het collectief centrum van de Belgische technologische industrie
Manufacturing Day 2011Digital Factory introduces a new era for product development
10-04-2023© Sirris | www.sirris.be | [email protected] | 2
Product Development
The GoalBring the products that your customers want to market at the
right time and the lowest cost.
By The Way• on a limited budget• with limited resources• with limited time• and changing priorities• on a daily basis
10-04-2023© Sirris | www.sirris.be | [email protected] | 3
10-04-2023© Sirris | www.sirris.be | [email protected] | 4
#1Start now and create your strategic Digital
Factory plan !
Rule #1: Start Now!
What are the strategic options?
10-04-2023© Sirris | www.sirris.be | [email protected] | 5
2012 2013 2014 2015 2016 2017
€
Do Nothing
BreakthroughInnovation
Incremental improvements
Room for improvements
Additional room for improvements
1.1 Set Strategic Goals
• Time To Market • First Time Through Rate• Customer Satisfaction• Product Performance• Efficiency • Flexibility• Cost Reduction• Margin• …
10-04-2023© Sirris | www.sirris.be | [email protected] | 6
1.2 Analyse Current Processes
10-04-2023© Sirris | www.sirris.be | [email protected] | 8
'When we understand this slide, we'll have won the war.'General Stanley McChrystal,
US and NATO force commander
10-04-2023© Sirris | www.sirris.be | [email protected] | 9
ActiveVOS, Adeptia, Altova, Appian Corporation, Avolution, Axway, Bizagi, BOC AG Borland, Cordys, Corel, Embarcadero Technologies, HandySoft Corporation, IDS Scheer, ILOG, Interfacing Technologies, MEGA International, Microsoft, No Magic, Omni Group, Orbus software, Pegasystems, SAP AG, Software AG, Sun Microsystems, Sybase, Tibco Software, Troux Technologies, Visual Paradigm, yWorks, …
1.2 Analyse Current Processes
10-04-2023© Sirris | www.sirris.be | [email protected] | 10
1.3 Define Actions Issue
ImprovementAction
Impact
10-04-2023© Sirris | www.sirris.be | [email protected] | 11
1.4 Prioritise actions
Impact
ROI
Size = investment
10-04-2023© Sirris | www.sirris.be | [email protected] | 12
1.5 Action-types
• Eliminate steps • Increase efficiency• Minimise iteration-effects
XX
2.1 Digitise your processes
CAADCADCADDCAECAMCAPPCAQCARCASCASECFDCIMEDAFEAKBEMPMMPPPDMPLM
Technologies
+
10-04-2023© Sirris | www.sirris.be | [email protected] | 16
A photorealistic rendered picture created with POV-Ray 3.6. Glasses and ashtray are modelled with Rhinoceros 3D. Dice with Cinema 4D
2.2 Quy Orthopedic Milling Services (1)
Original Process
10-04-2023© Sirris | www.sirris.be | [email protected] | 17
Assess Patient-geometry
Create Plaster-negative
Adjust Plaster-negative
Copymilling
• Long Lead Time • Average Quality • High Cost• Labour Intensive
2.2 Quy Orthopedic Milling Services (2)
• Digitised Process
10-04-2023© Sirris | www.sirris.be | [email protected] | 18
Asess Patient-geometry
Create Plaster-negative
Adjust plaster-negative
Create
CAM
Copymilling
MillingCapture 3D data
X XAdjust in CAD
CAM
2.3 Simulation of rain penetration (1)
• Original Process
10-04-2023© Sirris | www.sirris.be | [email protected] | 19
Design Data
OK?Physical
PrototypeTesting
Certification
2.3 Simulation of rain penetration (2)
• New Process
10-04-2023© Sirris | www.sirris.be | [email protected] | 20
Design Data
SimulationOK?
TestingCertification
OK?
• No straight forward model to apply all the physics(rain droplets, wind driven motion in fluid domain, droplet accumulation and motion over the wall boundaries)
• DPM (Discrete Particle Model) lacks modeling droplet-accumulation. Therefore, trial tests were done with Eularian Mixing Model which is capable of modeling water accumulation and motion on the louver walls
• Initial results were in poor agreement with the experimental study. Changing the droplet size improved accuracy. 30 days of simulation time were required to do droplet size optimization. Initial results indicate that modeling with 150micron droplet size is in better agreement with the experimental results.
