexandria/Arlington Alexandria, VA 23 No No MSWAvista Corp. Kettle Falls Generating Station Kettle Falls, WA 53.4 No No Logging and mill residueBiomass One LP (Parent) Biomass One White City, OR 30 No No Woody biomassBlueFire Renewables Inc. BlueFire Renewables Fulton LLC Fulton, MS 25 Yes No Wood wasteBoise Cascade LLC Medford Operation Medford, OR 11 Yes No Mill residue Boralex Boralex Sherman LLC Stacyville, ME 18 No No Woody biomassBridgewater Power Co. LP Bridgewater Power LP Plymouth, NH 15 No No Woody biomassBurlington Electric Department Joseph C McNeil Generating Station Burlington, VT 59.5 No No Forest and mill residues, local wood wasteBurney Forest Products Burney Forest Power Burney, CA 31 Yes No Logging and mill residueCaletta Renewable Energy Palmer Renewable Energy Springfield, MA 35 No No Wood chipsCalifornia Ethanol & Power LLC California Ethanol & Power LLC Imperial Valley, CA 49.9 Yes No BagasseCapital Power Corp. CPI USA North Carolina LLC Southport, NC 55 Yes Yes Wood residuals, TDFCapital Power Corp. Roxboro Facility Roxboro, NC 67.5 Yes Yes Wood, TDFCate Street Capital Burgess BioPower Berlin, NH 75 No No Woody biomassCity and County of Honolulu Covanta Honolulu Resource Recovery Venture Kapolei, HI 90 No No MSWCity of Long Beach Covanta Long Beach Renewable Energy Long Beach, CA 36 No No MSWCity of Perham Perham Resource Recovery Facility Perham, MN 4.5 Yes No MSWCity of Spokane Wheelabrator Spokane Inc. Spokane, WA 26 No No MSWCity of Tampa Wheelabrator McKay Bay Inc. Tampa, FL 22 No No MSWCMS Energy Craven County Wood Energy New Bern, NC 50 No No Mill residueCMS Energy Genesee Power Station LP Flint, MI 40 No No Wood waste, animal beddingCMS Energy Grayling Generating Station Grayling, MI 38 No No Mill residue, TDFCollins Company Collins Pine Company Kane, PA 12 Yes No Woody biomassConnecticut Resources Recovery Authority Covanta SECONN Preston, CT 18 No No MSWConnecticut Resources Recovery Authority Mid-Conn. Resource Recovery Facility Hartford, CT 68 No No MSWConnecticut Resources Recovery Authority Wheelabrator Bridgeport LP Bridgeport, CT 67 No No MSWConstellation NewEnergy Albany Green Energy Albany, GA 50 Yes No Woody biomassCovanta Covanta Babylon Inc. West Babylon, NY 17 No No MSWCovanta Covanta Bristol Inc. Bristol, CT 16.3 No No MSWCovanta Covanta Burney Mountain Power Burney, CA 11.4 No No Woody biomassCovanta Covanta Camden Energy Recovery Center Camden, NJ 21 No No MSWCovanta Covanta Delano Delano, CA 58 No No Orchard and vineyard wasteCovanta Covanta Delaware Valley LP Chester, PA 80 No No MSWCovanta Covanta Essex Company Newark, NJ 65 No No RDFCovanta Covanta Fairfax Inc. (I-95 Energy) Lorton, VA 80 No No MSWCovanta Covanta Haverhill Inc. Haverhill, MA 49 No No MSWCovanta Covanta Hempstead Company Westbury, NY 80 No No MSWCovanta Covanta Hennepin Energy Resource Co. LP Minneapolis, MN 40 No No MSWCovanta Covanta Huntington LP East Northport, NY 25 No No MSWCovanta Covanta Indianapolis Inc. Indianapolis, IN 7 Yes No MSWCovanta Covanta Jonesboro Power Station J onesboro, ME 24.5 No No Logging and mill residueCovanta Covanta Lake Inc. Okahumpka, FL 15 No No MSWCovanta Covanta Marion Inc. Brooks, OR 13 No No MSWCovanta Covanta Mendota Mendota, CA 25 No No Orchard and vineyard wasteCovanta Covanta Mount Lassen Power Westwood, CA 12 No No Forest thinning residueCovanta Covanta Niagara Company Niagara Falls, NY 30 No No MSWCovanta Covanta Onondaga LP Jamesville, NY 40 No No MSWCovanta Covanta Pacific Oroville Power Oroville, CA 17 Yes Yes Forest residue, RDFCovanta Covanta Pacific Ultrapower Chinese Station Jamestown, CA 19.8 No No Woody biomassCovanta Covanta Pittsfield Inc. Pittsfield, MA 4 Yes No MSWCovanta Covanta Plymouth Renewable Energy Ltd. Conshohocken, PA 32 No No MSWCovanta Covanta Projects of Wallingford LP Wallingford, CT 11 No No MSWCovanta Covanta SEMASS LP West Wareham, MA 54 No No MSWCovanta Covanta Springfield LLC Agawam, MA 9 No No MSWCovanta Covanta Stanislaus Inc. Crows Landing, CA 22.5 No No MSWCovanta Covanta Warren Energy Resource Co. LP Oxford, NJ 14 No No MSWCovanta Covanta WBH LLC Tulsa, OK 17 No No MSWCovanta Covanta West Enfield West Enfield, ME 25 No No Forest and mill residueD.R. Johnson Lumber Company Riddle Facility Riddle, OR 7.5 Yes No Woody biomassDominion Virginia Power Altavista Power Station Altavista, VA 50 No No Wood waste, slash, other biomassDominion Virginia Power Hopewell Power Station Hopewell, VA 50 No No Wood WasteDominion Virginia Power Pittsylvania Power Station Hurt, VA 83 No No Logging residueDominion Virginia Power Southampton Power Station Franklin, VA 50 No No Wood WasteDTE Energy DTE Stockton LLC Stockton, CA 45 Yes No Woody biomass, agricultural residuesDTE Energy Services DTE Stoneman Station Cassville, WI 40 No No Woody biomassDTE Energy Services Woodland Biomass Power Ltd. Woodland, CA 28 No No Woody biomassDutchess County Resource Recovery Agency Covanta Hudson Valley Renewable Energy LLC Poughkeepsie, NY 9 No No MSWEast Texas Electric Cooperative Woodville Renewable Power Woodville, TX 49 No No Woody biomassEastern Connecticut Resource Recovery Authority Wheelabrator Lisbon Inc. Lisbon, CT 15 No No MSWEcomaine (Parent) Ecomaine (Biomass Power Plant) Portland, ME 14 No No MSWecoPower ecoPower - Hazard Chavies, KY 58 No No Woody biomassEDF Renewable Energy EDF-RE Allendale Allendale, SC 17.8 No No Forestry wood wasteEDF Renewable Energy Pinelands Biomass - Dorchester Harleyville, SC 35.6 No No Logging ResidueEnergy Investor Funds Greater Detroit Resource Recovery Facility Detroit, MI 68 No No MSWEnergy Management Inc. Gainesville Renewable Energy Center Gainesville, FL 102.5 No No Woody biomassEnpower Corp. Wadham Energy LP Williams, CA 26.5 No No Rice hullsEscanaba Green Energy LLC Escanaba Generating Station Escanaba, MI 23 Yes Yes Wood waste and TDFEvergreen BioPower LLC (Parent) Evergreen Biopower LLC Lyons, OR 10 Yes No Mill residueEvergreen Clean Energy Eagle Valley Clean Energy Gypsum, CO 11.5 Yes No Forest restoration residueEver-Green Energy LLC St. Paul Cogeneration LLC St. Paul, MN 37 Yes No Urban tree wasteEWP Renewable Corp. DG Fairhaven Power Samoa, CA 18.8 No No Woody biomassEWP Renewable Corp. DG Whitefield LLC (Biomass Power Plant) Whitefield, NH 19 No No Woody biomassEWP Renewable Corp. Springfield Power LLC Georges Mills, NH 19 No No Woody biomass
LOCATIONCOMPANY PLANT NAMENAMEPLATECAPACITY (MW) CHP CAPABILITY
COFIRE COAL FUEL FEEDSTOCK
2015 Biomass Industry Directory | 7
U.S. Biomass Power Facilities List
Florida Biomass Energy LLC Florida Biomass Energy LLC Bradenton, FL 60 No No Woody biomass vegetative wasteFlorida Crystals New Hope Power, Co. South Bay, FL 128.9 Yes No Bagasse, woodFortistar Hillman Power LLC Hillman, MI 20 No No Wood waste & TDFGDF Suez Energy North America Inc. Pinetree Power - Bethlehem Bethlehem, NH 16.2 No No Forest and logging residueGDF Suez Energy North America Inc. Pinetree Power - Tamworth Tamworth, NH 25 No No Woody biomassGDF Suez Energy North America Inc. Pinetree Power - Westminster Westminster, MA 17 No No Woody biomassGDF Suez Energy North America Inc. Ryegate Power Station East Ryegate, VT 20.5 No No Whole tree chipsGDF Suez Energy North America Inc. Viking Energy of Lincoln Lincoln, MI 16 No No RDF, natural gasGDF Suez Energy North America Inc. Viking Energy of McBain McBain, MI 18 No No Wood waste and TDFGDF Suez Energy North America Inc. Viking Energy of Northumberland Northumberland, PA 16 Yes No Woody biomassGrays Harbor Paper LP Grays Harbor Paper LP - Powerhouse Hoquiam, WA 14 Yes No Paper mill sludgeGreat River Energy Elk River Energy Recovery Station Elk River, MN 29 No No MSWGreenleaf Power LLC Desert View Mecca, CA 48 Yes No Agricultural residue , urban wood wasteGreenleaf Power LLC Eel River Plant Scotia, CA 28 Yes No Logging and mill residueGreenleaf Power LLC Honey Lake Wendel, CA 36.2 No No Mill and logging residue, urban wood wasteGreenleaf Power LLC Tracy Biomass Tracy, CA 21.5 No No Woody biomassHarrisburg Authority Covanta Harrisburg Inc. Harrisburg, PA 24 Yes No MSWHawaiian Commercial & Sugar Co Ltd (Parent) Hawaiian Commercial & Sugar Puunene Mill Puunene, HI 46.1 Yes Yes BagasseHillsborough County Solid Waste Department Covanta Hillsborough Inc. Tampa, FL 47 No No MSWHoge Lumber Co Hoge Lumber New Knoxville, OH 3.7 Yes No Mill residueHomeland Renewable Energy Inc. Fibrominn Biomass Power Plant Benson, MN 50 No No Poultry litter, agricultural residueHu Honua Bioenergy LLC Hu Honua Bioenergy Facility Pepeekeo, HI 24 No No Eucalyptus and other biomassIberdrola Renewables Lakeview Power Plant Lakeview, OR 35 Yes No Logging and mill residueIndeck Energy Services Inc. Indeck Energy - Alexandria LLC Alexandria, NH 16 No No Wood wasteINEOS Bio INEOS - Indian River Bioenergy Center Vero Beach, FL 6 Yes No Vegetative waste, ag waste, MSWInventivEnergy LLC Aspen Biomass Power Plant Lufkin, TX 44 No No Logging and mill residue, urban wood wasteIslip Resource Recovery Agency Covanta MacArthur Renewable Energy Inc. Ronkonkoma, NY 12 No No MSWKapStone Kraft Paper Corp. Longview Fibre Longview, WA 55 Yes No Mill residueKauai Island Utility Cooperative Green Energy Team LLC Koloa, Kauai, HI 6.7 Yes No Woody biomassKent County Covanta Kent Inc. Grand Rapids, MI 18 No No MSWKoppers Inc. Koppers Susquehanna Plant Montgomery, PA 7.5 Yes No Waste creosote-treated woodLaidlaw Energy Group Inc Susanville Biomass Facility Susanville, CA 14 No No Forest residueLancaster County Solid Waste Authority Covanta Lancaster Inc. Bainbridge, PA 36 No No MSWL’Anse Warden Electric Company L’Anse Warden L’Anse, MI 20 Yes No RDFLeaf Clean Energy Company Multitrade Telogia Bristol, FL 14 No No Logging and mill residue, peanut hullsLee County Solid Waste Authority Covanta Lee Inc. Ft. Myers, FL 57 No No MSWLeidos Holdings Inc. Plainfield Renewable Energy Plainfield, CT 37.5 No No C&D WasteLeucadia National Corporation Imperial Valley Resource Recovery Imperial, CA 18.1 No No Wood waste and ag residueLos Angeles County Sanitation Districts Commerce Refuse-to-Energy Facility Commerce, CA 11.5 No No MSWMacpherson Energy Corporation Mt. Poso Cogeneration Company LLC Bakersfield, CA 44 Yes No Orchard waste, urban wood wasteMaple Island FH Stoltze Land & Lumber Columbia Falls, MT 3 Yes No Mill residueMaryland Environmental Service Eastern Correctional Institute Cogeneration Plant Westover, MD 3.8 Yes No Woody biomassMiami-Dade County Covanta Dade Renewable Energy Doral, FL 77 No No MSWMid-Maine Waste Action Corp. MMWAC Resource Recovery Facililty Auburn, ME 3.6 No No MSWMinnesota Power Hibbard Energy Center Duluth, MN 72.8 Yes Yes Cellulose mattresses fill and other RDFMinnesota Power Rapids Energy Center Grand Rapids, MN 26.5 No Yes Logging and mill residue Nippon Paper Industries USA NPI USA Co-Generation Facility Port Angeles, WA 20 Yes No Logging and mill residueNorth American Power Group Rio Bravo Fresno Fresno, CA 28 No No Woody biomassNorth American Power Group Rio Bravo Rocklin Lincoln, CA 28 No No Woody biomassNortheast Maryland Wast Disposal Authority Covanta Montgomery Inc. Dickerson, MD 55 No No MSWNortheast Maryland Waste Disposal Authority Wheelabrator Baltimore LP Baltimore, MD 64.5 Yes No MSWNovo Power LLC Novo BioPower LLC Snowflake, AZ 27 Yes No Forest thinning, mill residueNRG Energy Inc. Montville Generation Station Uncasville, CT 40 No No Woody biomassOlmsted County Environmental Resources Olmsted Waste-To-Energy Facility Rochester, MN 9.6 Yes No MSWOswego County Solid Waste Authority Oswego County Energy Recovery Facility Fulton, NY 3.6 No No MSWPasco County Covanta Pasco Inc. Spring Hill, FL 31.2 No No MSWPatriarch Partners LLC Old Town Fuel & Fiber Old Town, ME 28.5 Yes No Mill residuePecan Row Landfill Pecan Row Landfill Valdosta, GA 4.8 No No MSW, biogasPhoenix Energy Cabin Creek Biomass Energy Facility Truckee, CA 2 No No Woody biomassPinellas County Utilities Pinellas County Resource Recovery Facility St. Petersburg, FL 75 No No MSWPSNH - Public Service of New Hampshire Northern Wood Power Portsmouth, NH 50 No Yes Woody biomassReEnergy Holdings LLC ReEnergy Ashland Ashland, ME 40 No No Woody biomassReEnergy Holdings LLC ReEnergy Black River Fort Drum, NY 60 No No Woody biomass, TDFReEnergy Holdings LLC ReEnergy Fort Fairfield Fort Fairfield, ME 37 No No Woody biomassReEnergy Holdings LLC ReEnergy Livermore Falls Livermore Falls, ME 40 No No Woody biomassReEnergy Holdings LLC ReEnergy Lyonsdale Lyons Falls, NY 22 Yes No Woody biomassReEnergy Holdings LLC ReEnergy Sterling Sterling, CT 36 No No Woody biomass, TDFReEnergy Holdings LLC ReEnergy Stratton Stratton, ME 48 No No Woody biomassReVenture Park ReVenture Park Charlotte, NC 1.4 Yes No Wood chips, sawdustRio Grande Valley Sugar Growers Inc. Rio Grande Valley Sugar Growers Santa Rosa, TX 23.5 Yes No BagasseRiverstone Holdings Coastal Carolina Clean Power Kenansville, NC 35 Yes No Woody biomassRobbins Lumber Inc. Robbins Lumber Searsmont, ME 1.2 Yes No Woody biomassRockTenn RockTenn - Tacoma Tacoma, WA 64 Yes No Mill residueRollcast Energy Inc. Cadillac Renewable Energy Cadillac, MI 44 No No Forest residueRollcast Energy Inc. Piedmont Green Power Barnesville, GA 60.5 No No Woody biomassRoseburg Forest Products Dillard Complex Roseburg, OR 51.5 Yes No Woody biomassSappi Fine Paper North America S D Warren Westbrook Westbrook, ME 62.5 Yes Yes Mill residue, BLQ, TDFSappi Fine Paper North America Sappi Cloquet Mill Cloquet, MN 60.7 Yes No Mill residueSappi Fine Paper North America Somerset Plant Skowhegan, ME 116.9 Yes Yes Mill residueSauder Woodworking Co. Sauder Power Plant Archbold, OH 7 Yes No Mill residueSDS Lumber Co. SDS Lumber Gorge Energy Division Bingen, WA 10 Yes No Logging and mill residueSeneca Sawmill Company Seneca Sustainable Energy Eugene, OR 19.8 Yes No Forest and mill residueShakopee Mdewakanton Sioux Community Koda Energy LLC Shakopee, MN 23.4 Yes No Agricultural residue, urban tree wasteShasta Renewable Shasta Renewable Anderson, CA 5.5 No No Woody biomassSierra Pacific Industries Sierra Pacific - Aberdeen Aberdeen, WA 18 Yes No Logging and mill residueSierra Pacific Industries Sierra Pacific - Anderson Anderson, CA 5 Yes No Logging and mill residueSierra Pacific Industries Sierra Pacific - Burlington Mount Vernon, WA 28 Yes No Logging and mill residue
LOCATIONCOMPANY PLANT NAMENAMEPLATECAPACITY (MW) CHP CAPABILITY
COFIRE COAL FUEL FEEDSTOCK
Note: Plant map data as of October 23, 2014
The map indicates electricity generation plants that:
-have the ability to supply all or a portion of their power to the grid
-use greater than 40% biomass by volume in annual fuel mix
-have a nameplate capacity equal to or greater than 1 MW
To add a plant to this map email [email protected]
Color Key
Existing Under Construction Proposed Idled
8 | 2015 Biomass Industry Directory
LOCATIONCOMPANY PLANT NAMENAMEPLATECAPACITY (MW) CHP CAPABILITY
COFIRE COAL FUEL FEEDSTOCK
Sierra Pacific Industries Sierra Pacific - Burney Burney, CA 20 Yes No Logging and mill residueSierra Pacific Industries Sierra Pacific - Lincoln Lincoln, CA 18 Yes No Woody biomassSierra Pacific Industries Sierra Pacific - Loyalton Loyalton, CA 20 Yes No Mill residueSierra Pacific Industries Sierra Pacific - Quincy Quincy, CA 27.5 Yes No Mill residueSierra Pacific Industries Sierra Pacific - Sonora Sonora, CA 7.5 Yes No Logging and mill residueSmurfit-Stone Container Corp. Stone Container Panama City Mill Panama City, FL 34 Yes No Paper mill wasteSnider Industries Inc. Snider Industries Marshall, TX 5 Yes No Woody biomassSolid Waste Authority of Palm Beach Palm Beach Renewable Energy #1 West Palm Beach, FL 62.3 No No MSWSolid Waste Authority of Palm Beach Palm Beach Renewable Energy #2 West Palm Beach, FL 100 No No MSWSouth Boston Energy LLC NOVEC Energy Production, Halifax County Biomass South Boston, VA 49.9 No No Forest residueSoutheast Renewable Fuels LLC. Southeast Renewable Fuels LLC - Clewiston Clewiston, FL 25 Yes No Cellulosic ethanol byproductSouthern Power Company Southern Co. Nacogdoches Generating Facility Sacul, TX 100 No No Forest and mill residue, MSWSP Newsprint Company SP Fiber Technologies - Newberg Newberg, OR 30 Yes No Logging and mill residueStimson Lumber Company Plummer Cogen Plummer, ID 6 Yes No Wood wasteTamarack Energy Inc. Tamarack Energy Partnership New Meadows, ID 6.2 Yes No Wood wasteTaylor Biomass Energy LLC TBE-Montgomery LLC Montgomery, NY 20 No No MSW, C&D and wood wasteTelogia Power Telogia Power Telogia, FL 14 No No Logging and mill residue, peanut hullsThe Powell Group Agrilectric Power Partners Ltd. Lake Charles, LA 12.1 No No RDFThermagen Power Group LLC Fox Valley Clean Energy Center Northfield, IL 7 Yes No Paper mill sludgeU.S. EcoGen LLC U.S. EcoGen Clay Generating Facility Green Cove Springs, FL 63 No No Eucalyptus grandisU.S. EcoGen LLC U.S. EcoGen Martin Generating Facility Indiantown, FL 63 No No Eucalyptus grandisU.S. EcoGen LLC U.S. EcoGen Okeechobee LLC Okeechobee, FL 63 No No Eucalyptus grandisU.S. EcoGen LLC U.S. EcoGen Polk LLC Fort Meade, FL 63 No No Eucalyptus grandisUnion County Utilities Authority Covanta Union Inc. Rahway, NJ 44 No No MSWUnited States Sugar Corp Clewiston Sugar Factory Clewiston, FL 70.6 Yes No BagasseUS Renewables Group Niagara Generation LLC Niagara Falls, NY 56 No Yes Wood waste, TDF, petroleum cokeUSA Energy Group LLC Penobscot Energy Recovery Orrington, ME 25 No No MSW, woody biomassWarm Springs Forest Products Industries Warm Springs Forest Products Warm Springs, OR 9 Yes No Mill residueWasatch Integrated Waste Management District Wasatch Integrated Energy Recovery Layton, UT 1.6 No No MSWWe Energies Rothschild Biomass Cogeneration Plant Rothschild, WI 50 Yes No Urban wood waste, mill residueWheelabrator Technologies Inc. Wheelabrator Claremont Company LP Claremont, NH 5 No No MSWWheelabrator Technologies Inc. Wheelabrator Concord Company LP Concord, NH 14 No No MSWWheelabrator Technologies Inc. Wheelabrator Falls Inc. Morrisville, PA 53.3 No No MSWWheelabrator Technologies Inc. Wheelabrator Gloucester Company LP Westville, NJ 14 No No MSWWheelabrator Technologies Inc. Wheelabrator Hudson Falls LLC Hudson Falls, NY 15 No No MSWWheelabrator Technologies Inc. Wheelabrator Millbury Inc. Worcester, MA 46 No No MSWWheelabrator Technologies Inc. Wheelabrator North Andover Inc. North Andover, MA 40 No No MSWWheelabrator Technologies Inc. Wheelabrator North Broward Inc. Pompano Beach, FL 68 No No MSWWheelabrator Technologies Inc. Wheelabrator Portsmouth Portsmouth, VA 60 Yes No MSWWheelabrator Technologies Inc. Wheelabrator Ridge Energy Inc. Auburndale, FL 50 No No Wood waste, TDF and landfill gasWheelabrator Technologies Inc. Wheelabrator Saugus Inc. Saugus, MA 38 No No MSWWheelabrator Technologies Inc. Wheelabrator Shasta Energy Co. Inc. Anderson, CA 50 No No Logging, mill and agricultural residue Wheelabrator Technologies Inc. Wheelabrator South Broward Inc. Davie, FL 66 No No MSWWheelabrator Technologies Inc. Wheelabrator Westchester LP Peekskill, NY 59.7 No No MSWXcel Energy Bay Front Power Plant Ashland, WI 40 No No Wood waste, RR tiesXcel Energy French Island Generating Plant La Crosse, WI 30.4 No No RDF, Wood waste, RR tiesXcel Energy Red Wing Red Wing, MN 20 No No RDF, WoodXcel Energy Wilmarth Generating Station Mankato, MN 20 No No RDF, WoodYork County Solid Waste Authority Covanta York Renewable Energy LLC York, PA 36.5 No No MSW
Total Existing Nameplate Capacity (MW) 6,580Total Under Construction Nameplate Capacity (MW) 201Total Proposed Nameplate Capacity (MW) 555
Color Key
Existing Under Construction Proposed Idled
U.S. Biomass Power Facilities List (continued)
Source: Biomass Magazine / BBI International
Please contact Steve Stucko, Data & Content Manager, with questions or comments regarding the 2015 Biomass Power List at [email protected].
