+ All Categories
Transcript
Page 1: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

http://creativecommons.org/licenses/by-sa/2.0/

Page 2: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Multiple Alignments & Molecular Evolution

Prof:Rui [email protected]

973702406Dept Ciencies Mediques Basiques,

1st Floor, Room 1.08Website of the

Course:http://web.udl.es/usuaris/pg193845/Courses/Bioinformatics_2007/ Course: http://10.100.14.36/Student_Server/

Page 3: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Part I: Multiple Alignments

Page 4: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Pairwise Alignment

• We have seen how pairwise alignments are made.

• Dynamic programming is an efficient algorithm for finding the optimal alignment.– Break problem into smaller subproblems– Solve subproblems optimally, recursively– Use optimal solutions to construct an optimal solution

for the original problem

• Alignments require a substitution (scoring) matrix that accounts for gap penalties.

Page 5: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Sub. Matrix: Basic idea

• Probability of substitution (mutation)

Page 6: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

PAM Matrices

• A family of matrices (PAM-N)• Based upon an evolutionary model• The score for a substitution of nucleotides/amino

acids is based on how much we expect that substitution to be observed after a certain length of evolutionary time

• The scores are derived by a Markov model – i.e., the probability that one amino acid will change to another is not affected by changes that occurred at an earlier stage of evolutionary history

Page 7: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Nucleic acid PAM matrices

• PAM = point accepted mutation• 1 PAM = 1% probability of mutation at each sequence

position.• A uniform PAM1 matrix for a familiy of closely related

proteins:

A G T C

A 0.99 0.00333 0.00333 0.00333

G 0.00333 0.99 0.00333 0.00333

T 0.00333 0.00333 0.99 0.00333

C 0.00333 0.00333 0.00333 0.99

Page 8: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did they get the values for PAM-1?

• Look at 71 groups of protein sequences where the proteins in each group are at least 85% similar (Why these groups?)

• Compute relative mutability of each amino acid – probability of change

• From relative mutability, compute mutability probability for each amino acid pair X,Y– probability that X will change to Y over a certain evolutionary time

• Normalize the mutability probability for each pair to a value between 0 and 1

Page 9: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Transitions and transversions

• Transitions (A G or C T) are more likely than transversions (A T or G C)

• Assume that transitions are three times as likely:

A G T C

A 0.99 0.006 0.002 0.002

G 0.006 0.99 0.002 0.002

T 0.002 0.002 0.99 0.006

C 0.002 0.002 0.006 0.99

Page 10: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

PAM-N Matrices

• N is a measure of evolutionary distance• PAM-1 is modeled on an estimate of how long in

evolutionary time it would take one amino acid out of 100 to change. That length of time is called 1 PAM unit, roughly 10 million years (abbreviated my).

• Values in a PAM-1 matrix show the probability that an amino acid will change over 10 my.

• To get the PAM-N matrix for any N, multiply PAM-(N-1) by PAM-1.

Page 11: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Distant relatives

• If a family of proteins is say, 80% homologous use a PAM 2.

A G T C

A 0.98014 0.011888 0.003984 0.003984

G 0.011888 0.98014 0.003984 0.003984

T 0.003984 0.003984 0.98014 0.011888

C 0.003984 0.003984 0.011888 0.98014

Page 12: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Computing Relative Mutability – A Measure of the Likelihood that an

Amino Acid Will Mutate For each amino acid• changes = number of times the amino acid

changed into something else• exposure to mutation =

(percentage occurrence of the amino acid in the group of sequences being analyzed) * (frequency of amino acids changes in the group)

• relative mutability = (changes/exposure to mutation) / 100

Page 13: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Computing Relative Mutability of A:changes = # times A changes into something else = 4% occurrence of A in group = 10 / 63 = 0.159frequency of all amino acid changes in group = 6 * 2 = 12

(Note: Count changes backwards and forwards.)exposure to mutation = (% occurrence of A in group)

* (frequency of all amino acid changes in group) = 12 * 0.159

relative mutability = (changes / exposure to mutation) / 100 = (4 / (12 * 0.159)) = 2.09 / 100 = 0.0209

Example from Fundamental Concepts of Bioinformatics by Krane and Raymer.