• In 2008 simulation was more expensive than physical testing. Now (2011) it is cheaper
• Increase your knowledge and prepare for setbacks
2.3 Simulation of rain penetration (3)
10-04-2023© Sirris | www.sirris.be | [email protected] | 22
#3Topmanagement
has to support the improvement
process !
10-04-2023© Sirris | www.sirris.be | [email protected] | 23Room filled with people who care.
3.1 Manage the project
• Allocate resources (PM)• Plan learning (and setback) curve• Monitor KPI • Adjust implementationspeed• Feedback results to stakeholders • Plan second improvement project• Take 1 step at a time
10-04-2023© Sirris | www.sirris.be | [email protected] | 24
Sales
CustomerOfferte
Archive
Search for similar offers
Calculation Software
ERP
3.1 Typical Sales Proces: Offer (1)
Offer
Information Transfer
Knowledge at individualsManusla input
Internal Sales
EngineeringWorkpreparation
BOM and routing
Source: Sofon
Sales
CustomerOfferte
Archive
Calculation Software
ERP
Offer
Internal Sales
EngineeringWorkpreparation
BOM and routing
Modified Offer
Gewijzigde Offerte
3.1 Typical Proces: Modified Offer (2)
Information Transfer
Knowledge at individualsManusla input
Source: Sofon
Modified Offer
Sales
Customer
Internal Sales
Calculation Software
EngineeringPlanning / Production
Offer
Archive
Workpreparation
BOM and routing
DelayOrderconfirmation
ERP
Offer
Order
Modified Offer
3.1 Typical Sales Proces: Order (3)
Source: Sofon
3.3 Modularity, standardisation
10-04-2023© Sirris | www.sirris.be | [email protected] | 30
k100 klantenspecificaties, 1 1 1k200 klantenspecificaties, 2 2 219Touch screen 21 1 2101generator 3 1 1 3 1 1 1 1 1 1 1 1 1 102deoxo-dryer 4 1 1 1 4 1 1 1 1 1 1 103H2-dryer 5 1 1 5 1 1 1 1 104Fritz sparger H2 6 1 1 1 1 605oxy 7 1 1 706dehydro 8 1 1 8 1 1 1 1 1 1 107O2-dryer 9 1 1 1 9 1 1 1 1 108Fritz sparger O2 10 1 1 1 1 1009storage 11 1 1 11 1 1 1 110Electrische voeding 12 1 1 1 1 1 1 1 12 1 1 1 1 111Proceswater 13 1 1 1 1312Cooling water (chiller / closed loop / dry cooler)14 1 1 1 1 1 14 1 1 113Nitrogen 15 1 1 1 1 1 1 1 15 1 1 1 114Instrument air 16 1 1 1 1 1 1 1 16 1 115Enclosure 17 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 17 1 1 1 1 1 1 116Online purity o2 18 1 1 1 1 1 1817Online purity H2 19 1 1 1 1 1 1920Hydrogen compressor 22 1 1 1 2221Oxygen compressor 23 1 1 1 2323Mass flow meter 25 1 1 1 2524Control panel 26 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 26 1 126Interconnections 28 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 28 1 127Power distribution 29 1 1 1 1 1 1 1 1 29 128Power rack 30 1 1 1 1 3018Visualisatie 20 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 20 125Software 27 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2722On site erection 24 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 24
Actions• Productportfolio (5)• Conceptual Design (8)• Systemdesign ( 20)• Detaildesign (100)
Leadtime decreases 50%
10-04-2023© Sirris | www.sirris.be | [email protected] | 32
5.1 Internal Collaboration (1)
Documentserver
PDMCMS
Content Management System
IntranetCommunities
Local
…
Collaboration Platform
Atos Origin sets out its ambition to be a zero email company within three years (07/02/2011)
• By 2013, more than half of all new content will be the result of updates of existing information
• Online social networking is now more popular than email and search • Middle managers spend more than 25% of their time searching for
information • 2010 : Corporate users receive 200 mails per day, 18% of which is
spam
10-04-2023© Sirris | www.sirris.be | [email protected] | 33
5.1 Internal Collaboration (2)
Why search when you can ask your network?
5.1 Internal Collaboration (3)
10-04-2023© Sirris | www.sirris.be | [email protected] | 34
My smmr hols wr CWOT. B4, we usd 2 go 2 NY 2C my bro, his GF & thr 3 :-@ kds FTF.
2003, nn, 12 years old.
Now 20 years and starting in your company!
5.2 External Collaboration (1)
10-04-2023© Sirris | www.sirris.be | [email protected] | 35
SuppliersRaw
Material
Supplier
Distributors
ComponentSuppliers
ContractManufacturers
Factories
ConsumersManufacturer Channels
PlantWarehouses
HQ Retailers
Resellers
Direct
Individual
Businesses
ServiceDesign / R&D
Source: Microsoft
5.2 External collaboration (2)
• Data exchange : JT, STEP, 3DPDF, …• SME’s will be pressured to collaborate with Large
Enterprises• LE provides portals for offering and collaborative design• Larger companies (Vestas, Airbus) centralise all engineers
on a project base.
10-04-2023© Sirris | www.sirris.be | [email protected] | 36
© sirris 2007 | www.sirris.be | [email protected] | 3821/06/2007
Proces Deelproces BeginnerMidden-
mootGevorderd
Engineering Change Management l lProduct Data Vaulting and Management l l lBill of Material Management l lItem Management and Classification lDesign and Project Collaboration -
Visualization, Markup and Translation -
CAD Design Integration l l lEnterprise/ERP Integration
Product Cost Estimation - -
Portfolio Management - - -Project Management - -
Stage Gate Process, Workflow - -
Ideation - -
Requirements Management -
Production Process Planning - -
Production Process Design and Validation -
Production Modeling and Simulation -
Ergonomic Evaluation and Simulation - -
Product Identification l lProduct As-Built Configuration - lProduct As-Is Configuration -
Product Service History and Parts -
Design for Compliance - Management of Hazardous and Controlled Substances - -
Regulatory and Compliance Documentation l lManaging Recyclables and Controlled Waste - -
75-100 l50-75 25-50 0-25 -
Maturiteit
Engineering and Collaboration
% bedrijvendie dit gebruiken
Legende
Portfolio & Project Mgt
Manufacturing Proces
Management
Service
Regulatory & Compliance
Idea & Requirement Mgt
5.3 Benchmark (2)
5.4. Audit
10-04-2023© Sirris | www.sirris.be | [email protected] | 39
Audit Digital Factory
Hierarchy Criterion 0 1 2 3 4 Comment1 Discrete Industries1,1 Engineering Change Management1.1.1 Engineering Change Definition1.1.2 Managed Change Process1.1.3 Engineering Change Effectivity
1.1.4Engineering Change Cost/Impact Analysis
1.1.5Engineering Change Execution/Communication
1.1.6 Managing Engineering Changes
1,2Product Data Vaulting and Management
1.2.1 Product Data Vaulting1.2.2 Product Data Organization1.2.3 Product Data Search and Retrieval1,3 Bill of Material Management1.3.1 Product Structures1.3.2 BOM Definition1.3.3 BOM Structure1.3.4 BOM Content1.3.5 Managing BOM's1.3.6 BOM Validation
1,4Item Management and Classification
1.4.1 Item Classes/Attributes1.4.2 Item Definition
1,5Routing, Approval, and Lifecycle Process
Conclusions (1): 5 Golden Rules
10-04-2023© Sirris | www.sirris.be | [email protected] | 40
#1Start now and make a
plan !#2Think Digital !
#3Manage !
#4Think Modular !
#5Collaborate !
Conclusions (2): So what?
10-04-2023© Sirris | www.sirris.be | [email protected] | 41
% improvement20 40 60 80
Savings tool design
Communication and collaboration
Reduction Design Changes
Timesavings production planning
Time to Market
Project efficiency