CHP: Combined heat and power, RDF: Refuse derived fuel, C&D: Construction and demolition, RR: Railroad
2015 Biomass Industry Directory | 9
Agri Fibers Inc.Alexander Energy Inc.Allegheny Pellet CorporationAmerican Pellet CompanyAmerican Wood Fibers - CirclevilleAmerican Wood Fibers - MarionAmerican Wood Fibers - WisconsinAppalachian Wood PelletsArbor PelletAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest Products - Cascade LocksBear Mountain Forest Products - BrownsvilleBearlodge Forest ProductsBeaver Wood EnergyBiomass Power Louisiana LLCDry Creek ProductsPA PelletsBlue Mountain Lumber ProductsBlueFire Renewables Fulton LLCNew Biomass EnergyThermogen IndustriesConfl uence Energy - KremmlingConfl uence Energy - WaldenCorinth Wood PelletsCurran Renewable EnergyDeadwood BiofuelsDejno’s Inc.Dover Resources, Inc.Morehouse BioEnergyAmite BioEnergyEnergex Pellet Fuel, Inc.Enginuity WorldwideEnova Energy Group - NahuntaEnova Energy Group - GordonEnova Energy Group - WarrentonEnova Energy Group - JohnstonBiomass Energy LLCEnviro Energy Environmental Energy PartnersEnviva Pellets AmoryEnviva Pellets WigginsEnviva Pellets AhoskieEnviva Pellets Northampton, LLCEnviva Pellets Southampton, LLCEquustock - MontebrookEquustock - ClareEquustock - ChesterEquustock - TroyEssex Pallet & PelletF.E. Wood & Sons - Natural EnergyFiber By-Products - White PigeonFiber Energy Products ARFiber Recovery Inc.Fiber Resources Inc.First Georgia BioEnergyForest Energy Corp.Appling County Pellets LLCFram Renewable Fuels - HazlehurstFrank PelletsFulghum Graanul Oliver LLCGeneral Biofuels - GeorgiaGeneva Wood FuelsGerman Pellets LouisianaGerman Pellets TexasGlobal Harvest OrganicsGolden Peanut Co. - HeadlandGolden Peanut Co. - DawsonGreat Lakes Renewable Energy, Inc.Green Friendly Pellets, LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet Fuel ElkinsHassell & Hughes Lumber CompanyHenry County Hardwoods Inc.Horizon Biofuels Inc.Indeck Energy Ladysmith Biofuel Center LLCInternational Biomass Energy LLCIsabella PelletGreen Circle Bio Energy IncJensen Lumber Co.Kirtland Products, LLCKoetter & Smith, Inc.Lee Energy SolutionsGreenwood FuelsLignetics of Idaho IncLignetics of Virginia Inc.
Rapid CityKaneYoungsvilleCorunnaCirclevilleMarionSchofi eldKingwoodSalt Lake CityLa FargevilleTroyCascade LocksBrownsvilleHulettFair HavenBaton RougeArcadeUlyssesPendletonFultonQuitmanPortsmouthKremmlingWaldenCorinthMassenaRapid CityKenoshaStocktonMorehouse ParishGlosterMiffl intownColumbiaNahuntaGordonWarrentonJohnstonBumpassUnadillaSilver PlumeAmoryWigginsAhoskieGarysburgFranklinMontbrookClareChesterTroyKeesevilleWest BaldwinWhite PigeonMountain ViewRinglePine BluffWaynesvilleShow LowBaxleyHazlehurstMill CityOliverSandersvilleStrongLa SalleWoodvilleAuroraHeadlandDawsonHaywardBalsam LakeGarards FortWest MonroeElkinsCollinwoodParisFremontLadysmithJacksonLake IsabellaCottondaleOvidBoyne CityBordenCrossvilleGreen BayKootenaiKenbridge
SDPAPAMIOHVAWIWVUTNYPAORORWYVTLANYPAORMSMSNHCOCOMENYSDWICALAMSPAMOGAGAGASCVANYCOMSMSNCNCVAFLMIVAVANYMEMIARWIARGAAZGAGAORGAGAMELATXMOALGAWIWIPALAWVTNTNNEWIALMIFLIDMIINALWIIDVA
8,0008,500
77,00012,00050,00075,00025,000
Undisclosed60,000
8,00045,00040,000
120,0005,000
110,0001,000,000
100,00050,00020,000
400,000250,000110,000100,000
65,00075,000
100,00071,00040,00035,000
500,000500,000120,000
6,000150,000545,000545,000500,000127,000
1,80018,00090,000
136,000365,000551,000551,000
40,00036,00080,00040,000
6,000344,000
65,00022,00075,00050,000
375,00062,000
220,000551,000
21,000200,000440,000
90,0001,100,000
551,00050,000
UndisclosedUndisclosed
70,00017,00050,00060,00060,00030,00040,00020,00090,000
485,00040,000
660,00015,00035,00015,000
110,000120,000
80,00070,000
NoNoNoNoYesYesYesNoYesNoNoYesNoNoNoYesNoNoNoNoYesYesNoNoYesYesYesNoYesYesYesNoNoYesYesYesYesYesNoNoYesYesYesYesYesYesYesYesYesNoYesNoNoNoNoYesNoYesYesYesYesYesNoYesYesNoYesYesYesNoNoNoNoNoNoNoYesYesNoYesNoNoNoYesNoNoNo
Woody BiomassHardwoodHardwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwoodHardwood and softwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodHardwoodSoftwoodHardwood and softwoodWoody BiomassHardwood and softwoodWoody BiomassSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodWoody biomassHardwood and softwoodHardwoodCorn stover, miscanthusSoftwoodWoody biomassWoody biomassSoftwoodHardwood and softwoodMixed grass and weedsSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwoodHardwoodHardwoodHardwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodHardwoodSoftwoodHardwood and softwoodAlfalfa hay, wood residuals, poultry litterPeanut hullsPeanut hullsHardwood and softwoodHardwoodHardwoodHardwood and softwoodHardwoodHardwoodHardwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwoodHardwoodPaper wasteSoftwoodHardwood
Europe, AsiaEurope, AsiaAsia
S. Korea, Japan
Japan
Europe
EuropeEurope
United KingdomBelguim, Italy, Spain
AsiaUnited Kingdom
EuropeTBDTBD
Europe
EuropeEuropeEuropeEuropeEuropeItaly, S. Korea, Taiwan, Australia, IcelandItaly, S. Korea, Taiwan, Australia, IcelandItaly, S. Korea, Taiwan, Australia, IcelandItaly, S. Korea, Taiwan, Australia, Iceland
Europe
Europe
EuropeEuropeEuropeEurope
Europe
United KingdomUnited KingdomPoland, Germany, Netherlands
CanadaEurope
Scandanavia, Northern Europe, S. Korea Japan
United Kingdom
COMPANY PLANT NAME LOCATION FEEDSTOCK
PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION
Color Key
Existing Under Construction Proposed
Note: Pellet mill map as of February 11, 2014-To add a pellet production facility to this map email [email protected]
Find up-to-date information at :
www.biomassmagazine.com/plants/listplants/pellet/US/
Source: Pellet Mill Magazine / BBI International
Pellet Mill Map List
Agri Fibers Inc.Alexander Energy Inc.Allegheny Pellet CorporationAmerican Pellet CompanyAmerican Wood FibersAmerican Wood FibersAmerican Wood FibersAppalachian Wood PelletsArbor Pellet LLCAssociated Harvest Inc.Barefoot Pellet CompanyBear Mountain Forest ProductsBear Mountain Forest ProductsBearlodge Forest ProductsBeaver Wood EnergyBiomass Secure PowerBioMaxx Inc.BioMaxx Inc.Blue Mountain Lumber ProductsBlueFire Renewables Inc.BTH Quitman Hickory LLCCate Street CapitalConfl uence EnergyConfl uence EnergyCorinth Wood Pellets LLCCurran Renewable Energy LLCDeadwood Biofuels LLCDejno’s Inc.Dover CapitalDrax Biomass International Inc.Drax Biomass International Inc.Energex CorporationEnginuity Worldwide, LLCEnova Energy GroupEnova Energy GroupEnova Energy GroupEnova Energy GroupEnsign-Bickford Renewable Energies Inc.Enviro Energy LLCEnvironmental Energy Partners LLCEnviva LPEnviva LPEnviva LPEnviva LPEnviva LPEquustock LLCEquustock LLCEquustock LLCEquustock LLCEssex Pallet & PelletF.E. Wood & Sons - Natural EnergyFiber By-Products Corp.Fiber Energy Products AR LLCFiber Recovery Inc.Fiber Resources Inc.First Georgia BioEnergyForest Energy Corp.Fram Renewable Fuels LLCFram Renewable Fuels LLCFrank PelletsFulghum Graanul Oliver LLCGeneral BiofuelsGeneva Wood Fuels, LLCGerman Pellets GmbHGerman Pellets GmbHGlobal Harvest Organics, LLCGolden Peanut CompanyGolden Peanut CompanyGreat Lakes Renewable Energy, Inc.Green Friendly Pellets, LLCGreene Team Pellet Fuel CompanyGulf Coast Renewable EnergyHamer Pellet FuelHassell & Hughes Lumber CompanyHenry County Hardwoods Inc.Horizon Biofuels Inc.Indeck Energy Services, Inc.International Biomass Energy LLCIsabella PelletJCE Group ABJensen Lumber Co.Kirtland Products, LLCKoetter & Smith, Inc.Lee Energy SolutionsLibra GroupLigneticsLignetics
10 | 2015 Biomass Industry Directory
U.S. Pellet Producers (continued)
Lignetics of West Virginia Inc.Log Hard Premium Pellets Inc.Low Country BiomassMaeder Brothers Quality Wood Pellets, Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet Co. - PeshtigoMarth Wood Shavings SupplyMichigan TimberMichigan Wood FuelsMt. Taylor - WoodYouRecycleMt. Taylor Machine Pellet FuelNature’s Earth Pellets - ReformNature’s Earth Pellets - LaurinburgJaffrey Manufacturing FacilityDeposit Manufacturing FacilitySchuyler Manufacturing FacilityNorth Idaho Energy Logs - HauserNorth Idaho Energy Logs - Moyie SpringsNortheast Pellets LLCMalheur Pellet MillOlympus Pellets - SheltonO’Malley Wood PelletsOzark Hardwood ProductsPacifi c Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellheat Inc.Penn Wood Products, Inc.Potomac Supply LLCLemhi Valley PelletsRisley Pellet Solutions LLCRocky Canyon Pellet Co.Dillard Composite SpecialtiesGeorgia BiomassShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable Resources Superior Pellet Fuels LLCWestervelt Renewable Energy, LLCTri State BiofuelsTurman Hardwood PelletsInstantheat Wood Pellets Inc.Varn Wood ProductsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products - BanksWest Oregon Wood Products - Columbia CityWood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass - SelmaZilkha Biomass - Crockett
LinnSpartansburgRidgelandWeidmanAthensRocklinTacomaPeshtigoMarathonFlintHollandAlbuquerqueMilanReformLaurinburgJaffreyDepositSchuylerHauserMoyie SpringsAshlandJohn DaySheltonTappahannockSeymourRedmondNacogdochesAppletonGlen HopeEast BerlinKinsaleSalmonMonticelloGrangevilleRoseburgSavannahKingsvilleSomersetLexingtonHuntingburgGamalielSnowfl akeNorth PoleAlicevilleLemont FurnaceGalaxAddisonHobokenNorth ClarendonSt AugustineVulcanBanksColumbia CityPierzSummerhillPrinevilleFinleySelmaCrockett
WVPASCMIMECAWAWIWIMIMINMNMALNCNHNYNYIDIDMEORWAVAMOORTXWIPAPAVAIDWIIDORGAMOKYKYINKYAZAKALPAVANYGAVTFLMIORORMNPAORNDALTX
HardwoodHardwoodHardwoodHardwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodHardwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodHardwoodSoftwoodPaper wasteHardwoodHardwoodSoftwoodHardwood and softwoodHardwoodHardwood and softwoodSoftwoodSoftwoodGrassesHardwoodHardwoodHardwoodHardwoodSoftwoodHardwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwood
125,00025,000
220,00022,000
105,00060,00038,00064,00064,00018,00050,000
6,0006,000
75,000100,000
84,00084,00084,00060,00050,00040,00018,00050,00040,00085,00040,00040,00050,000
5,0005,000
50,0002,600
42,00010,00040,000
825,00015,00050,000
100,00010,00012,00018,00012,000
309,00050,00028,00050,00080,00016,600
132,2779,000
30,00050,000
Undisclosed36,000
Undisclosed22,000
303,13544,000
NoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoNoYesYesNoYesNoNoNoNoYesNoNoNoYesNoNoNoNoYesNoNoNoNoNoNoNoYesNoNoNoYesNoYesNoYesYesNoNoNoNoYesYes
Canada, S. Korea, ItalyCanada, S. Korea, Italy
Japan
Italy
Undisclosed
Europe
Europe
Europe
Europe & Korea
S. Korea, Austrailia, ItalyS. Korea, Australia, Italy
Europe and AsiaEurope and Asia
COMPANY PLANT NAME LOCATION FEEDSTOCK
PRODUCTIONCAPACITY (SHORT TONS/YR) EXPORTING DESTINATION
Total U.S. Existing Capacity - U.S. 9,422,500Total U.S. Under Construction Capacity - U.S. 3,677,412Total U.S. Proposed Capacity - U.S. 5,210,000
Color Key
Existing Under Construction Proposed
Pellet Mill Map List
LigneticsLog Hard Premium Pellets Inc.Low Country BiomassMaeder Bros. Inc.Maine Woods Pellet CompanyMallard Creek Inc.Manke Lumber CompanyMarth Peshtigo Pellet CompanyMarth Peshtigo Pellet CompanyMichigan TimberMichigan Wood FuelsMt. Taylor Machine Pellet FuelMt. Taylor Machine Pellet FuelNature’s Earth Pellet Energy LLCNature’s Earth Pellet Energy LLCNew England Wood Pellet LLCNew England Wood Pellet LLCNew England Wood Pellet LLCNorth Idaho Energy Logs Inc.North Idaho Energy Logs Inc.Northeast Pellets LLCOchoco Lumber CompanyOlympus PelletsO’Malley Wood PelletsOzark Hardwood ProductsPacifi c Pellet LLCPatterson Wood Products Inc.Pellet America Corp.Pellheat Inc.Penn Wood Products, Inc.Potomac Supply LLCQb Corp.Risley Pellet Solutions LLCRocky Canyon Pellet Co.Roseburg Forest ProductsRWE Innogy CogenShow Me Energy CooperativeSomerset Pellet FuelSouth Shore Biofuels LLCSouthern Indiana HardwoodsSouthern Kentucky Pellet Mill Inc.Southwest Renewable Resources Superior Pellet Fuels LLCThe Westervelt CompanyTri State BiofuelsTurman Hardwood PelletsTwo Rivers TimberVarn Wood ProductsVermont Wood Pellet Co. LLCVulcan Renewables LLCVulcan Wood ProductsWest Oregon Wood Products Inc.West Oregon Wood Products Inc.Wood Pellet CoopWood Pellets C&C Smith LumberWoodgrain Millwork Inc.Woodshed Renewables LLCZilkha Biomass EnergyZilkha Biomass Energy
2015 Biomass Industry Directory | 11
Canadian Pellet Producers
Boreal PelletCanadian Biofuel Inc.Canadian Biofuel Inc.Canadian Northern Timber GroupCanadian Northern Timber GroupCottles Island Lumber Co.Courtice IndustriesDansonsDirect Pellet Industries Inc.Energex CorporationFoothills Forest Products, Inc.General BiofuelsGildale FarmsGranulcoGranules LGGranules LGGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.Holson Forest ProductsK.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy Inc. Lauzon Recycled Wood Energy Inc. Marwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest IndustriesPacifi c BioEnergy CorporationPinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Pinnacle Renewable Energy Inc.Premium Pellet Ltd.Princeton Co-Generation Corp.Protocol Biomass Corp.Rentech Inc.Rentech Inc.Resolute Forest ProductsShaw Resources Inc.Shaw Resources Inc.SPB SolutionsT.P. Downey & Sons Ltd.Trebio Wood PelletsVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Viridis Energy Inc.Viridis Energy Inc.Wawasum GroupWhitesand First Nation
Boreal PelletCanadian Biofuel - SpringfordCanadian Biofuel - WoodstockAtlantic Fiber Resources - GoosebayAtlantic Fiber Resources - ChanderCottles Island Lumber Co.Hamilton BiofuelFriendly Fuels LimitedDirect Pellet IndustriesGranules Combustibles Energex, Inc.Foothills Forest Products, Inc.General Biofuels - British ColumbiaGildale Farms
Granules LG Inc.Granules LG InternationalGroupe Savoie Inc.H.J. Crabbe & Sons Ltd.