Page 14: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How can we understand relative mutability intuitively?

relative mutability = changes / exposure to mutation =the number of times A changed in proportion to thethe probability that it COULD have changed

exposure to mutation – that were 6 times when somethingchanged in the tree. Each time, that change could have been A changing to something else, or something elsechanging to A – 12 chances for a change involving A. But Aappears in a sequence only .159 of the time.

Page 15: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Computing Mutability Probability Between

Amino Acid PairsFor each pair of amino acids X and Y:

r = relative mutability of X

c = num times X becomes Y or vice versa

p = num changes involving X

mutability probability of X to Y =

(r * c) / p

Page 16: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Computing Mutability Probability that A will change to G:

r = relative mutability of A = .0209c = num times A becomes G or vice versa = 3p = num changes involving A = 4mutability probability of A to G =

(r * c) / p = (0.0209 * 3) / 4 = 0.0156

Page 17: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Normalizing Mutability Probability, X to Y

• For each Y among all amino acids, compute mutability probability of X to Y as described above

• Get a total of these 20 probabilities. Divide them by a normalizing factor such that the probability that X will NOT change is 99% and the sum of probabilities that it will change to any other amino acid is 1%

• These are the numbers that go in the PAM-1 matrix!

Page 18: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Converting Mutability Probabilities to Log Odds Score for X to Y

• Compute the relative frequency of change for X to Y as follows:– Get the X to Y mutability probability– Divide by the % frequency of X in the sequence data– Convert to log base 10, multiply by 10

• In our example, we get log10(0.0156/0.1587) =

log10(.098) • To compute log10(.098) solve for x:

– 10x = 0.098 x = -1.01 10-1.01 = 1/101.01 = 0.098• Compute log odds score for Y to X• Take the average of these two values

Page 19: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Usefulness of Log Odds Scores

• A score of 0 indicates that the change from one amino acid to another is what is expected by chance

• A negative score means that the change is probably due to chance

• A positive score means that the change is more than expected by chance

• Because the scores are in log form, they can be added (i.e., the chance that X will change to Y and then Y to Z)

Page 20: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Disadvantages of PAM Matrices

• An alignment tree must be constructed first, implying some circularity in the analysis

• The original PAM-1 matrix was based on a limited number of families, not necessarily representative of all protein families

• The Markov model does not take into account that multi-step mutations should be treated differently from single-step ones

Page 21: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Most Commonly-Used Amino Acid Subtitution Matrices

• PAM (Percent Accepted Mutation, also called Dayhoff Amino Acid Substitution Matrix)

• BLOSUM (BLOcks amino acid SUbstitution Matrix)

Page 22: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

BLOSUM Scoring Matrices

• Based on a larger set of protein families than PAM (about 500 families). The proteins in the families are known to be biochemically related.

• Focuses on blocks of conserved amino acid patterns in these families

• Designed to find conserved domains in protein families• BLOSUM matrices with lower numbers are more useful

for scoring matches in pairs that are expected to be less closely related through evolution – e.g., BLOSUM50 is used for more distantly-related proteins than BLOSUM62. (This is the opposite of the PAM matrices.)

Page 23: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

BLOSUM Matrices

• Target frequencies are identified directly and not by extrapolation

• Sequences more than x% identical are collapsed into a single sequence–BLOSUM 50: >=50% Identity–BLOSUM 62: >=62% Identity

Page 24: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Building a BLOSUM Matrix

• BLOSUM 62:– Collapse Sequences that have more than

62% identity into one– Calculate probability of a given pair of AAs

being in same column (qij)– Calculate the frequency of a given AA (fi)

– Calculate log odds ratio sij=log2(qij/fi). This is the value that goes into the BLOSUM matrix

Page 25: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

BLOSUM50

Page 26: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

What matrix to choose?

