Nifty pickle 09 25 14

1Thanks For Reading The Nifty Pickle!

Thursday • September 25, 2014 • Issue #6

50th Annual Boaz Harvest Festival

The Boaz Area Chamber of Com-merce proudly presents the 50th Annu-al Boaz Harvest Festival on Friday and Saturday, October 3rd and 4th from 8am until 6pm, in Historic Downtown Boaz, Alabama. There will be an Antique Classic Car Show on Saturday with registration from 8am until 10am and prizes will be awarded at 3pm. You will see Street Rods, Show Cars, Antiques, Muscle Cars, Collectors, Modified, Trucks and Motorcycles along with parts vendors. You can shop Main Street with over 200 Arts and Crafts, Food Court and Free Children’s Inflatable Play Area. Rides will also be available for a fee on the Euro-Bungee Jumping, Rock Climb-ing Wall and Thomas the Train. Oh, and don’t forget about the Monster Balls... Kids love them! Be sure to attend the Miss Harvest Festival Pageant on Saturday morning at 9am. It will be held downtown, next door to Q-Slow Smoked BBQ and will be for

ages 1 to 18. Contestants will compete for prizes, trophies and flowers and a scholarship to Snead State Community College will be awarded to the Miss Har-vest Festival winner, ages 16-18, in the upper division of the pageant. The age groups include: Tiny Miss (1-3 years), Little Miss (4-6 years), Petite Miss (7-9 years), Junior Miss (10-12 years), Teen Miss (13-15 years) and Miss Harvest Festival (16-18 years). There will be entertainment daily with Gary Waldrep Bluegrass Band per-forming on Saturday at 1pm and 5pm along with Southern Riot and The Shii Band. Trent Slaton and Country Case will perform at 5pm on Friday. All motorcycle riders are invited to join us for the Harvest Festival Motor-cycle Fun Ride and you certainly don’t want to miss the Moon-Pie Eating Con-test on Saturday. We will also be having our 1st Harvest Moon Midnight Run, 5K and 1 Mile Fun Run. It starts at 11:59pm Friday from Piper Station. The $25 pre-race fee benefits the High School Cross-Country Team and a city program to make Boaz healthier. For more information, please con-tact the Boaz Chamber of Commerce at 256-593-8154 or email us at [email protected]. You may also visit us at www.boazchamber-ofcommerce.com.

The Harvest Festival is located on Hwy 168 just off US Hwy 431 in Histor-ic Downtown Boaz Alabama. Come Join Us and Enjoy!

Do You Have An Idea For A Story That You Would Like To See In

The Nifty Pickle?

If So, Please Call256-673-8190

or send an email [email protected].

Thanks For ReadingThe Nifty Pickle!

Please Support Your Local Merchants!2

LIVING

Billboard For Rent in Boaz. AL Hwy 168 (Across from

Little Lots)The top and bot-tom of both sides

are available. $250 per Month for each space. No Contract

Required.

Call JW at256-673-8190 for

more information.

(StatePoint) The next time you’re standing in the cereal aisle, think back on your early memories of breakfast. If you’re like many Americans, your morning likely started with a bowl of cereal and milk and perhaps a Silly Rabbit.

This year, Trix cereal celebrates 60 years of special moments around the morning breakfast table complete with flavorful fruitier-tast-ing corn puffs, an endearing Silly Rabbit and colorful fun by the bowlful. Here is a look at its fun, fruity 60-year history.

• 1954: General Mills introduced Trix, the first ready-to-eat ce-real created especially for kids, the same year of the first national color television broadcast. The original corn puff colors included raspberry red, orange and lime yellow.

• 1959: The Trix Rabbit is introduced to television audiences in a commercial which launched his quest to nab Trix cereal. Whether he was on roller skates or stealthily hidden in disguise, kids were encouraged to remind him that, “Silly Rabbit, Trix are for kids!”

• 1960: The first rabbit appears on the front of a Trix cereal box. The following year, the iconic box featuring a roller skating rabbit de-buts.

• 1968: To coincide with a presidential election year, Trix boxes featured a “Vote Now!” offer where kids could vote via postcard whether or not to let the Silly Rabbit try his favorite cereal. This popular promo-tion was repeated throughout the years, including in 1976 during the Bicentennial.

• 1987: A special “Wanted” box asks Trix fans to help name the Rabbit. This was one of many interactive boxes created over the years that featured mail-in or in-box giveaways like markers, bumper stickers, sunglasses, an alarm clock, magnets, and pillow cases.

• 1991: Trix introduces cereal shapes that look like fruit.

• 2000s: Trix colors began to include Wildberry Blue, Grapity Purple, Raspberry Red, Lemony Yellow, Orangey Orange and Water-melon.

• 2009: Cereal puffs sport their signature Trix swirl.

• 2014: Celebrating 60 years of special breakfasts, General Mills introduces new fruitier-tasting Trix nationwide featuring solid-colored cereal puffs.

