Using the complete genome sequence of Mycobacterium ulcerans

to address research priorities for the control of Buruli ulcer

“Knowledge is power.”Sir Francis Bacon

Genome sequence = knowledge

(length of 1 bp) x(number of bp per cell) x

(number of cells in a colony)

(0.34 x 10-9 m) x (6 x 106) x (107) =

20 km

A, G, C, T……..

AGCTCTGGGCGTTTCGCAATGGCTAGCGATAGCTCTGGGCGTTTCGCAATGGCTAGCGAGT………

genes (DNA)

proteins(amino acids)

muweb.millersville.edu

Information

Knowledge

Wisdom

Genome sequence

Annotated genome

Hypothesis testing

Treatment

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

MU MDPTIAAGALIGGGLIMAGGAIGAGIGDGIAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

Genome overview

5,631,606 bp

174,155 bp

5,805,761 bp

pMUM001, mycolactones and virulence

mlsA1mlsA2

mlsB

5,631,606 bp

174,155 bp

5,805,761 bp

• 4288 CDS

• 304 copies ISE

Genome overview

5,631,606 bp

174,155 bp

5,805,761 bp

• 4288 CDS

• 304 copies ISE

• 735 pseudo

Genome overview

5,631,606 bp

174,155 bp

5,805,761 bp

• 4300 CDS

• 288 copies ISE

• 690 pseudo

• MU unique- 2 prophage

- 97 PE/PPE

- 22 other

• G + C 65.47%

Genome overview

M. M. ulceransulcerans--specificspecific antigen identificationantigen identification

• 41 potential antigens identified

• Rapid immunodiagnostics

• Vaccine development

MU Genome Treatment

• New drugs

• New diagnostic tools

• Vaccines

• Improved molecular epidemiology

http://genolist.pasteur.fr/BuruList/

Monash Microbiology• Jessica Porter• Sacha Pidot• Janine Ryan• Grant Jenkin• John DaviesVictorian Bioinformatics Consortium• Torsten SeemannOthers• Paul Johnson (Austin Hospital)

Funding• Association Française Raoul Follereau• The Génopole Programme• World Health Organisation (Nippon Foundation)

• NH&MRC, Australia

• Wafa Frigui• Roland Brosch• Thierry Garnier• Melinda Pryor• Gilles Reysett• Stewart Cole

Dept. Biochemistry University of Cambridge

• Hui Hong• Peter Leadlay

The Génopole PF1

University of Tennessee

• Pamela Small

“Where is the Life we have lost in living? Where is the

wisdom we have lost in knowledge? Where is the

knowledge we have lost in information?”

T.S. Eliot