• BLOSUM Matrices perform better in local similarity searches

• BLOSUM 62 is the default matrix used for database searching

Page 27: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Gap Penalty

(Gap Scoring)

Page 28: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Gap Penalties

• Gaps in the alignment are necessary to increase score.

• They must be penalized; however if penalty is to high no gaps will appear

• On the other hand if they are too low, gaps everywhere!!!

• The default settings of programs are usually ok for their default scoring matrices

Page 29: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Once a gap, can we widen it?>gi|729942|sp|P40601|LIP1_PHOLU Lipase 1 precursor (Triacylglycerol lipase) Length = 645

Score = 33.5 bits (75), Expect = 5.9 Identities = 32/180 (17%), Positives = 70/180 (38%), Gaps = 9/180 (5%)

Query: 2038 IYSLYGLYNVPYENLFVEAIASYSDNKIRSKSRRVIATTLETVGYQTANGKYKSESYTGQ 2097 +++ YGL+ Y+ ++ Y D K +R ++ + N + G+Sbjct: 441 VFTAYGLWRY-YDKGWISGDLHYLDMKYEDITRGIVLNDW----LRKENASTSGHQWGGR 495

Query: 2098 LMAGYTYMMPENINLTPLAGLRYSTIKDKGYKETGTTYQNLTVKGKNYNTFDGLLGAKVS 2157 + AG+ + + +P+ + KGY+E+G + + Y++ G LG ++Sbjct: 496 ITAGWDIPLTSAVTTSPIIQYAWDKSYVKGYRESGNNSTAMHFGEQRYDSQVGTLGWRLD 555

Query: 2158 SNINVNEIVLTPELYAMVDYAFKNKVSAIDARLQGMTAPLPTNSFKQSKTSFDVGVGVTA 2217 +N P ++ F +K I + + + S KQ + +G+ ASbjct: 556 TNFG----YFNPYAEVRFNHQFGDKRYQIRSAINSTQTSFVSESQKQDTHWREYTIGMNA 611

Real gaps are often more than one letter long.

Page 30: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Affine gap penalty

LETVGYW----L

-5 -1 -1 -1

• Separate penalties for gap opening and gap extension.

• This requires modifying the DP algorithm to store three values in each box.

Page 31: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Scoring Gap Penalties• Linear Gap Penalty Score

• Affine Penalty Score

• Opening a gap is costly; extending it not so much (open=12; extension=1)

( )gap gap opening penalty score

( )

( ) ( 1)

gap opening penalty score

extension penalty gap

Page 32: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Multiple Sequence Alignment

Page 33: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

MSA Introduction

• Goal of protein sequence alignment:– To discover “biological” (structural / functional)

similarities

• If sequence similarity is weak, pairwise alignment can fail to identify important features (eg interaction residues)

• Simultaneous comparison of many sequences often find similarities that are invisible in PA.

Page 34: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Why do we care about sequence alignment?

• Identify regions of a gene (or protein) susceptible to mutation and regions where residue replacement does not change function.

• Information about the evolution of organisms.• Orthologs are genes that are evolutionarily related, have

a similar function, but now appear in different species.• Homologous genes (genes with share evolutionary

origin) have similar sequences.• Paralogs are evolutionarily related (share an origin) but

no longer have the same function. • You can uncover either orthologs or paralogs through

sequence alignment.

Page 35: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Multiple Sequence Alignment

• Often applied to proteins (not very good with DNA)

• Proteins that are similar in sequence are often similar in structure and function

• Sequence changes more rapidly in evolution than does structure and function.

Page 36: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Work with proteins!Work with proteins!If at all possible —If at all possible —

• Twenty match symbols versus four, plus similarity! Way better signal to noise.

• Also guarantees no indels are placed within codons. So translate, then align.