K.D. Quality PelletsLa Crete Sawmills Ltd.LacWood IndustriesLauzon Recycled Wood Energy - Saint-PaulinLauzon Recycled Wood Energy - PapineauvilleMarwood Ltd.Meadow Lake Tribal Council Pellet MillMuskoka Timber Mills Ltd.New Forest IndustriesPacifi c Bioenergy Pellet MillHouston Pellet Limited Partnership - HoustonPinnacle Renewable Energy Inc. - ArmstrongPinnacle Renewable Energy Inc. - Burns LakePinnacle Renewable Energy Inc. - QuesnelPinnacle Renewable Energy Inc. - StrathnaverPinnacle Renewable Energy Inc. - Williams LakePremium Pellet Ltd.Princeton Co-Generation Corp.Protocol Biomass Corp.Rentech Inc. - AtikokanRentech Inc. - WawaThunder Bay Pellet PlantShaw Resources - BelleduneShaw Resources - ShubenacadieSPB Bio MaterialsT.P. Downey & Sons Ltd.Trebio Wood PelletsVanderhoof Specialty Wood ProductsVanderwell Contractors Ltd.Okanagan Pellet Co. Inc.Scotia Atlantic Biomass Co. Inc.Wawasum GroupWhitesand First Nation
AmosSpringfordWoodstockGoosebayChandlerSummerfordHamiltonEdmontonHaliburtonLac-MéganticGrande CacheTerraceSt. MarysSacre-CoeurSt-FelicienMashteuiatshSt-QuentinBristolRoddicktonNew LiskeardLa CreteHearstSaint-PaulinPapineauvilleFrederictonMeadow LakeBracebridgeNew RichmondPrince GeorgeHoustonArmstrongBurns LakeQuesnelStrathnaverWilliams LakeVanderhoofPrincetonPrescottAtikokanWawaThunder BayBelleduneShubenacadiePeterboroughWeldonPortage-du-FortVanderhoofSlave LakeWest KelownaMiddle MusquodoboitGreenstoneArmstrong
QCONONNLQCNLONABONQCABBCONQCQCQCNBNBNLONABONQCQCNBSKONQCBCBCBCBCBCBCBCBCBCONONONONNBNSONNBQCBCABBCNSONON
50,00040,000
100,000120,000190,000
12,00050,00030,000
Undisclosed120,000
30,000500,000
12,00040,000
120,00080,00055,00040,00060,00045,00070,00010,00058,00058,00010,000
6,00050,000
125,000400,000220,000
60,000440,000100,000220,000200,000140,000108,000500,000100,000450,000
45,000100,000
50,000UndisclosedUndisclosed
130,00015,00050,00060,000
120,00067,00068,000
NoYesYesYesYesNoYesNoYesYesNoYesNoNoYesYesYesNoNoYesYesYesYesYesNoNoNoYesNoYesYesYesYesYesYesNoYesYesYesYesNoYesNoYesNoYesNoYesYesYesYesYes
ItalyItalySweden, DenmarkUnited Kingdom
Europe, United States
ItalyU.S., Europe
U.S., ItalyU.S. and ItalyEuropeU.S.
United KingdomUndisclosedItalyEuropeEurope
Europe
Asia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, EuropeAsia, Europe
Europe, AsiaEuropeEuropeEurope
Europe
U.S.
Europe
U.S.EuropeEuropeEurope
Hardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodSoftwoodHardwood and softwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodHardwoodHardwoodSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodHardwood and softwoodHardwood and softwoodSoftwoodHardwood and softwoodHardwood and softwoodOat hullsHardwood and softwoodHardwood and softwoodSoftwoodSoftwoodSoftwoodHardwood and softwoodHardwoodHardwood and softwood
COMPANY PLANT NAME LOCATION FEEDSTOCK
PRODUCTION CAPACITY (METRIC TONS/YR) EXPORTING DESTINATION
Total Existing Capacity - Canada 3,329,000Total Under Construction Capacity - Canada 790,000Total Proposed Capacity - Canada 1,605,000
Pellet Mill Map List
Color Key
Existing Under Construction Proposed
The Largest Biomass Conference in North America
INCREASE EXPOSURELimited Number of Sponsorships Available.Don't Wait, Become a Sponsor Today
At the 2014 event in Orlando…
98% of exhibitors said they’d return
100% of exhibitors rated the quality of leads positive
98% of exhibitors rated their ROI as positive
Surround Yourself with Biomass Decision MakersDon’t Wait, Get Your Premium Booth NowBy purchasing a booth you are surrounding yourself with industry professionals who are looking for solutions to their challenges. Contact us at [email protected] or 866-746-8385.
“Overall the conference was a positive experience and an opportunity to find our place in the Biomass Industry.” – Steve Hoagland, Pantron Automation
“The Biomass Conference was an excellent networking event with technical information relevant to the industry.”
– Amy Theis, Fauske & Associates
“This is a very important conference for me. Wouldn't miss it.” – William Perritt, RISI
866-746-8385 | [email protected]
#IBCE15 - Follow Us: twitter.com/biomassmagazine
14 | 2015 Biomass Industry Directory
Ag Products & Services Feedstock Collection Systems
Ag Products & ServicesFeedstock Collection
Systems
New Holland Agriculture
500 Diller AvenueNew Holland, PA 17557 Jarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)[email protected]/na
Gulf Stream Fuels, LLC
P.O. Box 147Markham, TX 77456Truman Neuman, VP of MarketingPhone (512-745-6940)[email protected]
Feedstock Procurement
Agricultural Fuels Corp
5361 Young Pine Rd. Orlando, FL 32829James Meade, CTOPhone (407-234-1788) | Fax (407-380-5188)[email protected]
Cousineau Forest Products
1310 Old Concord RdHenniker, NH 03242Jon Baker, Operations & Wood Procurement ManagerPhone (603-428-7155) | Fax (603-428-7839)[email protected]
Timberland Associates, LLC
2150 CR 750Dumas, MS 38625Tom Busch, OwnerPhone (662-837-0381)[email protected]
Associations & Organizations
Shift Your Career in to High GearJoining the SWANA Team provides solid waste management professionals like you with the tools you need to enhance your skills and advance your career.
New Solid Waste Assocation of North America members receive a FREE 1-year Landfill Gas and Biogas Technical Division Membership that adds you to a select group of professionals who are recognized as the premier authorities on landfill gas (LFG) recovery, controls, litigation and management.
TECHNICAL DIVISIO
N
LANDFILL GAS & BIOGAS
TECHNICAL DIVISIO
N
LANDFILL GAS & BIOGAS
Associations &
Organizations
The Solid Waste Association of North
America (SWANA)
1100 Wayne Avenue, Suite 650Silver Spring, MD 20910Meri Beth Wojtaszek, Deputy Executive DirectorPhone (800-467-9262) | Fax (301-589-7068)[email protected] OUR AD ON PAGE 14
Advanced Biofuels USA
507 North Bentz StreetFrederick, MD 21701Joanne Ivancic, Executive DirectorPhone (301-644-1395)[email protected]
Biomass Power Association
100 Middle StreetPortland, ME 04104Bob Cleaves, PresidentPhone (207-228-7376) | Fax (207-774-1127)[email protected]
CTI
3845 Cypress Creek Parkway, Ste. 420Houston, TX 77068Jalene Fritz, Membership CommitteePhone (970-593-8637) | Fax (970-472-1304)[email protected]
Neutopia ecoSOLUTIONS Inc.
2045 Lakeshore Boulevard WestSuite 411Toronto, ON M8V 2Z6 CanadaRobert Laporte, President & CEOPhone (905-581-6333)[email protected]
NH Wood Energy Council
2 Airport RoadUnit 1Gilford, NH 03249Rick DeMark, CoordinatorPhone (603-527-2093)[email protected]
OÖ Energiesparverband
(Energy Agency of Upper Austria)
Landstrasse 45 Linz AustriaChristine Egger, Deputy managerPhone (437-327-72014386) (Fax 437-327-72014383)offi [email protected]/english/
2015 Biomass Industry Directory | 15
European Pellet Conference 2015: February 25 - 26
2016: February 24 - 25
WELS, AUSTRIA
WWW.PELLETS15.EU
The largest
pellet event worldwide!
International Biomass Conference & Expo
Phone (866-746-8385)[email protected] OUR AD ON PAGE 12
National Advanced Biofuels Conference & Expo
Phone (866-746-8385)service@bbiinternational.comwww.advancedbiofuelsconference.comSEE OUR AD ON PAGE 54
International Fuel Ethanol Workshop & Expo
Phone (866-746-8385)[email protected]
Associations & Organizations
Roundtable on Sustainable Biomaterials (RSB)
60 North Market Street, Suite C200Asheville, NC 28801Matt Rudolf, Regional Director, AmericasPhone (919-810-2295)[email protected]
TAPPI
15 Technology Parkway S.Peachtree Corners, GA 30092Raine Hyde, MarketingPhone (770-446-1400)[email protected]
WebSite Names Only
Box 304Nanoose Bay, V9P9J9 CanadaGary R Campbell
Phone (250-468-7047)[email protected]
Associations & Organizations
Conferences/Trade Shows
& Meetings
Densifi cation & Size
Reduction
Balers - Industrial
C&M Baling Systems, Inc.
P.O.Box 16309Winston Salem, NC 27115John Gibbs, President & COOPhone (336-723-1838) | Fax (336-761-8695)[email protected]
16 | 2015 Biomass Industry Directory
Densifi cation & Size Reduction Briquetting
Briquetting
Biomass Briquette Systems, LLC
P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-893-2444) | Fax (530-893-2444)[email protected]
DI PIÙ - Sunomi LLC
608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)[email protected]
Hartpence Farms
PO Box 155Moscow, PA 18444Larry Hartpence, OwnerPhone (570-842-6464)[email protected]
Lehra Fuel Tech PVT LTD
Vpo Nanakpur Jagera-141117, Opp Dera Sacha Sauda Near Shanti Tara College, Distt. LudhianaPunjab, 141117 IndiaSarabjit Singh, DirectorPhone (919815200337)[email protected]
Vecoplan Midwest
4005 Earnings WayNew Albany, IN 47150Bill Miller, Chief Operating Offi cerPhone (812-923-4992)[email protected] OUR AD ON PAGE 19
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
YongHua
Zhengzhouroad 559Zhengzhou, 450042 ChinaJack Zhao, 先生Phone (037167817233)[email protected]
Chippers - Brush
Morbark, Inc.
8507 S. Winn Rd. | P.O. Box 1000Winn, MI 48896Casey Gross, Sales Manager, Tree CarePhone (800-831-0042) | Fax (989-866-2280)[email protected]
Chippers - Whole Log
Morbark, Inc.
8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896John Foote, Vice President, Sales and MarketingPhone (800-831-0042) | Fax (989-866-2280)[email protected]
ANDRITZ
1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing CoordPhone (289-239-9456)[email protected]
Grinders - Horizontal
Morbark, Inc.
8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896John Foote, Vice President, Sales and MarketingPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Continental Biomass Industries, Inc.
22 Whittier St.Newton, NH 03858Art Murphy, Marketing ManagerPhone (603-382-0556)[email protected] OUR AD ON PAGE 17
Rawlings Waste Wood Recovery Systems
PO Box 4485Missoula, MT 59806John Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)[email protected] OUR AD ON PAGE 16
Vecoplan, LLC
PO Box 7224High Point, NC 27264Yuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 19
Grinders - Tub
Morbark, Inc.
8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896John Foote, Vice President, Sales and MarketingPhone (800-831-0042) | Fax (989-866-2280)[email protected]
American Property Experts
606 Sunnyvale DriveWilmington, NC 28412Bill Waggaman, Business DevelopmentPhone (910-793-1460) | Fax (910-793-6227)[email protected]
Rawlings Waste Wood Hogs• Biomass & Co-Gen Operations• Sawmill and Log Yard Waste• Pulp, Pellet & Paper Plants
• Compost & Mulch Operations• Wood Waste Recycling Facilities• Alternative Fuels for Cement Manufacturing
For over 35 Years Rawlings is a proven leader in cost effective wood waste recovery equipment.
Ph: 1.866.RocWear (762.9327) or 406.728.6182 • www.wastewoodhogs.com
Densifi cation & Size Reduction
Densifi cation & Size Reduction
Densifi cation & Size Reduction Grinders - Vertical
Grinders - Vertical
Brunette Machinery Co.
8717 132nd StreetSurrey, BC V3W 4P1 CanadaKirk Forbes, PresidentPhone (604-522-3977)[email protected]
Vecoplan, LLC
PO Box 7224High Point, NC 27264Yuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 19
Mills - Hammer
Andrirz Feed and Biofuel
336 West PennMuncy, PA 17756Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)[email protected]/ft
Bliss Industries, LLC
1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601Chad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
Williams Patent Crusher &
Pulverizer Company, Inc.
2701 North BroadwaySt. Louis , MO 63102Steve Baumgartner, Sales ManagerPhone (314-621-3348) | Fax (314-436-2639)[email protected]
Pellet Mills
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Andrirz Feed and Biofuel
336 West PennMuncy, PA 17756Joanne Turnell, Sales & Marketing CoordPhone (289-239-9456)[email protected]/ft
Anyang General International Group
Renmin Road, Anyang, ChinaMNancy Yang, Manager AssistantPhone (863725965148)[email protected]
Bliss Industries, LLC
1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601Chad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]
CPM Roskamp Champion
2975 Airline CircleWaterloo, IA 50703Tim Gilbert, North American ManagerPhone (800-366-2563)[email protected] OUR AD ON PAGE 18
Vecoplan Midwest
4005 Earnings WayNew Albany, IN 47150Bill Miller, Chief Operating Offi cerPhone (812-923-4992)[email protected] OUR AD ON PAGE 19
Victor Pellet Mill
Wenhua Road Zhengzhou, ChinaWales Z, SalesmanPhone (8637156747890)[email protected]://www.pelletizermill.com/
Pyrolysis
Heyl & Patterson Inc.
400 Lydia StreetCarnegie, PA 15106Sales Dept.
Phone (412-788-9810) | Fax (412-788-9822)[email protected]
Torrefaction
Agri-Tech Producers, LLC (ATP)
116 Wildewood Club CourtColumbia, SC 29223Joseph James, PresidentPhone (803-462-0153) | Fax (803-462-9676)[email protected]
Heyl & Patterson Inc.
400 Lydia StreetCarnegie, PA 15106Sales Dept. Phone (412-788-9810) | Fax (412-788-9822)[email protected]
Konza Renewable Fuels
2953 SW Wanamaker DrTopeka, KS 66614Josh Thompson, MemberPhone (785-286-7390)[email protected]://www.konzarf.com/Contact.aspx
18 | 2015 Biomass Industry Directory
Executive Search
H.T. PROF Clean Tech
575 N. Patterson Ave.Suite 444Winston-Salem, NC 27101Todd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)[email protected]/clean-tech.htm
Commodity Talent LLC
349 Fifth Ave., 7th Flr.New York, NY 10016George Stein, Managing DirectorPhone (646-205-3557)[email protected]
Olson Search International, Inc.
PO Box 3127Redmond, WA 98073Jon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)[email protected]
Top Wood Jobs
PO Box 4La Center, WA 98629George Meek, RecruiterPhone (360-263-3371)[email protected]
Education Education
Education
Martin Engineering
One Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)[email protected]
Amatrol Inc.
2400 Centennial Blvd.Jeff ersonville, IN 47130Luke Gillenwater, InternPhone (800-264-8285) | Fax (812-283-1584)[email protected]
Employment
Education
2015 Biomass Industry Directory | 19
Engineering & Construction Anaerobic Digestion Systems
DESIGNING INNOVATIONBiomass Feedstock Processing Systems
(336) 252-4095
vecoplanllc.com
Cellulosic Ethanol • Pellet Production • Combined Heating and Power • Co-Firing Utilities
A worldwide leader in size reduction technology for bioenergy, Vecoplan works with individual customers to design, engineer, manufacture and implement technologically advanced, material specific, and application specific shredding, ferrous and non-ferrous removal, size and density separation, screening and classification technologies and extremely efficient conveyor and bulk material handling, metering, storage and unloading technologies.
Contact Vecoplan today to learn more about our existing systemsor to arrange a visit to one, or several, of our installations.
Engineering & ConstructionAnaerobic Digestion
Systems
ADI Systems Inc.
370 Wilsey RoadFredericton, NB E3B 6E9 CanadaScott Christian, Vice President, Business DevelopmentPhone (506-452-7107)[email protected]
RWL Water
7135 Madison Avenue WestGolden Valley, MN 55427Nii Mensah, VP of Sales & MarketingPhone (763-746-9277) | Fax (763-746-8408)[email protected]
Adtec Power Gmbh
Industriestrasse 1Hard, 6971 AustriaBernhard Schulz, CEOPhone (00436606489040)[email protected]
BIOGAS Equity 2, Inc.
130 Eleanor Dr.Woodside, CA 94062Mike Muller, COOPhone (650-283-9555)[email protected]
Eisenmann
150 E Dartmoor DriveCrystal Lake, IL 60014John McDowell, Sales EngineerPhone (815-477-5335)[email protected]
SeaHold LLC
23551 Rose Quartz DrivePerris, CA 92570Thomas Hintz, Managing PartnerPhone (951-943-9697)[email protected]
Vecoplan, LLC
PO Box 7224High Point, NC 27264Yuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 19
Biomethane
Urban Renewable H2
3010 LBJ Freeway Suite 1200Dallas, TX 75234Ray Gwin, CEOPhone (214-796-4033)[email protected]
Buildings
Greystone Construction
500 S. Marschall Road, Suite 300Shakopee, MN 55379Colin O’Brien, Business Development ManagerPhone (952-496-2227) | Fax (952-445-4191)[email protected]
ICS, Inc.
(Industrial Contract Services, Inc.)
PO Box 13158Grand Forks, ND 58208-3158David Dangerfi eld, Project DevelopmentPhone (701-775-8480) | Fax (701-775-8479)ddangerfi [email protected]
Miron Construction Co., Inc.
1471 McMahon DriveNeenah, WI 54956Dan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004) | Fax (920-969-7393)[email protected]
Natural Light Fabric Structures
397 Ervin Industrial DriveJordan, MN 55352Colin O’Brien, Dealer/Business Development ManagerPhone (888-708-3272)[email protected]
Rubb Buildings Inc.
1 Rubb LaneSanford, ME 04073Chuck Auger, Marketing ManagerPhone (207-324-2877)[email protected]
Civil Engineering
Cimarron Light & Power Systems
506 Riverside Drive NEHuron, SD 57350James Schaeff er, PresidentPhone (605-352-4460) | Fax (605-352-1430)[email protected]
CHP Systems
AgriPower, Inc.
46 Deepdale DriveGreat Neck, NY 11021Barry Berman, CEOPhone (516-829-2000) | Fax (516-487-3163)[email protected]
Engineering & Construction CHP Systems
2014 Biomass Industry Directory | 21
WWW.AGRAIND.COM800-842-8033 AGRA HAS CUSTOM-DESIGNED BIOMASS SOLUTIONS FOR YOU!
TO FABRICATIONFROM DESIGN
AGRAIndustries
YOUR EPC CONTRACTOR
TO COMPLETION!
Engineering & ConstructionSolar Turbines Incorporated
9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)[email protected]
Detailed Design
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)[email protected]
Evergreen Engineering, Inc.
1740 Willow Creek CircleEugene, OR 97402Aaron Edewards, Business Development DirectorPhone (541-484-4771) | Fax (541-484-6759)[email protected]
District Heating Systems
Solar Turbines Incorporated
9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)[email protected]
Electrical
ESP
1075 Progress CircleLawrenceville, GA 30043Jim Batten, V.P. of SalesPhone (770-682-8259) | Fax (770-277-5524)[email protected]
EPC
AGRA Industries
1211 West Water StreetMerrill, WI 54452Tim Gruling, Manager of SalesPhone (715-536-9584) | Fax (715-536-9587)[email protected] OUR AD ON PAGE 21
Fagen, Inc.
501 W. Hwy 212Granite Falls, MN 56241Richard Cantor, Vice President, Business DevelopmentPhone (864-430-5338)[email protected]
Gray
10 Quality StreetLexington, KY 40507Alex De Martini, Manager, Business DevelopmentPhone (859-281-5000) | Fax (859-252-5300)[email protected] OUR AD ON PAGE 23
OSDV Engineering Inc.
1 Rabbit RunWilmington, DE 19809Charlesl Clerecuzio, Principal / Chief EngineerPhone (856-266-2550)[email protected]
Venture Engineering &
Construction, Inc.
1501 Reedsdale StreetSuite 505Pittsburgh, PA 15233Bill Slatosky, Sr. Business Development ManagerPhone (412-231-5890) | Fax (412-231-5891)[email protected]
Waste Environmental Solutions, LLC
437 Linden AveElizabeth, NJ 07202Nestor Vela, COOPhone (732-489-0015) | Fax (732-833-8874)[email protected]
Waterleau
1300 Adams Ave, Apt 32PCosta Mesa, CA 92626Laetitia d’Ursel, Business Development ManagerPhone (714-727-7607)[email protected]
Fabrication
AGRA Industries
1211 West Water StreetMerrill, WI 54452Tim Gruling, Manager of SalesPhone (715-536-9584) | Fax (715-536-9587)[email protected] OUR AD ON PAGE 21
AGRA Industries
1211 West Water StreetMerrill, WI 54452 USPat Hinner, PresidentPhone (800-842-8033)[email protected] OUR AD ON PAGE 21
Andy J. Egan Co.