Pop culture and cereal aficionados alike can visit www.Silly-Channel.com for more nostalgia, as well as interactive games and activ-ities featuring the Silly Rabbit.

Silly Rabbit Still Seeking Cereal After 60 Years

Here’s how the iconic kids’ cereal has changed over the course of six decades.(c) General Mills

Can you name three consecutive days without using the words Monday,Tuesday, Wednesday, Thursday,

Friday, Saturday, or Sunday?See Answer on Page 15


The Rules Are Simple! This contest is for chil-dren that are 3 - 12 years of age. Please submit your entry no later than October 6, 2014. The winners (one boy and one girl) will be announced on our website, www.niftypickle.com, and in the next issue of the Nif-ty Pickle. You can mail your entry to Nifty Pickle, PO Box 1161, Guntersville, Alabama 35976. Please in-clude your name, phone number or email address so we can contact you if you are the winner. Your phone number or email address will never be shared with anyone. If you are one of the lucky winners, we will let you know where to pick up your prize.

Nifty PicklePublished Weekly

by Nifty Pickle, Inc.7032 US Hwy 431

Albertville, Alabama 35950

256-673-8190The publisher, Nifty Pickle,

Inc., has no responsibility for claims made by advertisers. No part of this publication

may be reproduced in whole or in part without consent of the publisher. The Publisher

will not be liable for any error in display advertisement to a greater extent that the cost of the line space occupied in the advertisement. The adver-tiser and/or agency agree to protect, indemnify and hold

harmless this publication, and it’s publisher, Nifty Pickle, against any and all liability, loss and expense (including attorney fees) arising out of the publication of the adver-

tisers advertisement.Letter To The Editor:We encourage letters to the

editor but we ask that certain guidelines be followed: Letters may be typed or handwritten, and legible.

Letters must be signed along with a telephone number and address. Phone numbers and addresses will only be used

for verification and will NOT be published. Letters should not exceed 250 words. The

Nifty Pickle reserves the right to refuse to print or, at it’s

discretion, may edit any let-ter. The basic content of the letter will not be altered. All letters must be received by

Monday at Noon and should be sent to Nifty Pickle • 7032 US Hwy 431, Albertville AL

35950 or emailed [email protected].

ENJOY!


There’s something almost magical about shopping at a farmers’ market. I think it’s because all the abundant pro-duce spilling out of the baskets and containers takes us back to our roots.

Ingredients8 ounces lean beef stew, cut into bite-size pieces

2 cups diced raw potatoes1 cup diced carrots

1 cup chopped celery1/2 cup chopped onion

1 (10 3/4-ounce) can reduced-fatcream of mushroom soup

1 (2.5-ounce) jar sliced mushrooms, drained1 tablespoon chopped fresh parsleyor 1 teaspoon dried parsley flakes

Directions 1. Preheat oven to 325 F. Spray an 8-by-8-inch baking dish with butter-flavored cooking spray. 2. In prepared baking dish, combine meat, pota-toes, carrots, celery and onion. Add soup, mushrooms and parsley. Mix well to combine. Cover and bake for 3 hours or until meat and vegetables are tender. 3. Place baking dish on a wire rack and let set for 5 minutes. Divide into 4 servings.

•Each serving equals: 261 calories, 5g fat, 22g protein, 32g carb., 594mg sodium, 4g fiber; Diabetic Exchanges: 1 1/2 Starch, 1 1/2 Meat, 1 Vegetable.

(c) 2014 King Features Synd., Inc.

Farmer’s Fare Stew

What is black when you buy it, red when you use it, and gray

when you throw it away?

The answer is Charcoal.

Why do they call it rush hour when nothing moves?

Robin WilliamsA word to the wise ain’t

necessary - it’s the stupid ones that need the advice.

Bill Cosby

Coat Drive for Children and

Adults in Need Marshall County Craft Club and Boaz Chamber Of Commerce joining efforts in a community project in which our organi-

zation will collect clean, reusable coats and jackets to be dis-tributed free to children and adults in need in our community. We are asking for your support of the First Annual Mar-shall County Craft Club Coat drive.When: September 30th – October 4th 10:00 am – 6:00 pm Where: Alabama Craft Show located in Piper Station, Boaz Al.