• Nucleotide sequences will only reliably align if they are very similar to each other. And they will require extensive hand editing and careful consideration.

Page 37: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Overview of Methods

• Dynamic programming – too computationally expensive to do a complete search; uses heuristics

• Progressive – starts with pair-wise alignment of most similar sequences; adds to that (LOCAL OPTIMIZATION)

• Iterative – make an initial alignment of groups of sequences, adds to these (e.g. genetic algorithms) (GLOBAL OPTIMIZATION)

• Locally conserved patterns• Statistical and probabilistic methods

Page 38: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Dynamic Programming

• Computational complexity – even worse than for pair-wise alignment because we’re finding all the paths through an n-dimensional hyperspace (Remember matrix, now add many dimensions)

• Can align less than 20 relatively short (200-300) protein sequences in a reasonable amount of time; not much beyond that

Page 39: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

A Heuristic for Reducing the Search Space in

Dynamic Programming

• Consider the pair-wise alignments of each pair of sequences.

• Create alignments from these scores.• Consider a multiple sequence alignment built

from the individual pairwise alignments.• These alignments circumscribe a space in which

to search for a good (but not necessarily optimal) alignment of all n sequences.

Page 40: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

The details

• Create an “alignment of alignments” (AOA) based on pair-wise alignments (Pairs of sequences that have the best scores are paired first in the tree.)

• Do a “first-cut” msa by incrementally doing pair-wise alignments in the order of “alikeness” of sequences as indicated by the AOA. Most alike sequences aligned first.

• Use the pair-wise alignments and the “first-cut” msa to circumscribe a space within which to do a full msa that searches through this solution space.

• The score for a given alignment of all the sequences is the sum of the scores for each pair, where each of the pair-wise scores is multiplied by a weight є indicating how far the pair-wise score differs from the first-cut msa alignment score.

Page 41: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Heuristic Dynamic Programming Method for MSA

• Does not guarantee an optimal alignment of all the sequences in the group.

• Does get an optimal alignment within the space chosen.

Page 42: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Progressive Methods

• Similar to dynamic programming method in that it uses the first step (i.e., it creates an AOA, aligns the most-alike pair, and incrementally adds sequences to the alignment.)

• Differs from dynamic programming method for MSA in that it doesn’t refine the “first-cut” MSA by doing a full search through the reduced search space. (This is the computationally expensive part of DP MSA.)

Page 43: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.
Page 44: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Progressive Method: the details

• Generally proceeds as follows: – Choose a starting pair of sequences and align them– Align each next sequence to those already aligned,

one at a time• Heuristic method – doesn’t guarantee an optimal

alignment• Details vary in implementation:

– How to choose the first sequence to align?– Align all subsequence sequences cumulatively or in

subfamilies?– How to score?

Page 45: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

ClustalW

• Based on phylogenetic analysis• A AOA is created using a pairwise distance matrix and

nearest-neighbor algorithm• The most closely-related pairs of sequences are aligned

using dynamic programming• Each of the alignments is analyzed and a profile of it is

created• Alignment profiles are aligned progressively for a total

alignment• W in ClustalW refers to a weighting of scores depending

on how far a sequence is from the root on the AOA

Page 46: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

ClustalW Procedure

AOA

Page 47: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.
Page 48: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

“Once a gap, always a

gap”

Page 49: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Basic Steps in Progressive Alignment

“Once a gap, always a gap”

Page 50: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.
Page 51: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Problems with Progressive Method

• Highly sensitive to the choice of initial pair to align. If they aren’t very similar, it throws everything off.

• It’s not trivial to come up with a suitable scoring matrix or gap penalties.

