Post on 07-Aug-2018
transcript
8/19/2019 IGF-1 | What is it?
http://slidepdf.com/reader/full/igf-1-what-is-it 1/7
What is IGF-1?
8/19/2019 IGF-1 | What is it?
http://slidepdf.com/reader/full/igf-1-what-is-it 2/7
Overview of IGF-1
IGF-1 (Insulin-like growth factor 1), also called Somatomedin 1, IGFIGF-IA, and mechano growth factor, was named for its close re
proinsulin. IGF-1 is encoded by the IGF1 gene.
IGF-1 is comprised of 70 amino acids with a molecular weight of 7649acid sequence is GPETLCGAEL VDALQFVCGD RGFYFNKPTGYGSTGIVDECCFR SCDLRRLEMY CAPLKPAKSA. It is known as an importa
growth throughout the lifecycle of mammals.
8/19/2019 IGF-1 | What is it?
http://slidepdf.com/reader/full/igf-1-what-is-it 3/7
How it Works
IGF-1 is most commonly generated by the liver in response to produchormone by the pituitary gland, but it can be produced in the fetus anfor localized purposes.
It has been shown to play a critical role in cell growth, apoptosis (prdeath), cell division, and the transfer of glucose across cell membranesit is found to have the opposite effect on adipose (fat) tissue.
IGF-1 inhibits the growth of adipose tissue while restricting glucose trencourages the body to burn adipose tissue for energy.
8/19/2019 IGF-1 | What is it?
http://slidepdf.com/reader/full/igf-1-what-is-it 4/7
About IGF-1 LR3
Long arginine 3-IGF-1, also called Long r3 IGF-1, LR3 IGF, IGF1 LR3, Lo1, is a synthetic version of IGF-1. It differs from IGF-1 by having an adamino acids at its N-terminus making it 83 amino acids.
There is also a substitution in the corresponding IGF-1 third position ofor an arginine. It has a molecular weight of 9105.4 Da. It’s amino acid MFPAMPLSSL FVNGPRTLCG AELVDALQFVCGDRGFYFNK PTGYGS
APQTGIV DEC CFRSCDLRRL EMYCAPLKPA KSA.
The difference in chemical composition makes the ability to bind to IG
efficient. The result is a 2.5 times increase in potency. Additionally, it hhalf-life of 20-30 hours.
8/19/2019 IGF-1 | What is it?
http://slidepdf.com/reader/full/igf-1-what-is-it 5/7
About IGF-1 DES
DES (1-3) IGF-1, also named IGF-1 Des (1-3), IGF-1 Des 1-3, is anotherthat occurs naturally and synthetically. It is missing the first three aminthe IGF-1 amino acid chain.
It is composed of 67 amino acids and has a molecular weight of 7360.5acid sequence is TLCGAELVDA LQFVCGDRGF YFNKPTGYGSSSRRAPQTGIVDECCFRSCD LRRLEMYCAP LKPAKSA.
The missing amino acids make it less effective at binding to IGF protbecause of the glutamate amino acid missing from position 3. The
difference makes it 10x more potent than IGF-1.
8/19/2019 IGF-1 | What is it?
http://slidepdf.com/reader/full/igf-1-what-is-it 6/7
Get Started on Researching
IGF-1, and its variants, are essential for regular growth in mam
development of muscle mass later in life. They have wide clinical u
induce different physical and muscle developmental issues. Rasa
proud to be provide these peptides for purchase for research purpos
Our chemical pr
intended for labo
8/19/2019 IGF-1 | What is it?
http://slidepdf.com/reader/full/igf-1-what-is-it 7/7
Buying Peptides &Research Liquids
Our chemical products are only
intended for laboratory research
https://rasaresearch.com/what-is-igf-1/