2011 Waldorf NWSuite 200Grand Rapids, MI 49544Rick Atkins, FabricationPhone (616-791-9952)[email protected]
PanAmerican Hydrogen, Inc.
5806 E. Grimes St.Harlingen, TX 78550Barbara Martinez, VPPhone (956-365-3773) | Fax (956-365-3739)[email protected] OUR AD ON PAGE 24
Gasifi ers
PHG Energy
3048 Owen DriveAntioch, TN 37013Mike Webb, Director of Business DevelopmentPhone (615-471-9299)[email protected]
Heat Transfer International
4720 44th Street SEKentwood, MI 49512Project Development, Sales ManagerPhone (616-551-5420)[email protected]
PRM Energy Systems, Inc.
504 Windamere TerraceHot Springs, AR 71913Ron Bailey, ChmPhone (501-276-2101) | Fax (501-767-7679)[email protected]
22 | 2015 Biomass Industry Directory
Smart E2 Solutions
14 Edgewood RoadRumson, NJ 07760George St.Onge, Director of Business DevelopmentPhone (732-801-6828) | Fax (732-758-1169)[email protected]
Information Technology
Services
ALDATA Software
203, 211 Pembina Ave.Hinton, AB T7V 2B3 CanadaMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]
Verdanté BioEnergy Services
626 Harper Ave NWPO Box 2917Lenoir, NC 28645G. David Waechter, OwnerPhone (828-394-1246)[email protected]
Management Services
NAES Corporation
1180 NW Maple StreetSuite 200Issaquah, WA 98027Jeanette Carroll, Marketing ManagerPhone (425-961-4700)[email protected]
Piping
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Plant Optimization
ASI-Industrial
1300 Minnesota Ave.Billings, MT 59101Matthew Hamlin, Vice President SalesPhone (406-245-6231) | Fax (406-245-6236)[email protected]
Power Plant Construction
BBI Project Development
10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)[email protected] OUR AD ON PAGE 13
TEi Construction Services
170 Tucapau RdDuncan, SC 29334Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 5
Pyrolysis
Heat Transfer International
4720 44th Street SEKentwood, MI 49512 USProject Development, Sales ManagerPhone (616-551-5420)[email protected]
STRATA
503 Olympic BlvdSanta Monica, CA 90401Josh Seldner, OwnerPhone (310-739-8243)[email protected]
Western Renewable Technologies
310 N Geneva RoadLindon, UT 84042Mel Radmall, CEOPhone (801-785-9330)[email protected]
Stacks
Hoff mann, Inc.
6001 49th St. SouthMuscatine, IA 52761Paul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)sales@hoff manninc.comwww.hoff manninc.com
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Structural Fabrication
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Torrefaction
Heat Transfer International
4720 44th Street SEKentwood, MI 49512Project Development, Sales ManagerPhone (616-551-5420)[email protected]
Water Treatment
Symbiont
www.symbiontonline.com
Feedstock Supply
Engineering & Construction
Project Development
Biomass Based Fuel Oil
Global Clean Energy Holdings
2790 Skypark DriveSuite 105Torrance, CA 90505Richard Palmer, President and CEOPhone (310-641-4234)[email protected]
Lewis & Raulerson, Inc.
1759 State StreetWaycross, GA 31501Casey Hall, Executive AssistantPhone (912-283-5951) | Fax (912-283-8281)[email protected]
Sustainable Oils
2790 Skypark DriveSuite 105Torrance, CA 90505Scott Johnson, PresidentPhone (919-428-1102)[email protected]
Briquettes
HerBasant Industries
At Sanjivani BuildingFarm Road, Modi Para,Sambalpur, 768002 IndiaL K Agrawal, General ManagerPhone (09438631539)[email protected]://www.herbsantextracts.com/
Dedicated Energy Crops
Novatos RE Agro-Industrial
24 Dollar St., CGPV, Felix Ave, Cainta, RizalRizal, 1400 PhilippinesRoberto Alip, PresidentPhone (639192359694)[email protected]/novatos.re
NRG Farm Consulting, LLC
3813 HabershamSchertz, TX 78154Bud Wylie, PresidentPhone (210-725-1756)[email protected]
Pellets
Curran Renewable Energy, LLC
20 Commerce DriveMassena, NY 13662Patrick Curran, President / OwnerPhone (315-769-2000)[email protected]
Engineering & Construction Gasifi ers
2015 Biomass Industry Directory | 23
BUILDING TOGETHERFOR THE FUTURE
gray.com
Feedstock Supply
WastAway
P.O. Box 7116McMinnville, TN 37111Terry Moore, Chief Business Development Offi cerPhone (931-815-8520)[email protected]
African Green Developments (Pty)Ltd.
80 Milner Rd. MidrandJohannesburg, 1865 South AfricaLeon-Valeri Eremin, CEOPhone (0822647781)[email protected]
E3Coal
Rissener Landstrasse 255Hamburg, 22559 GermanyChristopher Stone
Phone (0012022156201)[email protected]
Northeast Wood Products, LLC
13 Crow Hill RoadUncasville, CT 06382Mike Reid, SVP-Business DevelopmentPhone (855-324-9621)[email protected] OUR AD ON PAGE 25
West Oregon Wood Products, Inc.
PO Box 249Columbia City, OR 97018Chris Sharron, CEOPhone (503-397-6707) | Fax (503-397-6887)[email protected]
Wood Chips
Burns Forest Products LLC
17691 Hwy 4Bienville, LA 71008John Russo, COOPhone (318-259-4997) | Fax (318-259-6338)[email protected]
Ecostrat Inc.
60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaJordan Solomon, PresidentPhone (416-968-8884 ext. 222) Fax (416-968-8886)[email protected]
Foster Brothers
PO Box 249Auxvasse, MO 65231Steve Foster, VPPhone (573-386-2271) | Fax (573-386-2676)[email protected]
Wood Residues
Ecostrat Inc.
60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaJordan Solomon, PresidentPhone (416-968-8884 ext. 222) Fax (416-968-8886)[email protected]
Legal ServicesAttorney
Agriculture Law & Consulting LLC
16240 Burt StreetOmaha, NE 68118David Bracht, OwnerPhone (402-981-2900)[email protected]/pub/david-bracht/1/11b/66
Kilpatrick Townsend & Stockton LLP
607 14th Street, NWSuite 900Washington, DC 20005Mark Riedy, CounselPhone (202-508-5823) | Fax (202-318-4087)[email protected]
Schnader Harrison Segal & Lewis LLP
Suite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222Megan Harmon, PartnerPhone (412-577-5200)[email protected]
Intellectual Property
Sterne, Kessler, Goldstein & Fox P.L.L.C.
1100 New York Ave, NWWashington, DC 20005Peter Jackman, DirectorPhone (202-772-8585)[email protected]
Feedstock Supply Pellets
2015 Biomass Industry Directory | 25
Material Handling & StorageBucket Loader
Kenco Engineering, Inc.
2155 PFE RoadRoseville, CA 95747Ron Brajkovich, Regional ManagerPhone (800-363-9859) | Fax (916-783-3494)[email protected]
Conveyor-Belt
Martin Engineering
One Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)[email protected]
4B Components Ltd.
625 Erie AvenueMorton, IL 615504B Sales, 4B SalesPhone (309-698-5611)[email protected]/usa
B.I.D. Canada Ltd.
171 Hemlock StreetLower Woodstock, NB E7M 4E6 CanadaDerek Lawrence, Sales & Estimating ManagerPhone (506-328-4381 X 510)[email protected]
ProcessBarron
2770 Welborn St.Pelham, AL 35124Cliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)[email protected] OUR AD ON PAGE 28
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Conveyor-Drag
DI PIÙ - Sunomi LLC
608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)[email protected]
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Conveyor-Enclosed
SHW Storage & Handling Solutions
GmbH
www.shw-shs.com
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Conveyor-Mechanical
SHW Storage & Handling Solutions
GmbH
www.shw-shs.com
Vecoplan, LLC
PO Box 7224High Point, NC 27264Yuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 19
Material Handling & Storage Bucket Loader
26 | 2015 Biomass Industry Directory
Material Handling & StorageWarren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone 559-591-6790) | Fax ([email protected]
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Conveyor-Pneumatic
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Conveyor-Screw
DI PIÙ - Sunomi LLC
608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)[email protected]
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
SHW Storage &
Handling Solutions GmbH
www.shw-shs.com
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Cranes-Overhead
Processbio A/S
PO Box 34 Romeo, MI 48065Jorgen Lyngso, American representativePhone (586-255-7075)[email protected]
ANDRITZ
1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing CoordPhone (289-239-9456)[email protected]
Dryer - Conveyor
CPM Wolverine Proctor, LLC
251 Gilbraltar RoadHorsham, PA 19044Chris Law, Industry ManagerPhone (215-443-5200) | Fax (215-443-5206)[email protected] OUR AD ON PAGE 26
Dryer - Flash
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)[email protected]
Dryer - Ring
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)[email protected]
Dryer - Rotary Drum
Astec, Inc.
4101 Jerome AvenueChattanooga, TN 37407Malcolm Swanson, PresidentPhone (423-867-4210) | Fax (423-867-4636)[email protected] OUR AD ON PAGE 56
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)[email protected]
Material Handling Conveyor-Mechanical
2015 Biomass Industry Directory | 27
SCREEN, SIFT AND SCALP foreign material with non-vibrating screening technology. Easy installation and low maintenance.
Sfnta
Manufacturing, Inc.
Heyl & Patterson Inc.
400 Lydia StreetCarnegie, PA 15106Sales Dept., Phone (412-788-9810) | Fax (412-788-9822)[email protected]
Thompson Dehydrating Company
2953 SW Wanamaker DrTopeka, KS 66614Ted Thompson, CEOPhone (785-272-7722)[email protected]://www.thompsondryers.com/
Dryer - Spray
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000) [email protected]
Dryer - Steam Tube
Davenport Dryer
301 2nd StRock Island, IL 61204Rob Feller, Sales ManagerPhone (309-283-1134)[email protected]
Elevator-Bolts
4B Components Ltd.
625 Erie AvenueMorton, IL 615504B Sales
Phone (309-698-5611)[email protected]/usa
Elevator-Buckets
4B Components Ltd.
625 Erie AvenueMorton, IL 615504B Sales Phone (309-698-5611)[email protected]/usa
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Import / Export Services
Protective Packaging Corp.
1746 W. Crosby RoadCarrollton, TX 75006Anita Pinkerton, ConsultantPhone (800-644-4032)[email protected]
Loading Equipment
DYNATEK Loading Systems
200 North Harrison StNorth Prairie, WI 53153Gary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)[email protected]
SAMSON Materials Handling Ltd.
Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA Great BritainAndy Blythe, Managing DirectorPhone (441353665001) Fax (441353666734)[email protected]
Railcar-Moving
Heyl & Patterson Inc.
400 Lydia StreetCarnegie, PA 15106Sales Dept.
Phone (412-788-9810) | Fax (412-788-9822)[email protected]
Scale-Bulk Weigh
Hyer Industries-Thayer Scale
91 Schoosett St.PO Box 669Pembroke, MA 02359Peter Sirrico, Regional Sales ManagerPhone (781-826-8101) | Fax (781-826-0072)[email protected]
Scale-Software
Baywood Technologies Inc.
5210 Belfort Road, Suite 210Jacksonville, FL 32256Shannon Fitzgerald, Business DevelopmentPhone (904-733-7336) | Fax (904-731-5695)shannon.fi [email protected]
Screens-Disc
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
SHW Storage &
Handling Solutions GmbH
www.shw-shs.com
Screens-Disc Scalping
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
Screens-Fines
Morbark, Inc.
8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896John Foote, Vice President, Sales and MarketingPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Material Handling & Storage
Material Handling & Storage Dryer - Rotary Drum
28 | 2015 Biomass Industry Directory
Our equipment’s tough so the transition won’t be.
Biomass Conversion
processbarron.com/biomass-conversion
Visit us at POWER-GEN International Booth #3021
Material Handling & StorageScreens-Fines
EBM Manufacturing
1014 Sherwood RdNorfolk, NE 68701Tiff any Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)tiff [email protected] OUR AD ON PAGE 27
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
Screens-Other
ANDRITZ
1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)[email protected]
Komptech Americas
10855 Dover Street, Suite 1000Westminster, CO 80021Brandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)[email protected]
Specialty Parts and
Equipment
Hawkeye Process Technology Systems
3000 Old Alabama RdSte 119-198Atlanta, GA 30022Bill Schafer, Director Business DevelopmentPhone (614-747-1737)[email protected]
Stockyard Equipment
SCHADE Lagertechnik GmbH
Bruchstrasse 1Gelsenkirchen, 45883 GermanyKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122) Fax (4920950316188)fi [email protected] OUR AD ON PAGE 29
Storage - Bins
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Hoff mann, Inc.
6001 49th St. SouthMuscatine, IA 52761Paul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)sales@hoff manninc.comwww.hoff manninc.com
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113 Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
packIQ
1 American WayAnderson, SC 29621Than Nguyen, ConsultantPhone (877-233-8668)[email protected]://packiq.com
Storage - Other
Warren & Baerg Manufacturing, Inc.
39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
Storage - Silos
DI PIÙ - Sunomi LLC
608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)[email protected]
Material Handling & Storage Screens-Fines
2014 Biomass Industry Directory | 29
W E C O N V E Y Q U A L I T Y
SCHADE Stockyard Equipment for Wood Pellets
SCHADE Lagertechnik GmbH Bruchstraße 1 45883 Gelsenkirchen Germany [email protected] www.schade-lagertechnik.com
Material Handling & StorageJeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
SHW Storage &
Handling Solutions GmbH
www.shw-shs.com
Storage – Silo Reclaimer
ANDRITZ
1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing CoordPhone (289-239-9456)[email protected]
Jeff rey Rader,
a brand of TerraSource Global
215 Parkway EastSuite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] reyrader.comSEE OUR AD ON PAGE 30
SHW Storage &
Handling Solutions GmbH
www.shw-shs.com
Trailer - Moving Floor
Hallco Industries Inc.
PO Box 505Tillamook, OR 97141Ricardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)[email protected]
Transportation - Barge
Ingram Barge Company
4400 Harding PikeNashville, TN 37205Blake Roberson, Senior Business Development AnalystPhone (615-298-7589)[email protected]
Cooper/Consolidated
1127 Highway 190, East Service RoadCovington, LA 70433Brent Mahana, Sales DirectorPhone (985-871-4403)[email protected]
Transportation - Rail
Iowa Northern Railway
305 2nd St SESuite 400Cedar Rapids, IA 52401William Rhodes, Director Reload MarketingPhone (3194158150)[email protected]
TrinityRail
2525 Stemmons FreewayDallas, TX 75207Gregg Yates, Director, MarketingPhone (214-631-4420) | Fax (214-589-8623)[email protected]
Transportation - Truck
AAA Cooper Transportation
1751 Kinsey Rd. Dothan, AL 36303Buddy Turner, Director - Bulk ServicesPhone (251-589-2348)[email protected]
Truck Receiving/Dumpers
Airofl ex Equipment
6001 49th St. SouthMuscatine, IA 52761Andy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)sales@airofl exequipment.comwww.airofl exequipment.com
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Vibration Equipment
Martin Engineering
One Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)[email protected]
Material Handling & Storage Storage - Silos
Publications
Biodiesel Magazine
308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]
Biomass Magazine
308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]
Ethanol Producer Magazine
308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]
Pellet Mill Magazine
308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]/pellets
30 | 2014 Biomass Industry Directory Handling a World of MaterialsThe brands comprising TerraSource Global (Gundlach Crushers, Jeffrey Rader and Pennsylvania Crusher) are wholly-owned subsidiaries of Hillenbrand, Inc. (NYSE: HI) © 2014 TerraSource Global. All Rights Reserved.
Proven Solutions for your Biomass Applications
Email: [email protected] Web: www.terrasource.com/bm
Pneumatic &MechanicalBoiler Feeds
ChipThicknessScreening
BiomassMaterialHandling
Storage &Reclaim
Equipment
Crushers,Feeders& Sizers
UnmatchedParts and
ServiceStore, reclaim,
convey and feed biomass and
alternative fuels directly into
boilers and kilns.
Chip screening, air density separation and overthick chip
conditioning or sizing for digester
optimization.
Support for biomass energy generation
from truck/rail receiving through
metered infeed into the boiler.
Open air or enclosed storage
with circular or linear design
your application.
Primary and secondary crushing as well as multiple feeder options to process coal and
biomass.
Replacement parts, OEM
installation,start-up, training
and repair.
3 market-leading brands trusted and recognized throughout the world, 1 source.
Media
Air Pollution Control
ALSTOM Power, Inc-Environmental
Control Solutions
1409 Center Point Blvd.Knoxville, TN 37932Mark Walters, Business Sales ManagerPhone (770-876-1163)[email protected]
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
NESTEC Inc.
21 Unionville RoadP.O. Box 568 Douglassville, PA 19518Jim Nester, PresidentPhone (610-323-7670) | Fax (610-323-7672)[email protected]
Anguil Environmental Systems, Inc.
8855 North 55th StreetMilwaukee, WI 53223Kevin Summ, Marketing ManagerPhone (414-365-6400) | Fax (414-365-6410)[email protected]
Babcock Power Environmental
5 Neponset StreetWorcester, MA 01615 Jennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)[email protected]/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 5
CLARCOR Industrial Air
11501 Outlook Street, Suite 100Overland Park, KS 66210Tim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]
Media Publications
Process Equipment & Services
2015 Biomass Industry Directory | 31
Process Equipment & ServicesEcospray Technologies S.r.l.
5 Thawmont DriveSewickley, PA 15143Jo Ann Pacinelli, North AmericaPhone (412-427-0133) | Fax (412-741-8386)[email protected]
Eisenmann
150 E Dartmoor DriveCrystal Lake, IL 60014 John McDowell, Sales EngineerPhone (815-477-5335)[email protected]
Redecam USA
2125 Barrett Park Drive, Suite 112BKennesaw, GA 30144Rick Davies, Managing Director, V.P. N. America at REDECAM USAPhone (678-909-2342) | Fax (678-909-2359)www.redecam.com
SysTech Design, Inc.
300 North Pottstown PikeExton, PA 19341John Conley , OwnerPhone (800-456-9460)[email protected]
Binders & Surfactants
Emisshield Inc.
2000 Kraft DriveSuite 2600Blacksburg, VA 24060Tim Wilson, Project ManagerPhone (540-961-0999)[email protected]
Biogas-Capture
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Geomembrane Technologies Inc. (GTI)
370 Wilsey RoadFredericton, AB E3B 6E9 CanadaDarin Evans, Manager, Product DevelopmentPhone (1.506.452.7304) Fax (1.506.452.6625)[email protected]
Biogas-Purifi cation
Beltran Technologies, Inc.
1133 East 35 StreetBrooklyn, NY 11210Gary Siegel, Marketing DirectorPhone (718-338-3311) | Fax (718-253-9028)[email protected] OUR AD ON PAGE 32
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Clean Methane Systems LLC
19125 SW 125th CTTualatin, OR 97062Timothy Robinson, PresidentPhone (425-420-1979) | Fax (425-491-7740)[email protected]
Spencer Turbine Company
600 Day Hill RoadWindsor, CT 06095Chet Adamczyk, Sr Sales Engr - Biogas & WWT Phone (860-688-8361) | Fax (860-688-0098)[email protected]
Boilers - Direct Fired
Northwest Manufacturing, Inc./
WoodMaster
600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 43
Hurst Boiler & Welding Co., Inc.
100 Boilermaker LaneCoolidge, GA 31738Jeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Process Equipment & Services Air Pollution Control
32 | 2015 Biomass Industry Directory
Beltran Technologies, Inc.1133 East 35th St., Brooklyn, NY 11210 USA718.338.3311 • Fax: 718.253.9028info@beltrantechnologies.comwww.beltrantechnologies.com
BELTRANTECHNOLOGIES, INC.
FROM WASTE TO WATTS:THE BELTRAN BIOMASS GASIFICATION SYSTEM
Ask for our free TECH REPORT, From Waste to Watts.
Beltran’s advanced technology convertscarbon-based waste into profitablebioenergy, biofuels and co-products your company can use now!
• Biomass feedstock-flexible system can use low-value agricultural, animal, industrial, wood or municipal wastes.
• Produces clean-burning, multi-use synthesis gas, combined heat & power (CHP), biofuels, hydrogen, marketable chemicals.