Page 52: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Part II: Molecular Evolution

Page 53: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Theory of Evolution

• Evolution is the theory that allows us to understand how organisms came to be how they are

•In probabilistic terms, it is likely that all living beings today have originated from a single type of cells

•These cells divided and occupied ecological niches, where they adapted to the new environments through natural selection

Page 54: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Neutral Mutation (e.g. by error in genome replication)

Page 55: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Neutral Mutation Mutation (e.g. by error in genome replication)

Page 56: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Neutral Mutation Mutation (e.g. by error in genome replication)

Page 57: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Deleterious Mutation (e.g. by error in genome replication)

Page 58: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Deleterious Mutation Mutation (e.g. by error in genome replication)

Page 59: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Deleterious Mutation Mutation (e.g. by error in genome replication)

Page 60: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Advantageous Mutation (e.g. by error in genome replication)

Page 61: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How did the first cell create different cells?

Neutral Mutation Mutation (e.g. by error in genome replication)

Page 62: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

And then there was sex…

Page 63: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Why Sex???

• Asexual reproduction is quicker, easier, more offspring/individual.

• Sex may limit harmful mutations– Asexual: all offspring get all mutations– Sexual: Random distribution of mutations. Those

with the most harmful ones tend not to reproduce.• Generate beneficial gene combinations

– Adaptation to changing environment– Adaptation to all aspects of constant environment– Can separate beneficial mutations from harmful ones– Sample a larger space of gene combinations

Page 64: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

New Niche/ New conditions in old niche

What drives cells to adapt?

Page 65: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

New (better addapted) mutation

What drives cells to adapt?

Page 66: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

How do New Genes and Proteins appear?

• Genes (Proteins) are build by combining domains• New proteins may appear either by intradomain

mutation of by combining existing domains of other proteins

Cell DivisionCell

Division …

Page 67: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

The Coalescent

•This model of cellular evolution has implications for molecular evolution

•Coalescent Theory:

•a retrospective model of population genetics that traces all alleles of a gene in a sample from a population to a single ancestral copy shared by all members of the population, known as the most recent common ancestor

Page 68: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Why is the coalescent the de facto standard today?

Alternatives?

Current sequences have evolved from the same original sequence (Coalescent)

Current sequences have converged to a similar sequence from multiple origins of life

Page 69: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Back of the envelop support for ?

ACDEFGHIKLMNPQRSTVWY 20A EDYAHIKLMNPQRGTVWY 20

AAi AAk 0]1[ pLog

AAk AAk [ 2] 0Log p

AAi AAk [ 1] 0Log p

AAi

[ 2] 0

1 2

Log p

ptot p p

2121 pppp

Convergence2014614 121 pppptot

Divergence14 62 1p p

Which is more likely?141 ( )1

Convergencep

Divergence

Back of the envelop support for divergence

Page 70: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

About the mutational processPoint mutations:

• Transitions (A↔G, C↔T) are more frequent than transversions (all other substitutions)

• In mammals, the CpG dinucleotide is frequently mutated to TG or CA (possibly related to the fact that most CpG dinucleotides are methylated at the C-residues)

• Microsatellites frequently increase or decrease in size (possibly due to polymerase slippage during replication)

Gene and genome duplications (complete or partial), may lead to: • pseudogenes: function-less copies of genes which rapidly accumulate (mostly

deleterious) mutations, useful for estimating mutation rates!• new genes after functional diversification

Chromosomal rearrangements (inversions and translocation), may lead to • meiotic incompatibilities, speciation

Estimated mutation rates: • Human nuclear DNA: 3-5×10-9 per year• Human mitochondrial DNA: 3-5×10-8 per year• RNA and retroviruses: ~10-2 per year

Page 71: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Consequences of the coalescent model?