Call: 256-996-4945 for directions or information


ALBERTVILLEAlbertville Baptist Church

302 Buchanan RoadAlbertville, Alabama 35950

(256) 878-3933

Corinth Baptist Church4183 Rose Road

Albertville, Alabama 35951(256) 894-3400

Fairview UnitedMethodist Church

1750 Hustleville RoadAlbertville, Alabama 35950

(256) 891-1719

First Baptist Church Albertville309 East Main Street


Mt. Calvary Baptist Church201 Rose Road


Rose Road Church of God804 Rose Road

Albertville, Alabama 35950256-891-7723

I know who the Anti-Christ is! That seems to be the topic of best-selling books and scrolls since the dawn of Chris-tianity. Is it Barack Hussein Obama, or maybe it’s Saddam Hussein? Oh wait he’s dead. But, that really doesn’t seem to matter because I had a friend tell me in great detail how it was John F Kennedy, or at least some clone-type “thing” resurrect-ed from his brain matter. I mean after all, JFK had a mortal head wound and when he was resurrected he would be the Anti-Christ. I think someone had spent too much time surfing the internet. It seems like Christians have a great preoccupation with who the Anti-Christ is. I believe that instead of “who” it is we should be more concerned with WHAT it is. What do I mean what? Well, John wrote in 1Jn 4:3, “This is the spirit of the antichrist, which you have heard is coming and even now is already in the world.” He said the spirit of the antichrist has been working in the earth for over 2,000 years now. Unfortu-nately, most Christians are so busy chasing the latest “revela-tion” of WHO is the Anti-Christ and WHEN is Jesus returning that they miss the big deal of Jesus leaving. In John Chapter 16 we read about Jesus telling his dis-ciples that he was about to leave. As you can imagine, they were pretty panic stricken. Just like many of us would have

been also. He tried to encourage them by explaining that it was a good thing that He went away because He would send back another One, just like Him, The Holy Spirit. John later wrote (1Jn 4) that it is The Spirit of Truth that combats and exposes the spirit of the Antichrist. He said when the Holy Spirit came He would convict the world of sin, judgment and righteousness (Jn 16:9-11), but not how you may have been taught. Not that we are unworthy, but that we’ve been made worthy because of Jesus. Sin, because we are all sinners who need to believe in Jesus as Savior and not our own works. Righteousness, which we’ve been MADE in Christ, not BECOME by being and staying good enough and lastly, judgment, not ours but that the ENEMY has already been judged. So if you don’t think Jesus is needed for salvation or remission of sins, or that you can earn or lose your right stand-ing with God because of your good deeds or lack thereof and that the devil has not already been judged and stripped of his authority then you are NOW being influenced by the spirit of the antichrist (or anti –everything Jesus did on the cross- spir-it) which can be much more destructive to your life than WHO is the person manifesting as antichrist.

ALBERTVILLESolid Rock Church

2073 Section Line RoadAlbertville, Alabama 35950

256-891-1818

The Potter’s House 210 Sand Mt Dr.

Albertville, AL 35950256-298-2378

BOAZAll Saints’ Anglican Church

706 North Main StreetBoaz, Alabama 35957

Belaire Baptist Church1505 Oak Drive

Boaz, Alabama 35957(256) 593-8773

Beulah Baptist Church1991 Beulah Road

Boaz, Alabama 35957256-878-1516

Boaz Church of God115 McGee Street

Boaz, Alabama 35957(256) 593-3689

Thanks For Reading The Nifty Pickle!

BOAZFirst Baptist Church

225 S. Main StreetBoaz, Alabama 35957

(256) 593-8580

Mt. Zion Baptist Church623 County Road 2

Boaz, Alabama 35957(256) 561-3682

Sardis Baptist Church1501 Church Street

Boaz, Alabama 35957(256) 593-7762

GUNTERSVILLEFirst Baptist Church

1000 Gunter AveGuntersville, Alabama 35976

(256) 582-5141

First United Methodist Church539 Gunter Avenue

Guntersville, Alabama 35976(256) 582-2001

GUNTERSVILLEGuntersville Church of Christ

800 Gunter AvenueGuntersville, Alabama 35976

(256) 582-2494

Mount Zion Missionary Baptist1444 Carlisle Ave


The Churchat Lake Guntersville

4525 Wyeth DriveGuntersville, Alabama 35976

(256) 582-5312

Victory Baptist Church1644 O’ Brig Avenue



HEALTH

(StatePoint) If you’re 65 or older, you probably know that the Medicare Annual Enrollment Period runs Oc-tober 15 through December 7. Generally, this is the only time you can make changes to your coverage. According to Herb Fritch, president of Cig-

na-HealthSpring, a leading health service company and Medi-care insurance provider, here are some things to consider: • Determine priorities. Make a list of priorities -- such as lowering out-of-pocket costs -- and use it to compare plans. • Understand the different parts. Part A refers to hospital insurance. The amount of the deductible depends on the length of the hospital stay. Part B refers to basic medical insurance for doctor visits and other health care services. Medicare pays 80 percent of ap-proved charges while you pay 20 percent in addition to a month-ly Part B premium and annual deductible which will vary based on your income. Supplemental plans like Medigap and Medicare Advantage can help cover the 20 percent gap and most offer ex-tra benefits. Part C refers to plans operated by private companies that combine Part A and B benefits. Most include Part D prescription drug coverage, offer no or low monthly premiums, and extras like vision, dental and gym membership benefits. