+ All Categories
Transcript
Page 1: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

The Temptation of Technology

Robert Stevens

BioHealth Informatics Group

University of Manchester

[email protected]

Page 2: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Semantic Webs for Life Sciences

Pacific Symposium on Biocomputing 2006

http://psb.stanford.edu/

The creation and use of Semantic Web appliccations

Page 3: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Give me convenience, or give me death

Page 4: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Making the Trains Run on Time

Page 5: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Reinventing the wheel

Page 6: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Heath Robinson

Page 7: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Learning New Tricks

Page 8: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Purity

Page 9: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

The Puritan Approach

Page 10: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Angels on the head of a pin

Page 11: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Holy Grail

Page 12: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

A ‘Grand Challenge’

Page 13: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Classifying Proteins

>uniprot|Q15262|PTPK_HUMAN Receptor-type protein-tyrosine phosphatase kappa precursor (EC 3.1.3.48) (R-PTP-kappa).

MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHV

SAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNP

GTLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSSFWPNEYQVIFEAEVSGGRSGYI

AIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPV………..

InterPro

Instance Store

Reasoner

Translate

Codify

Page 14: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

Continuous Revolution

Page 15: The Temptation of Technology Robert Stevens BioHealth Informatics Group University of Manchester Robert.stevens@manchester.ac.uk.

KISS & Tell

Keep it simple, stupid

Keep it simple and stupid

Keep it stupid

Keep it sufficiently sophisticated

Lie about the features


Top Related