• Advanced gasification reactor, wet electrostatic precipitator and engine-generator are closely integrated for optimum efficiency.
• Scalable, adaptable solution for harvesting safe, renewable energy, reducing pollution and CO2, and turning costly waste into sustainable profit.
Process Equipment & Services
Boilers - Firetube
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Boilers - Fluidized Bed
Valmet, Inc.
3430 Toringdon WaySuite 201Charlotte, NC 28277Kerry Flick, Director, TechnologyPhone (704-541-1453)kerry.fl [email protected]
ANDRITZ
1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing CoordPhone (289-239-9456)[email protected]
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Outotec Energy Products
3568 W Industrial LoopCoeur d’Alene, ID 83815Kent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)[email protected]
Boilers - Hot Water
Northwest Manufacturing, Inc./
WoodMaster
600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 43
Biomass Heating Solutions
201 East 12th StreetAlturas, CA 96101Terry Olson, OwnerPhone (530-640-1072) | Fax (530-233-3450)[email protected]
Biomass Systems Supply
P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) | Fax (530-893-2444)[email protected]
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Viessmann Manufacturing Company
(U.S.), Inc.
45 Access RoadWarwick, RI 02886Lee Gustafson, MarketingPhone (401-732-0667) | Fax (401-732-0590)[email protected]
Webiomass Inc.
16 Washington St (mail)56 Howe St (plant)Rutland, VT 05701George Robbins, PresidentPhone (802-772-7563) | Fax (802-772-7564)[email protected]
Boilers - Parts & Service
Boiler Tube Company of America
506 Charlotte HighwayLyman, SC 29365Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/boiler-tube-co-of-americaSEE OUR AD ON PAGE 5
EquipNet, Inc.
5 Dan RoadCanton, MA 02021Emily Coleman
Phone (781-821-3482) | Fax (617-671-1269)[email protected]
Process Equipment & Services Boilers - Firetube
2015 Biomass Industry Directory | 33
Rotary Cascading Bed
Combustor Boiler (RCBC)
• Combust gases, MSW, sludge and liquids
• Produce steam and electricity
• No health and environmental hazards
• Ash co-product for fertilizer and land reclamation
• ASME Approved
Revolutionary New
Process Turns
Garbage into Energy
www.RCBCglobalinc.com
800-696-2110
Process Equipment & ServicesIndeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Riley Power Inc.
5 Neponset StreetWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 5
Welding Technologies
2330 Centennial DriveGainesville, GA 30504Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/welding-technologiesSEE OUR AD ON PAGE 5
Boilers - Solid Fuel
Northwest Manufacturing, Inc./
WoodMaster
600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) Fax (218-253-4409)[email protected] OUR AD ON PAGE 43
Biomass Systems Supply
P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) Fax (530-893-2444)[email protected]
EcoHeat Solutions LLC
153 Washington StBox B 9East Walpole, MA 02032George Whiting, PresidentPhone (877-317-0700)[email protected]
GARN Wood Heating
3425 33rd Ave. NEMinneapolis, MN 55418 USMartin Lunde, PresidentPhone (612-326-1104)[email protected]
Boilers - Steam
Babcock Power Services
5 Neponset StWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 5
Biomass Systems Supply
P.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) Fax (530-893-2444)[email protected]
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Boilers - Waste Heat
Recovery
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
RCBC Global Inc.
401 North Main St., Suite 201Hendersonville, NC 28792Doug King, VP MarketingPhone (828-696-2111)[email protected]
Centrifuges
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)[email protected]
CHP
Hydro-Thermal Corp.
400 Pilot CourtWaukesha, WI 53188Sales Department
Phone (262-548-8900) Fax (262-548-8908)[email protected]://www.hydro-thermal.com
Pick Heaters, Inc.
730 S. Indiana Ave.PO Box 516West Bend, WI 53095Sales Dept.
Phone (262-338-1191) Fax (262-338-8489)[email protected]
Cleaning
Seneca Companies
7241 Gaines Street CourtDavenport, IA 52806Chris Biellier, Waste Solutions General ManagerPhone (563-343-4679)[email protected]
Combustion Equipment
Detroit Stoker Company
1510 East First StreetMonroe, MI 48161Tim Loviska, Director - Contract SalesPhone (734-241-9500) Fax (734-241-7126)[email protected] OUR AD ON PAGE 34
Solar Turbines Incorporated
9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)[email protected]
Condensors
Thermal Engineering Int’l (USA)
10375 Slusher DriveSanta Fe Springs, CA 90670Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 5
Control Systems
Beijer Electronics
1865 West 2100 SouthSalt Lake City, UT 84119Jeff Hayes, Product ManagerPhone (801-466-8770)jeff [email protected]
Process Equipment & Services Boilers-Parts & Service
34 | 2015 Biomass Industry Directory
Process Equipment & Services4B Components Ltd.
625 Erie AvenueMorton, IL 615504B Sales
Phone (309-698-5611)[email protected]/usa
Cogent Industrial Technologies
Suite 180 - 13091 Vanier PlaceRichmond, BC V6V 2J1 CanadaBijan Shams, PresidentPhone (604-207-8880)[email protected]
SoftPLC Corporation
25603 Red BrangusSpicewood, TX 78669Cindy Hollenbeck, VPPhone (512-264-8390)[email protected]
Cooling Towers
Tower Performance, Inc.
4031 BroadwayHouston, TX 77087Jalene Fritz, Parts ManagerPhone (970-593-8637) | Fax (970-472-1304)[email protected]
Digester-Covers
Geomembrane Technologies Inc. (GTI)
370 Wilsey RoadFredericton, AB E3B 6E9 CanadaDarin Evans, Manager, Product DevelopmentPhone (1.506.452.7304) | Fax (1.506.452.6625)[email protected]
Dust Control - Baghouses
CLARCOR Industrial Air
11501 Outlook Street, Suite 100Overland Park, KS 66210Tim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]
Scientifi c Dust Collectors
4101 W. 126th StreetAlsip, IL 60007Andrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)arutherford@scientifi cdust.comscientifi cdustcollectors.com
Dust Control - Inertial Separators
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Process Equipment & Services Control Systems
2015 Biomass Industry Directory | 35
Process Equipment & ServicesKoger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Pinnacle Air Pollution Control
1177 Pittsburgh RoadSuite 203Valencia, PA 16059-3137Anthony Brajdic, Director of OperationsPhone (724-898-1220) | Fax (724-898-2229)[email protected]
Dust Control
- Unit Collectors
Martin Engineering
One Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)[email protected]
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Dust Control - Wet
Scrubbers
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Energy Management
SABIA Inc
10911 Technology PlSan Diego, CA 92127Paul Iverson, Product ManagerPhone (858-217-2232) | Fax (858-217-2203)[email protected]
Environmental Testing
Air Compliance Testing, Inc.
10060 Brecksville RoadSuite 1120Cleveland, CA 44141Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]://www.montrose-env.com/
Avogadro Environmental Corporation
1350 Sullivan TrailSuite AEaston, CA 18040Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]://www.montrose-env.com/
Bighorn Environmental Air Quality, LLC
1324 N Liberty Lake Road #266 Liberty Lake, WA 99019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Class One Technical Services, Inc.
3500 Camanche Rd NESuite GAlbuquerque, NM 87107Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Delta Air Quality Services, Inc.
1845 North Case Street Orange, CA 92865Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Eastmount Environmental Services, LLC
2 New Pasture RoadUnit #5Newburyport, CA 01950Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Emission Testing Services, Inc.
10461 Mammoth AveBaton Rouge, LA 70814Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
MEC Entec Services, LCC
30 Monroe DriveP.O. Box 1059Pelham, AL 35124Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Montrose Air Quality Services, LCC
4210 Resnik CourtSuite 200Bakersfi eld, CA 93313Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Montrose Environmental Group, Inc.
2 Park Plaza Suite 1120Irvine, CA 92614Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935) | Fax (925-429-9042)[email protected]
SCEC
1582-1 N. Batavia StreetOrange, CA 92867Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]://www.montrose-env.com/
South Florida Environmental
Services, LLC
2257 Vista ParkwayUnit 25West Palm Beach, FL 33411Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
The Air Compliance Group, LLC
5075 Hollins RoadRoanoke, VA 24019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
The Avogadro Group, LLC
2825 Verne Roberts CircleAntioch, CA 94509Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Fans
AirPro Fan & Blower Co.
PO Box 543Rhinelander, WI 54501Keith White, Sales EngineerPhone (715-365-3267)[email protected]
Jenkins & Brandt
PO Box 80609Atlanta, GA 30066Rick Brandt, PartnerPhone (770-650-7295) | Fax (678-594-0825)[email protected]
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Spencer Turbine Company
600 Day Hill RoadWindsor, CT 06095Chet Adamczyk, Sr Sales Engr - Biogas & WWT Phone (860-688-8361) | Fax (860-688-0098)[email protected]
Filters
CLARCOR Industrial Air
11501 Outlook Street, Suite 100Overland Park, KS 66210Tim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]
Orival, Inc.
213 S. Van Brunt StreetEnglewood, NJ 47352Marcus Allhands, Vice President of Business DevelopmentPhone (201-568-3311) | Fax (201-568-1916)[email protected]
Fire Protection
FLAMEX, Inc
4365 Federal DriveGreensboro, NC 27410Allen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)fl [email protected]
CV Technology
15852 Mercantile CourtJupiter, FL 33478Nicholas Licht, Sales Engineer Phone (561-694-9588) | Fax (561-694-9585)[email protected]
GreCon Spark Detection
15875 SW 74th Ave.Tigard, OR 97224Terry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)[email protected]/spark-detection/SEE OUR AD ON PAGE 37
Furnaces
Northwest Manufacturing, Inc./
WoodMaster
600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 43
Process Equipment & Services Dust Control - Inertial Separators
36 | 2015 Biomass Industry Directory
Process Equipment & ServicesFurnaces
REBL Refractories Evaluations
Laboratory, ULC
#109, 8484 162nd StreetSurrey, BC V4N 1B4 CanadaBryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)[email protected]
Generator-Diesel / Biodiesel
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Generator-Natural Gas /
Biogas
Solar Turbines Incorporated
9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)[email protected]
Generator-Steam Turbine
Elliott Group
901 North Fourth StreetJeannette, PA 15644Phil Rutkowski, Sales ManagerPhone (303-503-1134)[email protected]
Triveni Turbine Ltd.
12A, Peenya Industrial AreaBangaloreBangalore, 560058 IndiaDeepak Nayak, Asst. Gen. Manager-International Sales & MarketingPhone (918022164000) Fax (918028395945)[email protected]
Vogt Power International
13551 Triton Park BoulevardSuite 2000Louisville, KY 40223Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-recovery-systems/vogt-power-internationalSEE OUR AD ON PAGE 5
Heat Exchangers-Direct
Contact
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Direct Contact LLC
2555 34th Street NECanton, OH 44708Curt Rothman, CEOPhone (330-437-0444)[email protected]
Hydro-Thermal Corp.
400 Pilot CourtWaukesha, WI 53188Sales Department
Phone (262-548-8900) | Fax (262-548-8908)[email protected]://www.hydro-thermal.com
Pick Heaters, Inc.
730 S. Indiana Ave.PO Box 516West Bend, WI 53095Sales Dept.
Phone (262-338-1191) | Fax (262-338-8489)[email protected]
Heat Exchangers-Phase-
Change
AMSEnergy Corp.
1111 Bear Creek PikeColumbia, TN 38401Michael Sams, President & CEOPhone (615-852-8412)[email protected]
Heat Exchangers-Shell &
Tube
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Dale Stenning, V.P. Manager Evaporator DivisionPhone (708-747-7000)[email protected]
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Thermal Engineering Int’l (USA)
10375 Slusher DriveSanta Fe Springs, CA 90670Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 5
Heat Exchangers-Waste
Heat Recovery Unit
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Indeck Power
1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Hoppers
DI PIÙ - Sunomi LLC
608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)[email protected]
Wolf Material Handling Systems
12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 31
Instrumentation
Conveyor Components Company
130 Seltzer RoadPO Box 167Croswell, MI 48422Rich Washkevich, Sales ManagerPhone (810-679-4211) | Fax (810-679-4510)[email protected]
Levelese, Inc.
326 Steele StDenver, CO 80206Sallyanne Ofner, PresidentPhone (303-586-1425)[email protected]://www.levelese.com
Siemens Industry Inc.
7101 Hollister RoadHouston, TX 77040Customer Service, Phone (713-939-7400)[email protected]/processanalytics
Sierra Instruments, Inc.
5 Harris CourtBuilding LMonterey, CA 93940Scott Rouse, Product Line DirectorPhone (831-373-0200) | Fax (831-373-4402)[email protected]
Laboratory Equipment
COSA Xentaur Corp.
84G Horseblock RdUnit GYaphank, NY 11980Colin Mueller, Marketing DirectorPhone (631-345-3434)[email protected]
Elementar Americas
520 Fellowship Rd, Ste D-408Mt Laurel, NJ 08054Jean Bernius, Marketing ManagerPhone (856-787-0022)[email protected]
HEMCO Corporation
711 South Powell RoadIndependence, MO 64056Jerry Schwarz, Marketing / AdvertisingPhone (800-779-4362) | Fax (816-796-3333)[email protected]
Team Biogas®
23551 Rose Quartz DrivePerris, CA 92570Fabian Villanueva, Sales ManagerPhone (951-943-9697)[email protected]
Laboratory Services
Twin Ports Testing
1301 North 3rd StreetSuperior, WI 54880Stephen Sundeen, Laboratory ManagerPhone (800-373-2562) | Fax (715-392-7163)[email protected]
Associated Laboratories
806 N. Batavia St.Suite 1120Orange, CA 92868Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Process Equipment & Services Furnaces
2015 Biomass Industry Directory | 37
Biomass Energy Lab
1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Celignis Limited
T1-014 Tierney Building, University of LimerickLimerick, L111 IrelandDaniel Hayes
Phone (353894555582)[email protected]
R. W. Heiden Associates LLC
1026 New Holland AvenueP O Box 5001Lancaster, PA 17601Richard Heiden, Chief Science and Technology Offi cerPhone (717-299-6860) | Fax (717-299-6868)[email protected]
SciTech Group
Tekniikantie 12Espoo, 02150 FinlandJarno Hartikainen, ChemistPhone (358503411998)[email protected] www.scitech.fi
Timber Products Inspection
1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Lubricants
Ayalytical Instruments
2701 W. Fulton St. #5SChicago, IL 60612Juan Ayala, Managing DirectorPhone (312-622-7520)[email protected]
Mixers/Agitators
Hydro Dynamics, Inc.
8 Redmond Court NWRome, GA 30165Douglas Mancosky, VP - Research & DevelopmentPhone (706-234-4111) | Fax (706-234-0702)[email protected]
Moisture Analyzers
GreCon Moisture Meters
15875 SW 74th AveTigard, OR 97224Marshall LLoyd, SalesPhone (503-641-7731) | Fax (503-641-7508)[email protected]/measurement/ infrared-moisture-meterSEE OUR AD ON PAGE 37
Process Equipment & Services Laboratory Services
Process Equipment & Services
38 | 2015 Biomass Industry Directory
Process Equipment & Services
Moisture Analyzers
MOISTTECH
P O Box 118Tallevast, FL 34270-0118John Fordham, ManagerPhone (941-351-7870)[email protected]
NDC Technologies
5314 North Irwindale AvenueIrwindale, CA 91706Ray Shead, Marketing ManagerPhone (626-939-3856) | Fax (626-939-3870)[email protected]
Operations &
Maintenance (O&M)
Imerys
100 Mansell Court E.Suite 300Roswell, GA 30076Emmy Bracoud, Marketing AnalystPhone (678-579-2095)[email protected]
Pipe
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Pipe-Fittings
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Modern Industrial
2012 Highway 160 W, Suite 9Fort Mill, SC 29708Jon Payne, PresidentPhone (888-517-2310)[email protected]
Pipe-Flanges
Koger Air Corporation
P. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Pumps
Gorman-Rupp Company
600 S. Airport Rd.Mansfi eld, OH 44903Scott Derkez, National Sales ManagerPhone (419-755-1011) | Fax (419-755-1251)[email protected]
Safety
Martin Engineering
One Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)[email protected]
Exponent
4580 Weaver ParkwaySuite 100Warrenville, IL 60555Mark Fecke, Senior Managing EngineerPhone (630-658-7512)[email protected]/
IEP Technologies
417-1 South StreetMarlborough, MA 01752John Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)[email protected] OUR AD ON PAGE 40
Sensors
4B Components Ltd.
625 Erie AvenueMorton, IL 615504B Sales
Phone (309-698-5611)[email protected]/usa
Cornerstone Systems Ltd
Whitebridge WayStone, ST15 8LQ Great BritainGareth Hughes, DirectorPhone (01785818020) | Fax (01785811699)[email protected]
Optek-Danulat, Inc.
N118W18748 Bunsen DrGermantown, WI 53022Joe Ferrelli, Product SpecialistPhone (888-901-4288)[email protected]
Sierra Instruments, Inc.
5 Harris CourtBuilding LMonterey, CA 93940Scott Rouse, Product Line DirectorPhone (831-373-0200) | Fax (831-373-4402)[email protected]://www.sierrainstruments.com/
Separators
Dedert Corporation
17740 Hoff man WayHomewood, IL 60430Dale Stenning, V.P. Manager Evaporator DivisionPhone (708-747-7000)[email protected]
Separators-Magnetic
Puritan Magnetics, Inc.
900 S. Glaspie StreetOxford, MI 48371Andrea Webster, Sales & MarketingPhone (248-628-3808) | Fax (248-628-3844)[email protected]
Process Equipment & Services Moisture Analyzers
2015 Biomass Industry Directory | 39
Valves
Asahi/America
655 Andover StLawrence, MA 01843Jeff Baker, Marketing ManagerPhone (781-321-5409)[email protected]
Everlasting Valce Company
108 Somogyi CourtSouth Plainfi eld, NJ 07080David Jenkins, General Sales ManagerPhone (908-769-0700) | Fax (908-769-8697)[email protected]
Modern Industrial
2012 Highway 160 W, Suite 9Fort Mill, SC 29708Jon Payne, PresidentPhone (888-517-2310)[email protected]/
VOC Scrubbers
NESTEC Inc.
21 Unionville RoadP.O. Box 568 Douglassville, PA 19518Jim Nester, PresidentPhone (610-323-7670) | Fax (610-323-7672)[email protected]
Bionomic Industries
777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Wastewater Treatment
ADI Systems Inc.
370 Wilsey RoadFredericton, AB E3B 6E9 CanadaScott Christian, Vice President, Business DevelopmentPhone (506-452-7107)[email protected]
SHW Storage &
Handling Solutions GmbH
www.shw-shs.com
Water Treatment
Hydro-Thermal Corp.
400 Pilot CourtWaukesha, WI 53188Sales Department
Phone (262-548-8900) | Fax (262-548-8908)[email protected]://www.hydro-thermal.com
Process Equipment & Services
Process Equipment & Services Valves
Project Development & FinanceAccounting
Christianson & Associates, PLLP
302 SW 5th StWillmar, MN 56201Bradley Pederson, PartnerPhone (320-235-5937) | Fax (320-235-5962)[email protected]
Business Plans
BBI Project Development
10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)[email protected] OUR AD ON PAGE 13
Christianson & Associates, PLLP
302 SW 5th StWillmar, MN 56201Sherry Jean Olson, ManagerPhone (320-235-5937) | Fax (320-235-5962)[email protected]
On The Green, LLC
10116 Daniels Run WayFairfax, VA 22030Mary Valenta, CEOPhone (205-266-3393)[email protected]
Debt Financing
Gateway Commercial Finance, LLC
340 SE 1st StreetDelray Beach, FL 33483Marc Marin, Managing DirectorPhone (855-424-2955) | Fax (561-734-2708)[email protected]://gatewaycfs.com
MKL Capital LLC
Box 963Bronxville, NY 10708Brian Morrison, Managing DirectorPhone (917-653-3017)[email protected]
Due Diligence
Arc5 Environmental Consulting LLC
20 Rockwood LnGroton, MA 01450David Minott, PresidentPhone (978-877-7719)[email protected]
Luminate, LLC
1801 BroadwaySuite 1620Denver, CO 80202Michael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)[email protected]
Renewable Strategies, Inc.