Page 72: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

So what if we accept the coalescent model?A1 TSRISEIRR

A2 TSRISEIRR

A3 TSRISEIRR

A4 TSRISEIRR

A5 TSRISEIRR

A6 TSRISEIRR

A7 PSRISEIRR

A8 PKRISEVRR

A9 PKRISEVRR

A10 PQRISAIQR

A11 PQRISAIQR

A12 PQRISTIQR

A13 PQRISTIQR

A14 ASHLHNLQR

A15 TKHLQELQRE

A16 TKHLQELQRE

A17 TKHLQELQRE

A18 SKHLHELQRD

A19 PKNLHELQKD

A20 SKRLHEVQSE

A1-6 TSRISEIRR

A7 PSRISEIRR

A8-9 PKRISEVRR

A10-11 PQRISAIQR

A12-13 PQRISTIQR

A14 ASHLHNLQR

A15-17 TKHLQELQR

A18 SKHLHELQR

A19 PKNLHELQK

A20 SKRLHEVQS

Page 73: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

So what if we accept the coalescent model?

A1-6 TSRI SEI RR

A7 PSRI SEI RR

A8-9 PKRI SEVRR

A10-11 PQRI SAI QR

A12-13 PQRI STI QR

A14 ASHLHNLQR

A15-17 TKHLQELQR

A18 SKHLHELQR

A19 PKNLHELQK

A20 SKRLHEVQS

A1-6

A7

A10-11

A12-A13

A’1-7

A’10-13

Page 74: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

So what if we accept the coalescent model?

A’1-7 (p-t) SRI S E I RR

A8-9 P KRI S E VRR

A’10-13 P QRI S(a-t)I QR

A14 A SHLH N LQR

A15-17 T KHLQ E LQR

A18 S KHLH E LQR

A19 P KNLH E LQK

A20 S KRLH E VQS

4 3324 5 323

Page 75: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Phylogenetic trees

1 23

4

root

5

6

8 7 time

21 3 4 5

68

7

2

1

3 4

5

6

8

7

Rooted tree Rooted tree satisfying “molecular clock” hypothesis: all leaves at same distance from the root.

root

Unrooted tree:

Note: 1-5 are called leaves, or leave nodes. 6-8 are inferred nodes corresponding to ancestral species or molecules. Branches are also called edges. The edge lengths reflect evolutionary distances.

Page 76: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Phylogenetic treesA tree is a graph reflecting the approximate distances between a set of objects.A tree is also called a dendrogram. There are different types of trees:

Unrooted versus rooted trees: A rooted tree has an additional node representing the origin, in molecular phylogeny the last common ancestor of the sequences analyzed. In general, the root cannot be directly inferred from the data. It may be inferred from the paleontological record, from a trusted outlier, or on the basis of the molecular clock hypothesis.

Scaled and unscaled trees: In an unscaled tree, the length of the branches are not important. Only the topology counts. In phylogeny, trees are usually scaled.

Binary trees: each node branches into two daughter nodes. Other trees are usually not considered in phylogeny as they can easily be approximated by binary trees with very short edges between nodes. Note: A rooted (or unrooted) tree connecting n objects (leaves) has

2n–1 (or 2n–2) nodes altogether and2n–2 (or 2n–3) edges

Page 77: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Phylogenetic tree reconstruction, overview

Computational challenge: There is an enormous number of different topologies even for a relatively small number of sequences:

3 sequences: 1 4 sequences: 35 sequences: 15 10 sequences: 2,027,025 20 sequences: 221,643,095,476,699,771,875

Consequence: Most tree construction algorithm are heuristic methods not guaranteed to find the optimal topology.

Input data for two major classes of algorithms:1. Input data distance matrix, examples UPGMA, neighbor-joining2. Input data multiple alignment: parsimony, maximum likelihood

Distance matrix methods use distances computed from pairwise or multiple alignments as input.

Page 78: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Building phylogenetic trees of proteins

Genome 1

Genome 2

Genome 3

Genome …

Protein A Protein B Protein C Protein D

Protein A Protein BProtein C Protein D

Protein AProtein B Protein CProtein D

Page 79: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Distance based phylogenetic trees

ACTDEEGGGGSRGHI…A-TEEDGGAASRGHI…ACFDDEGGGGSRGHL……

A1

A2

A3

A1

A2

A3

A1

5 substitutions 3 substitutionsA2

A3

8 substitutions

A2

A3

A1

3

5

Page 80: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Maximum likelihood phylogenetic trees

ACTDEEGGGGSRGHI…A-TEEDGGAASRGHI…ACFDDEGGGGSRGHL……

Alignment Probability of aa substitution

A - E D …

A 1 0.01 0.2 0.09 …

- 0.01 1 0.0001 0.0001 …

E 0.2 0.0001 1 0.5

D 0.09 0.0001 0.5 1

Page 81: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Maximum likelihood phylogenetic trees

ACTDEEGGGGSRGHI…A-TEEDGGAASRGHI…ACFDDEGGGGSRGHL……

AlignmentA1

A2

A3

A1

5 substitutions

3 substitutions

A2

A3

8 substitutions

p(1,2)

p(1,3)

p(2,3)

p(2,3)>p(1,2)>p(1,3)

A1

A3

A2

A2

A3

A1

Page 82: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Maximum Likelyhood:Parsimony

• Goal: To explain the MSA with a minimal number of mutational events – to find the tree with the minimal cost

• Input: a multiple sequence alignment (MSA):

• Major components:

• A cost function for a tree given an MSA which simultaneously defines the branch lengths

• An algorithm which finds a tree with the minimal cost

• Output:

• an un-rooted tree (topology plus branch-lengths)

• A total cost

• an ancestral sequences for each non-terminal node

Page 83: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Statistical evaluation of trees: bootstrapping

1

2

54

3

76

8

Motivation: Some branching patterns in a tree may be uncertain for statistical reasons (short sequences, small number of mutational events)

Goal of bootstrapping: To assess the statistical robustness for each edge of the tree.

Note that each edge divides the leave nodes into two subsets. For instance, edge 7–8 divides the leaves into subsets {1,2,3} and {4,5}.However, is this short edge statistically robust ?

Method: Try to generate tree from subsets of input data as follows:

• Randomly modify input MSA by eliminating some columns and replacing them by existing ones, This results in duplication of columns.

• Compute tree for each modified input MSA.

• For each edge of the tree derived from the real MSA, determine the fraction of trees derived from modified MSAs which contain an edge that divides the leaves into the same subsets. This fraction is called the bootstrap value. Edges with low bootstrap values (e.g. <0.9) are considered unreliable.

Page 84: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Statistical evaluation of trees: bootstrapping

Page 85: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Other Trees

• Use genomes

• Use Enzymomes

• Use whatever group of molecules are important for a given function

Page 86: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

To Do

• Take the HKs and RRs you have annotated.

• Go to

• http://bioinf.cs.ucl.ac.uk/dompred/DomPredform.html

• Identify the different domains in each individual protein.

Page 87: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

To Do

• Take the HKs and RRs you have annotated.

• Create phylogenies for the complete HKs and RR sequences

• Create phylogenies for the individual homologous domains of the different proteins.

• Use either clustal or STRAP for protein alignment and tree building.

Page 88: Http://creativecommons.org/licens es/by-sa/2.0/. Multiple Alignments & Molecular Evolution Prof:Rui Alves ralves@cmb.udl.es 973702406 Dept Ciencies Mediques.

Distance measures for phylogenetic tree construction

Distance measures respect the following constraints: d = 0 if the sequences are identical, d > 0 if the sequences are different

Distances between molecular sequences are computed from pair-wise alignment scores.

For closely related DNA sequences, one could simply use f , the fraction of non-identical residues (readily computed from the % identity value returned by an alignment program).

For more distantly related sequences, the Jukes-Cantor distance, d = –¾log(1–4f/3) is preferred. This measure is supposed to be proportional to evolutionary time. It takes into account that the percent identity value saturates at 25% over time.

For protein sequences aligned with the aid of a substitution matrix, an approximate distance is often computed as follows:

rand

randobs

SS

SSD

max

log Sobs observed pairwise alignment scoreSmax maximum score (average of alignment scores

of each sequence against itself)Srand expected score for random sequences of

same length and composition


Top Related