PO Box 185Shoreham, VT 05770Douglas Patterson, PresidentPhone (802-989-0476)[email protected]
Economic Development
Green Science Corporation
www.greensciencecorp.com
Feasibility Studies
BBI Project Development
10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)[email protected] SEE OUR AD ON PAGE 13
LMC International Ltd
1841 Broadway, 611New York, NY 10023Andrea Kavaler, Executive Vice PresidentPhone (212-586-2427)[email protected]
Christianson & Associates, PLLP
302 SW 5th StWillmar, MN 56201Sherry Jean Olson, ManagerPhone (320-235-5937) | Fax (320-235-5962)[email protected]
Enerion Biomass Solutions
Av. 27 de Febrero n. 233, Torre Corp. Corominas Pepín, 4th Floor Ensanche NacoSanto Domingo, 10150 Dominican RepublicAlessandro Pozzi, Phone (00393470449209)[email protected]
General Biomass Company
2906 Central StreetSuite 134Evanston, IL 60201Daniel Gibbs, CEOPhone (847-624-3590)[email protected]
Project Development
Project Development
40 | 2015 Biomass Industry Directory
Formerly Fenwal Explosion Protection
Project Development & Finance
Feasibility Studies Solar Turbines Incorporated
9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)[email protected]
Wood Waste to Rural Heat
110A Slater Road NWCranbrook, BC V1C 5C8 CanadaDavid Dubois, Project CoordinatorPhone (250-489-4356) | Fax (250-489-1886)[email protected]
Feedstock Pricing
Ecostrat Inc.
60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaBrett Hogarth, Head of Business DevelopmentPhone (416-968-8884 ext. 239) Fax (416-968-8886)[email protected]
Insurance
FieldEddy Division of Hub International
New England LLC
PO Box 70996 Shaker RdEast Longmeadow, MA 01028Teresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)[email protected] eldeddy.com
Market Data
Bioenergy Insight
124 Middleton RoadMordenSurrey SM4 6RW, Great BritainPeter Patterson, Managing DirectorPhone (442086487082)[email protected]
LMC International Ltd
1841 Broadway, Rm 611New York, NY 10023Andrea Kavaler, Executive Vice PresidentPhone (212-586-2427)[email protected]
RISI
4 Alfred CircleBedford, MA 01730Seth Walker, Bioenergy EconomistPhone (781-734-8992)[email protected]
Mergers & Acquisitions
Maas Companies
PO Box 7127Rochester, MN 55903Tyler Maas, Director of Sales and MarketingPhone (507-285-1444) | Fax (507-285-0034)[email protected]
Recast Energy LLC
8730 Stony Point ParkwaySuite 100Richmond, VA 23235Brandon Ogilvie, CFOPhone (804-212-3143)[email protected]
Permitting-Air
Arc5 Environmental Consulting LLC
20 Rockwood LnGroton, MA 01450David Minott, PresidentPhone (978-877-7719)[email protected]
Air Resource Specialists, Inc.
1901 Sharp Point Drive, Suite EFort Collins, CO 80525Howard Gebhart, Manager, Environmental Compliance SectionPhone (970-484-7941)[email protected]
RTP Environmental Associates, Inc.
400 Post AveSuite 405Westbury, NY 11590 USJessica Karras-Bailey, PrincipalPhone (516-333-4526) | Fax (516-333-4571)[email protected]
Project Development & Finance Feasibility Studies
2015 Biomass Industry Directory | 41
No matter what you’re processing – chemicals, food, pharmaceuticals,
biomass, wood products – if it produces dusts or powders, there’s a high
probability you have an explosion risk. All it takes to interrupt your plant
productivity is a combustible material, oxygen and an ignition source.
For more than six decades, IEP Technologies has provided the right
explosion protection solution for every type of process application.
From cyclone separators and dust collectors to milling equipment and
dryers. We can analyze your challenge, design a protection system and
surround you with 24/7 service and support. Protecting your plant starts
with knowing your explosion risk.
Let’s develop a solution for you
Call the IEP engineering experts with the most experience in explosion protection at 1-855-793-8407 or visit IEPTechnologies.com.
P R O T E C T I N G T H E W O R L D ’ S P R O C E S S E S A G A I N S T E X P L O S I O N
Project Development & Finance
Project Development & Finance Permitting -Other
Permitting-Other
Life Cycle Associates, LLC
884 Portola RoadSuite A11Portola Valley, CA 94028Stefan Unnasch, Managing DirectorPhone (650-461-9048)[email protected]
Risk Management
ATI Systems
30 Jeff ries St.East Boston, MA 02128Troy Fergus, Business DeveloperPhone (617-567-4969)[email protected]
Valuation and Assets Services
2108 Carroll Creek ViewFrederick, MD 21702K. Boison, PrincipalPhone (301-646-4119)[email protected]://www.valuationandassets.com
Site Selection
Ecostrat Inc.
60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaBrett Hogarth, Head of Business DevelopmentPhone (416-968-8884 ext. 239) Fax (416-968-8886)[email protected]
Software-Accounting
Christianson & Associates, PLLP
302 SW 5th St Willmar, MN 56201Fred Gould, Business Development ManagerPhone (320-235-5937) Fax (320-235-5962)[email protected]
Research & DevelopmentGovernment
Arizona State Forestry Division
3650 Lake Mary RdFlagstaff , AZ 86005Patrick Rappold, Wood Utilization & Marketing SpecialistPhone (928-774-1425)[email protected]
Kentucky Division of Biofuels
500 Mero Street, 6th FloorFrankfort, KY 40601Tim Hughes, DirectorPhone (502-564-7192) | Fax (502-564-7406)[email protected]/biofuels/Pages/default.aspx
Private
Biofuels Technology LLC
1201 Orange StreetSuite 600Wilmington, DE 19801Andrew Laitt, CEOPhone (302-966-9235)[email protected]
American Science and Technology
1367 W. Chicago Ave.Chicago, IL 60642Ali Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)[email protected] OUR AD ON PAGE 55
42 | 2015 Biomass Industry Directory
Research & Development
Private
Cellulose Pilot and Processing Lab
6445 Packer Dr.Wausau, WI 54401Eric Singsaas, DirectorPhone (715-340-2591)[email protected] SEE OUR AD ON PAGE 55
Centre for Process Innovation
Wilton Centre, WiltonRedcar, TS10 4RF Great BritainLiz Grylls Phone (441642455340)[email protected]://www.uk-cpi.com
FPInnovations
319, rue FranquetPointe-Claire, QB G1P 4R4 CanadaPhone (418-781-6722)[email protected] OUR AD ON PAGE 44
Refi ned BioProducts
1718 Pine StreetStevens Point, WI 54481John Leschke, New Business DevelopmentPhone (715-869-7866)jleschke@refi nedbioproducts.comwww.refi nedbioproducts.com SEE OUR AD ON PAGE 55
University
Food & Fuel for the 21st Century
9500 Gilman Dr.MC: 0368La Jolla, CA 92093Travis Johnson, Program CoordinatorPhone (858-534-6383)[email protected] 21.ucsd.edu
Iowa State University BioCentury
Research Farm
1041 Food Sciences Bldg.Ames, IA 50011-1061Lawrence Johnson, DirectorPhone (515-294-4365) | Fax (515-294-6261)[email protected]
Oklahoma State University
Biosystems and Agricultural Engineering214 Agricultural HallStillwater, OK 74078Hasan Atiyeh, Associate Professor, BioprocessingPhone (405-744-8397) | Fax (405-744-6059)[email protected]
UMD Natural Resources Research
Institute
5013 Miller Trunk HighwayDuluth, MN 55811June Kallestad, Public Relations ManagerPhone (218-720-4300)[email protected]
Research & Development Private
For more information on becoming a dealer call 800-932-3629 or visit INFO.WOODMASTER.COM/DEALER
www.woodmaster.com
…in commercial and residential boilers and furnaces.Heat commercial, institutional and agricultural facilities with our Commercial Series line of boilers and furnaces.
Setting TheStandard.
44 | 2015 Biomass Industry Directory
VISION FOREST MACHINE TECHNOLOGY CONFERENCE
AFOR THE
FUTURE
FMTC CONFERENCEAPRIL 21 TO 23, 2015HYATT REGENCY HOTEL, MONTREAL, CANADAfmtc.fpinnovations.ca
REGISTER NOW!And benefit from early bird rates.
FEATURING• Prominent international keynote speakers • Invited technical presentations • Technology forum presentations • Supplier kiosks• Ideation working groups • Networking opportunities
Robots, remote-controlled machines and autonomous vehicles. Imagine all these exciting technologies helping out in the forest for a safer and efficient working environment!
OUR SILVER SPONSORS:
OUR GOLD SPONSORS:
FOLLOW US #FMTC
AD INDEX
Agra Industries 21
American Science & Technology 55
Astec 56
Babcock Power 5
BBI Project Development 13
Beltran Technologies, Inc. 32
Continental Biomass Industries, Inc. 17
CPM Roskamp Champion 18
CPM Wolverine Proctor, LLC 26
Detroit Stoker Company 34
EBM Manufacturing 27
FPInnovations 44
Gray 23
GreCon Inc. 37
Hurst Boiler & Welding Co. Inc. 2
IEP Technologies 40-41
Indeck Power Equipment Co. 38
International Biomass Conference & Expo 12
Lehra Fuel Tech Pvt. Ltd. 20
National Advanced Biofuels Conference & Expo 54
Northeast Wood Products LLC 25
OÖ Energiesparverband
(Energy Agency of Upper Austria)15
Pan American Hydrogen, Inc. 24
ProcessBarron 28
Rawlings Waste Wood Recovery Systems 16
RCBC Global 33
SCHADE Lagertechnik GmbH 29
SWANA 14
TerraSource Global 30
Vecoplan LLC 19
Wolf Material Handling Systems 31
Woodmaster 43
2015 Biomass Industry Directory | 45
Company Index
4B Components Ltd.625 Erie AvenueMorton, IL 61550
4B SalesPhone (309-698-5611)[email protected]/usa
A AAA Cooper Transportation1751 Kinsey Rd.Dothan, AL 36303Buddy Turner, Director - Bulk ServicesPhone (251-589-2348)[email protected]
ADI Systems Inc.370 Wilsey RoadFredericton, AB E3B 6E9 CanadaScott Christian, Vice President, Business DevelopmentPhone (506-452-7107)[email protected]
Adtec Power gmbhIndustriestrasse 1Hard, 6971 AustriaBernhard Schulz, CEOPhone (00436606489040)[email protected]
Advanced Biofuels USA507 North Bentz StreetFrederick, MD 21701Joanne Ivancic, Executive DirectorPhone (301-644-1395)[email protected]
African Green Developments (Pty)Ltd.80 Milner Rd. MidrandJohannesburg, 1865 South AfricaLeon-Valeri Eremin, CEOPhone (082-264-7781)[email protected].
AGRA Industries1211 West Water StreetMerrill, WI 54452Tim Gruling, Manager of SalesPhone (715-536-9584) | Fax (715-536-9587)[email protected] OUR AD ON PAGE 21
AGRA Industries1211 West Water StreetMerrill, WI 54452Pat Hinner, PresidentPhone (800-842-8033)[email protected] OUR AD ON PAGE 21
Agri-Tech Producers, LLC (ATP)116 Wildewood Club CourtColumbia, SC 29223Joseph James, PresidentPhone (803-462-0153) | Fax (803-462-9676)[email protected]
Agricultural Fuels Corp5361 Young Pine Rd. Orlando, FL 32829James Meade, CTOPhone (407-234-1788) | Fax (407-380-5188)[email protected]
Agriculture Law & Consulting LLC16240 Burt StreetOmaha, NE 68118David Bracht, OwnerPhone (402-981-2900)[email protected]://www.linkedin.com/pub/david-bracht/1/11b/66
AgriPower, Inc.46 Deepdale DriveGreat Neck, NY 11021Barry Berman, CEOPhone (516-829-2000) | Fax (516-487-3163)[email protected]
Air Compliance Testing, Inc.10060 Brecksville RoadSuite 1120Cleveland, CA 44141Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Air Resource Specialists, Inc.1901 Sharp Point Drive, Suite EFort Collins, CO 80525Howard Gebhart, Manager, Environmental Compliance SectionPhone (970-484-7941)[email protected]
Air/Compliance Consultants, Inc. 1050 William Pitt WaySuite 1120Pittsburgh, CA 15238Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Airofl ex Equipment6001 49th St. SouthMuscatine, IA 52761Andy Christy, SalesPhone (563-264-8066) | Fax (651-631-2539)sales@airofl exequipment.comwww.airofl exequipment.com
AirPro Fan & Blower Co.PO Box 543Rhinelander, WI 54501Keith White, Sales EngineerPhone (715-365-3267)[email protected]
ALDATA Software203, 211 Pembina Ave.Hinton, AB T7V 2B3 CanadaMike Meagher, President and CEOPhone (780-865-3249) | Fax (780-665-4242)[email protected]
ALSTOM Power, Inc. Environmental Control Solutions1409 Center Point Blvd.Knoxville, TN 37932Mark Walters, Business Sales ManagerPhone (770-876-1163)[email protected]
Amatrol Inc.2400 Centennial Blvd.Jeffersonville, IN 47130Luke Gillenwater, InternPhone (800-264-8285) | Fax (812-283-1584)[email protected]
American Property Experts606 Sunnyvale DriveWilmington, NC 28412Bill Waggaman, Business DevelopmentPhone (910-793-1460) | Fax (910-793-6227)[email protected]
American Science and Technology1367 W. Chicago Ave.Chicago, IL 60642Ali Manesh, PresidentPhone (312-433-3800) | Fax (312-433-3807)[email protected] OUR AD ON PAGE 55
AMSEnergy Corp.1111 Bear Creek PikeColumbia, TN 38401Michael Sams, President & CEOPhone (615-852-8412)[email protected]
ANDRITZ1115 Northmeadow PkwyRoswell, GA 30076Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)[email protected]
ANDRITZ Feed and Biofuel336 West PennMuncy, PA 17756Joanne Turnell, Sales & Marketing Coord.Phone (289-239-9456)[email protected]/ft
Andy J. Egan Co.2011 Waldorf NWSuite 200Grand Rapids, MI 49544Rick Atkins, FabricationPhone (616-791-9952)[email protected]
Anguil Environmental Systems, Inc.8855 North 55th StreetMilwaukee, WI 53223Kevin Summ, Marketing ManagerPhone (414-365-6400) | Fax (414-365-6410)[email protected]
Anyang General International GroupRenmin Road, Anyang, ChinaMNancy Yang, Manager AssistantPhone (863725965148)[email protected]
Arc5 Environmental Consulting LLC20 Rockwood LnGroton, MA 01450David Minott, PresidentPhone (978-877-7719)[email protected]
Arizona State Forestry Division3650 Lake Mary RdFlagstaff, AZ 86005Patrick Rappold, Wood Utilization & Marketing SpecialistPhone (928-774-1425)[email protected]
Asahi/America655 Andover StLawrence, MA 01843Jeff Baker, Marketing ManagerPhone (781-321-5409)[email protected]
ASI-Industrial1300 Minnesota Ave.Billings, MT 59101Matthew Hamlin, Vice President SalesPhone (406-245-6231) | Fax (406-245-6236)[email protected]
Associated Laboratories806 N. Batavia St.Suite 1120Orange, CA 92868Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Astec, Inc.4101 Jerome AvenueChattanooga, TN 37407Malcolm Swanson, PresidentPhone (423-867-4210) | Fax (423-867-4636)[email protected] OUR AD ON PAGE 56
ATI Systems30 Jeffries St.East Boston, MA 02128Troy Fergus, Business DeveloperPhone (617-567-4969)[email protected]
Avogadro Environmental Corporation1350 Sullivan TrailSuite AEaston, CA 18040Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Ayalytical Instruments2701 W. Fulton St. #5SChicago, IL 60612Juan Ayala, Managing DirectorPhone (312-622-7520)[email protected]
46 | 2015 Biomass Industry Directory
Company Index
BB.I.D. Canada Ltd.171 Hemlock StreetLower Woodstock, NB E7M 4E6 CanadaDerek Lawrence, Sales & Estimating ManagerPhone ((506-328-4381 ext 510)[email protected]
Babcock Power Environmental5 Neponset StreetWorcester, MA 01615Jennifer Pasquariello, Director Marketing & Communications Phone (864-949-2917)[email protected]/products/environmental/babcock-power-environmentalSEE OUR AD ON PAGE 5
Babcock Power Services5 Neponset StWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketng & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/babcock-power-services-incSEE OUR AD ON PAGE 5
Baywood Technologies Inc.5210 Belfort Road, Suite 210Jacksonville, FL 32256Shannon Fitzgerald, Business DevelopmentPhone (904-733-7336) | Fax (904-731-5695)shannon.fi [email protected]
BBI Project Development10585 W. Beloit Pl.Lakewood, CO 80227Mark Yancey, Vice President of Project DevelopmentPhone (303-906-6234) | Fax (701-746-5367)[email protected] OUR AD ON PAGE 13
Beijer Electronics1865 West 2100 SouthSalt Lake City, UT 84119Jeff Hayes, Product ManagerPhone (801-466-8770)[email protected]
Beltran Technologies, Inc.1133 East 35 StreetBrooklyn, NY 11210Gary Siegel, Marketing DirectorPhone (718-338-3311) | Fax (718-253-9028)[email protected] OUR AD ON PAGE 32
Biodiesel Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]
Bighorn Environmental Air Quality, LLC1324 N Liberty Lake Road #266 Liberty Lake, WA 99019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Bioenergy Insight124 Middleton RoadMordenSurrey SM4 6RW, Great BritainPeter Patterson, Managing DirectorPhone (442086487082)[email protected]
Biofuels Technology LLC1201 Orange StreetSuite 600Wilmington, DE 19801Andrew Laitt, CEOPhone (302-966-9235)[email protected]
BIOGAS Equity 2, Inc.130 Eleanor Dr.Woodside, CA 94062Mike Muller, COOPhone (650-283-9555)[email protected]
Biomass Briquette Systems, LLCP.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-893-2444) | Fax (530-893-2444)[email protected]
Biomass Energy Lab1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Biomass Heating Solutions201 East 12th StreetAlturas, CA 96101Terry Olson, OwnerPhone (530-640-1072) | Fax (530-233-3450)[email protected]
Biomass Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]
Biomass Power Association100 Middle StreetPortland, ME 04104Bob Cleaves, PresidentPhone (207-228-7376) | Fax (207-774-1127)[email protected]
Biomass Systems SupplyP.O. Box 1835Chico, CA 95927Dave Schmucker, PresidentPhone (877-474-5521) | Fax (530-893-2444)[email protected]
Bionomic Industries777 Corporate DriveMahwah, NJ 07430Linda Babcock, Marketing CoordinatorPhone (201-529-1094) | Fax (201-529-0252)[email protected]
Bliss Industries, LLC1415 W. Summit AveP.O. Box 910 (74602)Ponca City, OK 74601Chad Cook, V.P. Marketing & SalesPhone (580-765-7787) | Fax (580-762-0111)[email protected]
Boiler Tube Company of America506 Charlotte HighwayLyman, SC 29365Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/boiler-tube-co-of-americaSEE OUR AD ON PAGE 5
Brunette Machinery Co.8717 132nd StreetSurrey, BC V3W 4P1 CanadaKirk Forbes, PresidentPhone (604-522-3977)[email protected]
Burns Forest Products LLC17691 Hwy 4Bienville, LA 71008John Russo, COOPhone (318-259-4997) | Fax (318-259-6338)[email protected]
CC&M Baling Systems, Inc.P.O. Box 16309Winston Salem, NC 27115John Gibbs, President & COOPhone (336-723-1838) | Fax (336-761-8695)[email protected]
Celignis LimitedT1-014 Tierney Building, University of LimerickLimerick, L111 IrelandDaniel Hayes, DrPhone (353894555582)[email protected]
Cellulose Pilot and Processing Lab6445 Packer Dr.Wausau, WI 54401Eric Singsaas, DirectorPhone (715-340-2591)[email protected]
Centre for Process InnovationWilton Centre, WiltonRedcar, TS10 4RF Great BritainLiz Grylls, Phone (441642455340)[email protected]
Christianson & Associates, PLLP302 SW 5th StWillmar, MN 56201Sherry Jean Olson, ManagerPhone (320-235-5937) | Fax (320-235-5962)[email protected]
Christianson & Associates, PLLP302 SW 5th St Willmar, MN 56201Fred Gould, Business Development ManagerPhone (320-235-5937) | Fax (320-235-5962)[email protected]
Christianson & Associates, PLLP302 SW 5th StWillmar, MN 56201Bradley Pederson, PartnerPhone (320-235-5937) | Fax (320-235-5962)[email protected]
CLARCOR Industrial Air11501 Outlook Street, Suite 100Overland Park, KS 66210Tim Stark, Director Aftermarket SalesPhone (816-313-4955)[email protected]
Class One Technical Services, Inc.3500 Camanche Rd NESuite GAlbuquerque, NM 87107Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Clean Methane Systems LLC19125 SW 125thTualatin, OR 97062Timothy Robinson, PresidentPhone (425-420-1979) | Fax (425-491-7740)[email protected]
Cogent Industrial TechnologiesSuite 180 - 13091 Vanier PlaceRichmond, BC V6V 2J1 CanadaBijan Shams, PresidentPhone (604-207-8880)[email protected]
Commodity Talent LLC349 Fifth Ave., 7th Flr.New York, NY 10016George Stein, Managing DirectorPhone (646-205-3557)[email protected]
Continental Biomass Industries, Inc.22 Whittier St.Newton, NH 03858Art Murphy, Marketing ManagerPhone (603-382-0556)[email protected] OUR AD ON PAGE 17
2015 Biomass Industry Directory | 47
Company Index
Conveyor Components Company130 Seltzer RoadPO Box 167Croswell, MI 48422Rich Washkevich, Sales ManagerPhone (810-679-4211) | Fax (810-679-4510)[email protected]
Cooper/Consolidated1127 Highway 190, East Service RoadCovington, LA 70433Brent Mahana, Sales DirectorPhone (985-871-4403)[email protected]
Cornerstone Systems LtdWhitebridge WayStone, ST15 8LQ Great BritainGareth Hughes, DirectorPhone (01785818020) | Fax (01785811699)[email protected]
COSA Xentaur Corp.84G Horseblock RdUnit GYaphank, NY 11980Colin Mueller, Marketing DirectorPhone (631-345-3434)[email protected]
Cousineau Forest Products1310 Old Concord RdHenniker, NH 03242Jon Baker, Operations & Wood Procurement ManagerPhone (603-428-7155) | Fax (603-428-7839)[email protected]
CPM Roskamp Champion2975 Airline CircleWaterloo, IA 50703Tim Gilbert, North American ManagerPhone (800-366-2563)[email protected] OUR AD ON PAGE 18
CPM Wolverine Proctor, LLC251 Gilbraltar RoadHorsham, PA 19044Chris Law, Industry ManagerPhone (215-443-5200) | Fax (215-443-5206)[email protected] OUR AD ON PAGE 26
CTI3845 Cypress Creek Parkway, Ste. 420Houston, TX 77068Jalene Fritz, Membership CommitteePhone (970-593-8637) | Fax (970-472-1304)[email protected]
Curran Renewable Energy, LLC20 Commerce DriveMassena, NY 13662Patrick Curran, President / OwnerPhone (315-769-2000)[email protected]
CV Technology15852 Mercantile CourtJupiter, FL 33478Nicholas Licht, Sales Engineer Phone (561-694-9588) | Fax (561-694-9585)[email protected]
DDavenport Dryer301 2nd StRock Island, IL 61204Rob Feller, Sales ManagerPhone (309-283-1134)[email protected]
Dedert Corporation17740 Hoffman WayHomewood, IL 60430Colin Crankshaw, V.P. Business DevelopmentPhone (708-747-7000)[email protected]
Dedert Corporation17740 Hoffman WayHomewood, IL 60430Dale Stenning, V.P. Manager Evaporator DivisionPhone (708-747-7000)[email protected]
Delta Air Quality Services, Inc.1845 North Case Street Orange, CA 92865Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Detroit Stoker Company1510 East First StreetMonroe, MI 48161Tim Loviska, Director - Contract SalesPhone (734-241-9500) | Fax (734-241-7126)[email protected] OUR AD ON PAGE 34
DI PIÙ - Sunomi LLC608 Old Joppa RoadJoppa, MD 21085Giordano Checchi, PresidentPhone (404-759-3574)[email protected]
Direct Contact LLC2555 34th Street NECanton, OH 44708Curt Rothman, CEOPhone (330-437-0444)[email protected]
DYNATEK Loading Systems200 North Harrison StNorth Prairie, WI 53153Gary Kuehneman, Director of Marketing & SalesPhone (262-392-2162) | Fax (262-392-2984)[email protected]
E E3CoalRissener Landstrasse 255Hamburg, 22559 GermanyChristopher StonePhone (0012022156201)[email protected]
Eastmount Environmental Services, LLC2 New Pasture RoadUnit #5Newburyport, CA 01950Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]://www.montrose-env.com/
EBM Manufacturing1014 Sherwood RdNorfolk, NE 68701Tiffany Palmer, Director of Sales & MarketingPhone (877-370-4948) | Fax (402-371-9117)[email protected] OUR AD ON PAGE 27
EcoHeat Solutions LLC153 Washington StBox B 9East Walpole, MA 02032George Whiting, PresidentPhone (877-317-0700)[email protected]
Ecospray Technologies S.r.l.5 Thawmont DriveSewickley, PA 15143Jo Ann Pacinelli, North AmericaPhone (412-427-0133) | Fax (412-741-8386)[email protected]
Ecostrat Inc. 60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaBrett Hogarth, Head of Business DevelopmentPhone (416.968.8884 ext. 239) Fax (416.968.8886)[email protected]
Ecostrat Inc. 60 St. Clair Ave. EastSuite 404Toronto, ON M4T 1N5 CanadaJordan Solomon, PresidentPhone (416.968.8884 ext. 222)Fax (416.968.8886)[email protected]
Eisenmann150 E Dartmoor DriveCrystal Lake, IL 60014John McDowell, Sales EngineerPhone (815-477-5335)[email protected]
Elementar Americas520 Fellowship Rd Ste D-408Mt Laurel, NJ 08054Jean Bernius, Marketing ManagerPhone (856-787-0022)[email protected]
Elliott Group901 North Fourth StreetJeannette, PA 15644Phil Rutkowski, Sales ManagerPhone (303-503-1134)[email protected]
Emisshield Inc.2000 Kraft Drive Suite 2600Blacksburg, VA 24060Tim Wilson, Project ManagerPhone (540-961-0999)[email protected]
Emission Testing Services, Inc.10461 Mammoth AveBaton Rouge, LA 70814Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Enerion Biomass SolutionsAv. 27 de Febrero n. 233, Torre Corp. Corominas Pepín, 4th Floor Ensanche NacoSanto Domingo, 10150 Dominican RepublicAlessandro Pozzi, Phone (00393470449209)[email protected]
EquipNet, Inc.5 Dan RoadCanton, MA 02021Emily ColemanPhone (781-821-3482) | Fax (617-671-1269)[email protected]
ESP1075 Progress CircleLawrenceville, GA 30043Jim Batten, V.P. of SalesPhone (770-682-8259) | Fax (770-277-5524)[email protected]
Ethanol Producer Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]
Evergreen Engineering, Inc.1740 Willow Creek CircleEugene, OR 97402Aaron Edewards, Business Development DirectorPhone (541-484-4771) | Fax (541-484-6759)[email protected]
Everlasting Valve Company108 Somogyi CourtSouth Plainfi eld, NJ 07080David Jenkins, General Sales ManagerPhone (908-769-0700) | Fax (908-769-8697)[email protected]
Exponent4580 Weaver ParkwaySuite 100Warrenville, IL 60555Mark Fecke, Senior Managing EngineerPhone (630-658-7512)[email protected]
48 | 2015 Biomass Industry Directory
Company Index
F Fagen, Inc.501 W. Hwy 212Granite Falls, MN 56241Richard Cantor, Vice President, Business DevelopmentPhone (864-430-5338)[email protected]
FieldEddy Division of Hub International New England LLC PO Box 70996 Shaker RdEast Longmeadow, MA 01028Teresa Petit de Mange, Vice PresidentPhone (413-233-2108) | Fax (413-733-3191)[email protected] eldeddy.com
FLAMEX, Inc.4365 Federal DriveGreensboro, NC 27410Allen Wagoner, PresidentPhone (336-299-2933) | Fax (336-299-2944)fl [email protected]
Food & Fuel for the 21st Century9500 Gilman Dr.MC: 0368La Jolla, CA 92093Travis Johnson, Program CoordinatorPhone (858-534-6383)[email protected]
Foster BrothersPO Box 249Auxvasse, MO 65231Steve Foster, VPPhone (573-386-2271) | Fax (573-386-2676)[email protected]
FPInnovations319, rue FranquetPointe-Claire, QC G1P 4R4 CanadaPhone (418-781-6722)[email protected] OUR AD ON PAGE 44
G GARN Wood Heating3425 33rd Ave. NEMinneapolis, MN 55418Martin Lunde, PresidentPhone (612-326-1104)[email protected]
Gateway Commercial Finance, LLC340 SE 1st StreetDelray Beach, FL 33483Marc Marin, Managing DirectorPhone (855-424-2955) | Fax (561-734-2708)[email protected]://gatewaycfs.com
General Biomass Company2906 Central StreetSuite 134Evanston, IL 60201Daniel Gibbs, CEOPhone (847-624-3590)[email protected]
Geomembrane Technologies Inc. (GTI)370 Wilsey RoadFredericton, AB E3B 6E9 CanadaDarin Evans, Manager, Product DevelopmentPhone (506-452-7304) | Fax (506-452-6625)[email protected]
Global Clean Energy Holdings2790 Skypark Drive Suite 105Torrance, CA 90505Richard Palmer, President and CEOPhone (310-641-4234)[email protected]
Gorman-Rupp Company600 S. Airport Rd.Mansfi eld, OH 44903Scott Derkez, National Sales ManagerPhone (419-755-1011) | Fax (419-755-1251)[email protected]
Gray10 Quality StreetLexington, KY 40507Alex De Martini, Manager, Business DevelopmentPhone (859-281-5000) | Fax (859-252-5300)[email protected] OUR AD ON PAGE 23
GreCon Moisture Meters15875 SW 74th AveTigard, OR 97224Marshall LLoyd, SalesPhone (503-641-7731) | Fax (503-641-7508)[email protected]/measurement/infrared-moisture-meterSEE OUR AD ON PAGE 37
GreCon Spark Detection15875 SW 74th Ave.Tigard, OR 97224Terry Franklin, Technical Sales DirectorPhone (503-641-7731) | Fax (503-641-7508)[email protected]/spark-detectionSEE OUR AD ON PAGE 37
Green Science Corporationwww.greensciencecorp.com
Gulf Stream Fuels, LLCP.O. Box 147Markham, TX 77456Truman Neuman, VP of MarketingPhone (512-745-6940)[email protected]
HH.T. PROF Clean Tech575 N. Patterson Ave. Suite 444Winston-Salem, NC 27101Todd Porter, PresidentPhone (770-420-7440) | Fax (770-420-7440)[email protected]/clean-tech.htm
Hallco Industries Inc.PO Box 505Tillamook, OR 97141Ricardo Aguinaga, VP of Sales and MarketingPhone (503-842-8746)[email protected]
Hartpence FarmsPO Box 155Moscow, PA 18444Larry Hartpence, OwnerPhone (570-842-6464)[email protected]
Hawkeye Process Technology Systems3000 Old Alabama RdSte 119-198Atlanta, GA 30022Bill Schafer, Director Business DevelopmentPhone (614-747-1737)[email protected]
Heat Transfer International4720 44th Street SEKentwood, MI 49512Project Development, Sales ManagerPhone (616-551-5420)[email protected]
HEMCO Corporation711 South Powell RoadIndependence, MO 64056Jerry Schwarz, Marketing / AdvertisingPhone (800-779-4362) | Fax (816-796-3333)[email protected]
HerBasant IndustriesAt Sanjivani BuildingFarm Road, Modi Para,Sambalpur, 768002 IndiaL K Agrawal, General ManagerPhone (09438631539)[email protected]://www.herbsantextracts.com/
Heyl & Patterson Inc.400 Lydia StreetCarnegie, PA 15106Sales Dept., Phone (412-788-9810) | Fax (412-788-9822)[email protected]
Hoffmann, Inc.6001 49th St. SouthMuscatine, IA 52761Paul Reed, Silo & Chimney Sales ManagerPhone (563-263-4733) | Fax (563-263-0919)[email protected]
Hurst Boiler & Welding Co., Inc.100 Boilermaker LaneCoolidge, GA 31738Jeff Hurst, Director, Sales & MarketingPhone (229-346-3545)[email protected] OUR AD ON PAGE 2
Hydro Dynamics, Inc.8 Redmond Court NWRome, GA 30165Douglas Mancosky, VP - Research & DevelopmentPhone (706-234-4111) | Fax (706-234-0702)[email protected]
Hydro-Thermal Corp.400 Pilot CourtWaukesha, WI 53188Sales Department, SalesPhone (262-548-8900) | Fax (262-548-8908)[email protected]
Hyer Industries-Thayer Scale91 Schoosett St. PO Box 669Pembroke, MA 02359Peter Sirrico, Regional Sales ManagerPhone (781-826-8101) | Fax (781-826-0072)[email protected]
IICS, Inc. (Industrial Contract Services, Inc.)PO Box 13158Grand Forks, ND 58208-3158David Dangerfi eld, Project DevelopmentPhone (701-775-8480) | Fax (701-775-8479)ddangerfi [email protected]
IEP Technologies417-1 South StreetMarlborough, MA 01752John Shea, Vice President - Marketing & Business DevelopmentPhone (855-793-8407) | Fax (508-485-3115)[email protected] OUR AD ON PAGE 40
Imerys100 Mansell Court E. Suite 300Roswell, GA 30076Emmy Bracoud, Marketing AnalystPhone (678-579-2095)[email protected]
Indeck Power1111 Willis AvenueWheeling, IL 60090Lisa Lindell, SalesPhone (847-541-8300) | Fax (847-541-9984)[email protected] OUR AD ON PAGE 38
Ingram Barge Company4400 Harding PikeNashville, TN 37205Blake Roberson, Senior Business Development AnalystPhone (615-298-7589)[email protected]
Iowa Northern Railway305 2nd St SESuite 400Cedar Rapids, IA 52401William Rhodes, Director Reload MarketingPhone (319-415-8150)[email protected]
Iowa State University BioCentury Research Farm1041 Food Sciences Bldg.Ames, IA 50011-1061Lawrence Johnson, DirectorPhone (515-294-4365) | Fax (515-294-6261)[email protected]
International Biomass Conference & ExpoPhone (866-746-8385)[email protected] OUR AD ON PAGE 12
2015 Biomass Industry Directory | 49
Company Index
International Fuel Ethanol Workshop & ExpoPhone (866-746-8385)[email protected]
JJeffrey Rader, a brand of TerraSource Global215 Parkway East, Suite ADuncan, SC 29334Ted Gentile, Director of Sales, Engineered SystemsPhone (864-476-6748) | Fax (864-476-7510)[email protected] OUR AD ON PAGE 30
Jenkins & BrandtPO Box 80609Atlanta, GA 30066Rick Brandt, PartnerPhone (770-650-7295) | Fax (678-594-0825)[email protected]
KKenco Engineering, Inc.2155 PFE RoadRoseville, CA 95747Ron Brajkovich, Regional ManagerPhone (800-363-9859) | Fax (916-783-3494)[email protected]
Kentucky Division of Biofuels500 Mero Street, 6th FloorFrankfort, KY 40601Tim Hughes, DirectorPhone (502-564-7192) | Fax (502-564-7406)[email protected]/biofuels/Pages/default.aspx
Kilpatrick Townsend & Stockton LLP607 14th Street, NWSuite 900Washington, DC 20005Mark Riedy, CounselPhone (202-508-5823) | Fax (202-318-4087)[email protected]
Koger Air CorporationP. O. Box 20982581 Greensboro RoadMartinsville, VA 24113Mike Bull, Sales EngineerPhone (276-638-8821) | Fax (800-554-4040)[email protected]
Komptech Americas10855 Dover Street, Suite 1000Westminster, CO 80021Brandon Lapsys, VP of Sales & OperationsPhone (303-669-5637)[email protected]
Konza Renewable Fuels2953 SW Wanamaker DrTopeka, KS 66614Josh Thompson, MemberPhone (785-286-7390)[email protected]/Contact.aspx
L Lehra Fuel Tech PVT LTDVPO Nanakpur Jagera-141117, Opp Dera Sacha SaudaNear Shanti Tara College, Distt. LudhianaPunjab, 141117 IndiaSarabjit Singh, DirectorPhone (919815200337)[email protected]
Levelese, Inc.326 Steele St.Denver, CO 80206Sallyanne Ofner, PresidentPhone (303-586-1425)[email protected]
Lewis & Raulerson, Inc.1759 State StreetWaycross, GA 31501Casey Hall, Executive AssistantPhone (912-283-5951) | Fax (912-283-8281)[email protected]
Life Cycle Associates, LLC884 Portola RoadSuite A11Portola Valley, CA 94028Stefan Unnasch, Managing DirectorPhone (650-461-9048)[email protected]
LMC International Ltd1841 Broadway, 611New York, NY 10023Andrea Kavaler, Executive Vice PresidentPhone (212-586-2427)[email protected]
Luminate, LLC1801 BroadwaySuite 1620Denver, CO 80202Michael Robinson, President & CEOPhone (303-860-7627) | Fax (303-860-7647)[email protected]
MMaas CompaniesPO Box 7127Rochester, MN 55903Tyler Maas, Director of Sales and MarketingPhone (507-285-1444) | Fax (507-285-0034)[email protected]
Martin EngineeringOne Martin PlaceNeponset, IL 61345Chelsea Blake, Marketing SpecialistPhone (309-852-2384)[email protected]
MEC Entec Services, LCC30 Monroe DriveP.O. Box 1059Pelham, AL 35124Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Miron Construction Co., Inc.1471 McMahon DriveNeenah, WI 54956Dan Goymerac, Vice President Industrial Business DevelopmentPhone (920-969-7004) | Fax (920-969-7393)[email protected]
MKL Capital LLCBox 963Bronxville, NY 10708Brian Morrison, Managing DirectorPhone (917-653-3017)[email protected]
Modern Industrial2012 Highway 160 W, Suite 9Fort Mill, SC 29708Jon Payne, PresidentPhone (888-517-2310)[email protected]
MOISTTECHP O Box 118Tallevast, FL 34270-0118John Fordham, ManagerPhone (941-351-7870)[email protected]
Montrose Air Quality Services, LCC4210 Resnik CourtSuite 200Bakersfi eld, CA 93313Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Montrose Environmental Group, Inc.2 Park Plaza Suite 1120Irvine, CA 92614Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935) | Fax (925-429-9042)[email protected]
Morbark, Inc. 8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896John Foote, Vice President, Sales and MarketingPhone (800-831-0042) | Fax (989-866-2280)[email protected]
Morbark, Inc. 8507 S. Winn Rd. P.O. Box 1000Winn, MI 48896Casey Gross, Sales Manager, Tree CarePhone (800-831-0042) | Fax (989-866-2280)[email protected]
NNAES Corporation1180 NW Maple StreetSuite 200Issaquah, WA 98027Jeanette Carroll, Marketing ManagerPhone (425-961-4700)[email protected]
National Advanced Biofuels Conference & ExpoPhone (866-746-8385)[email protected]
NDC Technologies5314 North Irwindale AvenueIrwindale, CA 91706Ray Shead, Marketing ManagerPhone (626-939-3856) | Fax (626-939-3870)[email protected]
NESTEC Inc.21 Unionville RoadP.O. Box 568 Douglassville, PA 19518Jim Nester, PresidentPhone (610-323-7670) | Fax (610-323-7672)[email protected]
Neutopia ecoSOLUTIONS Inc.2045 Lakeshore Boulevard WestSuite 411, Toronto, ON M8V 2Z6 CanadaRobert Laporte, President & CEOPhone (905-581-6333)[email protected]
New Holland Agriculture500 Diller AvenueNew Holland, PA 17557Jarrod Angstadt, Manager, Growth Initiatives, Biomass & SpecialtyPhone (281-687-9159) | Fax (281-763-2632)[email protected]/na
NH Wood Energy Council2 Airport RoadUnit 1Gilford, NH 03249Rick DeMark, CoordinatorPhone (603-527-2093)[email protected]
Northeast Wood Products, LLC13 Crow Hill RoadUncasville, CT 06382Mike Reid, SVP-Business DevelopmentPhone (855-324-9621)[email protected] OUR AD ON PAGE 25
Northwest Manufacturing, Inc./WoodMaster600 Polk Ave SWRed Lake Falls, MN 56750Todd Strem, Sales & Marketing ManagerPhone (800-932-3629) | Fax (218-253-4409)[email protected] OUR AD ON PAGE 43
Novatos RE Agro-Industrial24 Dollar St., CGPV, Felix Ave, Cainta, Rizal 1400 PhillippinesRoberto Alip, PresidentPhone (639192359694)[email protected]/novatos.re
NRG Farm Consulting, LLC3813 HabershamSchertz, TX 78154Bud Wylie, PresidentPhone (210-725-1756)[email protected]
50 | 2015 Biomass Industry Directory
Company Index
OOklahoma State UniversityBiosystems and Agricultural Engineering214 Agricultural HallStillwater, OK 74078Hasan Atiyeh, Associate Professor, BioprocessingPhone (405-744-8397) | Fax (405-744-6059)[email protected]
Olson Search International, Inc.PO Box 3127Redmond, WA 98073Jon Olson, PresidentPhone (800-985-5191) | Fax (406-756-5154)[email protected]
On The Green, LLC10116 Daniels Run WayFairfax, VA 22030Mary Valenta, CEOPhone (205-266-3393)[email protected]
OÖ Energiesparverband (Energy Agency of Upper Austria)Landstrasse 45Linz AustriaChristiane Egger, Deputy managerPhone (43732772014386) Fax (43732772014383) offi [email protected]://www.esv.or.at/english/
Optek-Danulat, Inc.N118W18748 Bunsen DrGermantown, WI 53022Joe Ferrelli, Product SpecialistPhone (888-901-4288)[email protected]
Orival, Inc.213 S. Van Brunt StreetEnglewood, NJ 47352Marcus Allhands, Vice President of Business DevelopmentPhone (201-568-3311) | Fax (201-568-1916)[email protected]
OSDV Engineering Inc.1 Rabbit RunWilmington, DE 19809Charlesl Clerecuzio, Principal / Chief EngineerPhone (856-266-2550)[email protected]
Outotec Energy Products3568 W Industrial LoopCoeur d’Alene, ID 83815Kent Pope, Director of Business DevelopmentPhone (208-765-1611) | Fax (208-765-0503)[email protected]
PpackIQ1 American WayAnderson, SC 29621Than Nguyen, ConsultantPhone (877-233-8668)[email protected]://packiq.com
PanAmerican Hydrogen, Inc.5806 E. Grimes St.Harlingen, TX 78550Barbara Martinez, VPPhone (956-365-3773) | Fax (956-365-3739)[email protected] OUR AD ON PAGE 24
Pellet Mill Magazine308 Second Ave. N., Suite 304Grand Forks, ND 58203Phone (866-746-8385) | Fax (701-746-5367)[email protected]/pellets
PHG Energy3048 Owen DriveAntioch, TN 37013Mike Webb, Director of Business DevelopmentPhone (615-471-9299)[email protected]
Pick Heaters, Inc.730 S. Indiana Ave.PO Box 516West Bend, WI 53095Sales Dept., Phone (262-338-1191) | Fax (262-338-8489)[email protected]
Pinnacle Air Pollution Control1177 Pittsburgh RoadSuite 203Valencia, PA 16059-3137Anthony Brajdic, Director of OperationsPhone (724-898-1220) | Fax (724-898-2229)[email protected]
PRM Energy Systems, Inc.504 Windamere TerraceHot Springs, AR 71913Ron Bailey, ChmPhone (501-276-2101) | Fax (501-767-7679)[email protected]
ProcessBarron2770 Welborn St.Pelham, AL 35124Cliff Moss, VP and Director of Materials Handling DivisionPhone (205-663-5330)[email protected] OUR AD ON PAGE 28
Processbio A/SPO Box 34 Romeo, MI 48065Jorgen Lyngso, American RepresentativePhone (586-255-7075)[email protected]
Protective Packaging Corp.1746 W. Crosby RoadCarrollton, TX 75006Anita Pinkerton, ConsultantPhone (800-644-4032)[email protected]
Puritan Magnetics, Inc.900 S. Glaspie StreetOxford, MI 48371Andrea Webster, Sales & MarketingPhone (248-628-3808) | Fax (248-628-3844)[email protected]
RRCBC Global Inc.401 North Main St. Suite 201Hendersoncille, NC 28792Doug King, VP MarketingPhone (828-696-2111)[email protected]
R. W. Heiden Associates LLC1026 New Holland AvenueP O Box 5001Lancaster, PA 17601Richard Heiden, Chief Science and Technology Offi cerPhone (717-299-6860) | Fax (717-299-6868)[email protected]
Rawlings Waste Wood Recovery SystemsPO Box 4485Missoula, MT 59806John Rawlings, PresidentPhone (406-728-6182) | Fax (406-728-7957)[email protected] OUR AD ON PAGE 16
REBL Refractories Evaluations Laboratory, ULC#109, 8484 162nd StreetSurrey, BC V4N 1B4 CanadaBryce Jardine, Regional ManagerPhone (778-578-7551) | Fax (778-578-7571)[email protected]
Recast Energy LLC8730 Stony Point ParkwaySuite 100Richmond, VA 23235Brandon Ogilvie, CFOPhone (804-212-3143)[email protected]
Redecam USA2125 Barrett Park Drive, Suite 112BKennesaw, GA 30144Rick Davies, Managing Director, V.P. N. AmericaPhone (678-909-2342) | Fax (678-909-2359)www.redecam.com
Refi ned BioProducts1718 Pine StreetStevens Point, WI 54481John Leschke, New Business DevelopmentPhone (715-869-7866)jleschke@refi nedbioproducts.comwww.refi nedbioproducts.com
Renewable Strategies, Inc.PO Box 185Shoreham, VT 05770Douglas Patterson, PresidentPhone (802-989-0476)[email protected]
Riley Power Inc.5 Neponset StreetWorcester, MA 01615-0040Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/riley-power-incSEE OUR AD ON PAGE 16
RISI4 Alfred CircleBedford, MA 01730Seth Walker, Bioenergy EconomistPhone (781-734-8992)[email protected]
Roundtable on Sustainable Biomaterials (RSB)60 North Market Street, Suite C200Asheville, NC 28801Matt Rudolf, Regional Director, AmericasPhone (919-810-2295)[email protected]
RTP Environmental Associates, Inc.400 Post AveSuite 405Westbury, NY 11590Jessica Karras-Bailey, PrincipalPhone (516-333-4526) | Fax (516-333-4571)[email protected]
Rubb Buildings Inc1 Rubb LaneSanford, ME 04073Chuck Auger, Marketing ManagerPhone (207-324-2877)[email protected]
RWL Water7135 Madison Avenue WestGolden Valley, MN 55427Nii Mensah, VP of Sales & MarketingPhone (763-746-9277) | Fax (763-746-8408)[email protected]
SSABIA Inc10911 Technology PlSan Diego, CA 92127Paul Iverson, Product ManagerPhone (858-217-2232) | Fax (858-217-2203)[email protected]
SAMSON Materials Handling Ltd.Gemini House, Cambridgeshire Business Park1 Bartholomew’s WalkEly, Cambridgeshire, CB74EA Great BritainAndy Blythe, Managing DirectorPhone (441353665001) Fax (441353666734)[email protected]
SCEC 1582-1 N. Batavia StreetOrange, CA 92867Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
SCHADE Lagertechnik GmbHBruchstrasse 1Gelsenkirchen, 45883 GermanyKarl-Heinz Fiegenbaum, Managing DirectorPhone (4920950316122) Fax (4920950316188)fi [email protected] OUR AD ON PAGE 29
2015 Biomass Industry Directory | 51
Company Index
Schnader Harrison Segal & Lewis LLPSuite 2700 Fifth Avenue Pl.120 Fifth AvenuePittssburgh , PA 15222Megan Harmon, PartnerPhone (412-577-5200)[email protected]
Scientifi c Dust Collectors4101 W. 126th StreetAlsip, IL 60007Andrew Rutherford, Sales ManagerPhone (708-597-7090) | Fax (708-597-0313)arutherford@scientifi cdust.comscientifi cdustcollectors.com
SciTech GroupTekniikantie 12Espoo, 02150 FinlandJarno Hartikainen, ChemistPhone (358503411998)[email protected] www.scitech.fi
SeaHold LLC23551 Rose Quartz DrivePerris, CA 92570Thomas Hintz, Managing PartnerPhone (951-943-9697)[email protected]
Seneca Companies7241 Gaines Street CourtDavenport, IA 52806Chris Biellier, Waste Solutions General ManagerPhone (563-343-4679)[email protected]
SHW Storage & Handling Solutions GmbHwww.shw-shs.com
Siemens Industry Inc.7101 Hollister RoadHouston, TX 77040Customer Service, Phone (713-939-7400)[email protected]/processanalytics
Sierra Instruments, Inc. 5 Harris CourtBuilding LMonterey, CA 93940Scott Rouse, Product Line DirectorPhone (831-373-0200) | Fax (831-373-4402)[email protected]
Smart E2 Solutions14 Edgewood RoadRumson, NJ 07760George St.Onge, Director of Business DevelopmentPhone (732-801-6828) | Fax (732-758-1169)[email protected]
SoftPLC Corporation25603 Red BrangusSpicewood, TX 78669Cindy Hollenbeck, VPPhone (512-264-8390)[email protected]
Solar Turbines Incorporated9330 Sky Park CourtMail Zone SP4-BSan Diego, CA 92123Chris Lyons, Market ManagerPhone (858-694-6586)[email protected]
South Florida Environmental Services, LLC 2257 Vista ParkwayUnit 25West Palm Beach, FL 33411Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
Spencer Turbine Company600 Day Hill RoadWindsor, CT 06095Chet Adamczyk, Sr Sales Engr - Biogas & WWT Phone (860-688-8361) | Fax (860-688-0098)[email protected]
Sterne, Kessler, Goldstein & Fox P.L.L.C.1100 New York Ave, NWWashington, DC 20005Peter Jackman, DirectorPhone (202-772-8585)[email protected]
STRATA503 Olympic BlvdSanta Monica, CA 90401Josh Seldner, OwnerPhone (310-739-8243)[email protected]
Sustainable Oils2790 Skypark DriveSuite 105Torrance, CA 90505Scott Johnson, PresidentPhone (919-428-1102)[email protected]
Symbiontwww.symbiontonline.com
SysTech Design, Inc.300 North Pottstown PikeExton, PA 19341John Conley , OwnerPhone (800-456-9460)[email protected]
TTAPPI15 Technology Parkway S.Peachtree Corners, GA 30092Raine Hyde, MarketingPhone (770-446-1400)[email protected]
Team Biogas®23551 Rose Quartz DrivePerris, CA 92570Fabian Villanueva, Sales ManagerPhone (951-943-9697)[email protected]
TEi Construction Services170 Tucapau RdDuncan, SC 29334Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/tei-construction-services-incSEE OUR AD ON PAGE 5
The Air Compliance Group, LLC 5075 Hollins RoadRoanoke, VA 24019Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
The Avogadro Group, LLC2825 Verne Roberts CircleAntioch, CA 94509Erick Mirabella, Vice President, Business DevelopmentPhone (925-680-0935)[email protected]
The Solid Waste Association of North America (SWANA)1100 Wayne Avenue, Suite 650Silver Spring, MD 20910Meri Beth Wojtaszek, Deputy Executive DirectorPhone (800-467-9262) | Fax (301-589-7068)[email protected] OUR AD ON PAGE 14
Thermal Engineering Int’l (USA)10375 Slusher DriveSanta Fe Springs, CA 90670Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-exchangers/thermal-engineeringSEE OUR AD ON PAGE 5
Thompson Dehydrating Company2953 SW Wanamaker DrTopeka, KS 66614Ted Thompson, CEOPhone (785-272-7722)[email protected]
Timber Products Inspection1641 Sigman RoadConyers, GA 30012Tammy Hippchen, Business Development SpecialistPhone (218-461-2579)[email protected]
Timberland Associates, LLC2150 CR 750Dumas, MS 38625Tom Busch, OwnerPhone (662-837-0381)[email protected]
Top Wood JobsPO Box 4La Center, WA 98629George Meek, RecruiterPhone (360-263-3371)[email protected]
Tower Performance, Inc.4031 BroadwayHouston, TX 77087Jalene Fritz, Parts ManagerPhone (970-593-8637) | Fax (970-472-1304)[email protected]
TrinityRail2525 Stemmons FreewayDallas, TX 75207Gregg Yates, Director, MarketingPhone (214-631-4420) | Fax (214-589-8623)[email protected]
Triveni Turbine Ltd.12A, Peenya Industrial AreaBangaloreBangalore, 560058 IndiaDeepak Nayak, Asst. Gen. Manager-International Sales & MarketingPhone (918022164000) Fax (918028395945)[email protected]
Twin Ports Testing1301 North 3rd StreetSuperior, WI 54880Stephen Sundeen, Laboratory ManagerPhone (800-373-2562) | Fax (715-392-7163)[email protected]
UUMD Natural Resources Research Institute5013 Miller Trunk HighwayDuluth, MN 55811June Kallestad, Public Relations ManagerPhone (218-720-4300)[email protected]
Urban Renewable H23010 LBJ Freeway, Suite 1200Dallas, TX 75234Ray Gwin, CEOPhone (214-796-4033)[email protected]
Valmet, Inc.3430 Toringdon WaySuite 201Charlotte, NC 28277Kerry Flick, Director, TechnologyPhone (704-541-1453)kerry.fl [email protected]
Valuation and Assets Services2108 Carroll Creek ViewFrederick, MD 21702K. Boison, PrincipalPhone (301-646-4119)[email protected]
Vecoplan Midwest4005 Earnings WayNew Albany, IN 47150Bill Miller, Chief Operating Offi cerPhone (812-923-4992)[email protected] OUR AD ON PAGE 19
52 | 2015 Biomass Industry Directory
Company Index
Vecoplan, LLCPO Box 7224High Point, NC 27264Yuri Chocholko, N. Amer. Sales Man.-Wood, Biomass, and BiofuelsPhone (336-861-6070) | Fax (336-861-4329)[email protected] OUR AD ON PAGE 19
Venture Engineering & Construction, Inc. 1501 Reedsdale StreetSuite 505Pittsburgh, PA 15233Bill Slatosky, Sr. Business Development ManagerPhone (412-231-5890) | Fax (412-231-5891)[email protected]
Verdanté BioEnergy Services626 Harper Ave NWPO Box 2917Lenoir, NC 28645G. David Waechter, OwnerPhone (828-394-1246)[email protected]
Victor Pellet MillWenhua Road Zhengzhou, ChinaWales Z, SalesmanPhone (8637156747890)[email protected]
Viessmann Manufacturing Company (U.S.), Inc.45 Access RoadWarwick, RI 02886Lee Gustafson, MarketingPhone (401-732-0667) | Fax (401-732-0590)[email protected]
Vogt Power International13551 Triton Park BoulevardSuite 2000Louisville, KY 40223Jennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/heat-recovery-systems/vogt-power-international
WWarren & Baerg Manufacturing, Inc.39950 Road 108Dinuba, CA 93618Randy Baerg, PresidentPhone (559-591-6790) | Fax (559-591-5728)[email protected]
WastAwayP.O. Box 7116McMinnville, TN 37111 USTerry Moore, Chief Business Development Offi cerPhone (931-815-8520)[email protected]
Waste Environmental Solutions, LLC.437 Linden AveElizabeth, NJ 07202Nestor Vela, COOPhone (732-489-0015) | Fax (732-833-8874)[email protected]
Waterleau1300 Adams Ave, Apt. 32PCosta Mesa, CA 92626Laetitia d’Ursel, Business Development ManagerPhone (714-727-7607)[email protected]
Webiomass Inc.16 Washington St (mail)56 Howe St (plant)Rutland, VT 05701George Robbins, PresidentPhone (802-772-7563) | Fax (802-772-7564)[email protected]
WebSite Names OnlyBox 304Nanoose Bay, BC V9P 9J9 CanadaGary R CampbellPhone (250-468-7047)[email protected]
Welding Technologies2330 Centennial DriveGainesville, GA 30504 USJennifer Pasquariello, Director Marketing & CommunicationsPhone (864-949-2917)[email protected]/products/boilers-boiler-services/welding-technologiesSEE OUR AD ON PAGE 5
West Oregon Wood Products, Inc.PO Box 249Columbia City, OR 97018Chris Sharron, CEOPhone (503-397-6707) | Fax (503-397-6887)[email protected]
Western Renewable Technologies310 N Geneva RoadLindon, UT 84042Mel Radmall, CEOPhone (801-785-9330)[email protected]
Williams Patent Crusher & Pulverizer Company, Inc.2701 North BroadwaySt. Louis , MO 63102Steve Baumgartner, Sales ManagerPhone (314-621-3348) | Fax (314-436-2639)[email protected]
Wolf Material Handling Systems12680 Industrial BoulevardElk River, MN 55330Lynn Smith, Business DevelopmentPhone (763-576-9040) | Fax (763-576-9070)[email protected] OUR AD ON PAGE 27
Wood Waste to Rural Heat110A Slater Road NWCranbrook, BC V1C 5C8 CanadaDavid Dubois, Project CoordinatorPhone (250-489-4356) | Fax (250-489-1886)[email protected]
YYongHuawww.briquettemachinecn.com
YongHuaZhengzhouroad 559Zhengzhou, 450042 ChinaJack Zhao, 先生Phone (037167817233)[email protected]
Notes
directory.biomassmagazine.com
BECOME A SPONSOR Sponsorships Drive Recognition
& Return on Investment
October 26-28, 2015Hilton Omaha, Omaha, NEwww.AdvancedBiofuelsConference.com
Gain Exclusive ExposureBook Your Sponsorship Today for 2015As a sponsor of the 2015 Advanced Biofuels Conference & Expo, you will have an opportunity to position your organization as a leader and supporter of the renewable fuels industry in important international markets. For pricing and additional information, please contact your BBI International Account Executive at (866) 746-8385 or [email protected].
TWO FREE Producer Passes Per Biofuels FacilityEthanol | Biodiesel | Advanced Biofuels | Cellulosic
NETWORK WITH PRODUCERS
RBP is the marketing and sales channel for products and materials produced by CPPL. Current annual capacity is 10t pulp and 10t lignin, increasing to 200t pulp and 100t lignin in Q4 2015.
Private CompanyBio-Based Chemical and Product Sales
WIST connects the University of Wisconsin-Stevens Point to business and industry and provides research, laboratory services, and education. Our research includes biofuels, renewably sourced chemicals from biomass, packaging, compostability analysis, paper grade development and value-added uses of agricultural and forestry residuals.
Research InstituteCellulose Processing Lab
Laboratories and Analytical Capabilities Education and Workforce Development Basic and Applied R&D Independent Process and Products Evaluation
www.uwsp.edu/[email protected]
During 2013-2014, AST procssed a wide variety of biomass to produce over 2 tons of sugar, over 1 ton of pulp for paper, and 1 ton of pure lignin.
Private CompanyPilot Plant Bio-Refinery
Integrated Pilot Plant Biorefinery Applied R&D/Technology Development Product & Process Improvement Manufacturing/Limited Production
A University - IndustryPartnership
Sugar derivatives Biochemicals Biofuel Bio-oil
Outputs: High quality pulp C5 and C6 sugars Pure lignin Lignin/polymer compound
Inputs: Agricultural waste Forestry products & waste Any other lignocellulosic waste material in any form, from sawdust to woodchips
Biomass to End Product Biomass fractionation Organosolv pre-treatment Lignin extraction and recovery process High pressure and high temperature chemical processes and catalytic conversions Fermentation Metabolic engineering Process simulation
CPPL Technologies
Capabilities include, but not limited to:
Biochemical reactors for up to 400 PSI and 450 F High pressure/high temperature biomass fractionation Solvent recovery Pulp production, washing, drying Acid and enzymatic hydrolysis Sugar purification and dehydration Fast pyrolysis Fermentation Paper making and testing Analytical/experimental analysis Independent process/product development and evaluation Biomass characterization Chemical analysis Current Capacity - 200 Lb biomass processing/day including a 140 G high pressure/high temperature reactor Q4 2015 - 2 Ton biomass processing/day including a 2000 G high pressure/high temperature reactor with a powerful mixer.
CPPL Capabilities
A Unique Integrated Pilot Plant with 2 Ton/Day Processing Capability to Evaluate the Production of Value Added Products from Renewable Resources
PROVIDING PRE-COMMERCIALIZATION PILOT PROCESSING CAPABILITIES TO BIOMASS USERS, BIOMASS OWNERS, AND TECHNOLOGY DEVELOPERS
CPPLCellulose Pilot and Processing Lab
Hazlehurst, Georgia, USA
A S T E CW O O D P E L L E T P L A N T S
Modular design with replicated 20 TPH rated “lines”
One source for equipment and construction
No add-on equipment needed to reduce VOC emissions
Quick setup and startup with guaranteed production
24/7 support, parts and service
Any hard wood or soft wood species
AsAsAsAsAA tetetttetec,c,ccc, IIIIIncncncnc. . isisisisss aaa mmmemememembebebeebeeeerrr r r ofofofff tttttthehehehehehee AAAAAAAAstststsststececeecee IIIIndndndndndddusuusstrtrtrtrieieeeieies,s,s,s,ss IIIIIIncncncncncnnn . . fffffamamamamaaa ililililili yyy y y ofofofoffof ccccomomoommmpapapaap nininin eseses,,a a bibibibillllll ioioioioonnn dododododoollllarar ppppererreree yyyyyeaeaeae r r rr cocorprpppororatatatataa ioioioion n n heheheheeadadadadaa ququuuuuarara teteteteerererereeed dd d ininininnn CCCCCChahahahhahahahhatttttttttananannannnooooooooooooo gagaagggaag ,, TNTNNTNTNTN, , USUSUSUSUSUU A.AA.AAAAAAA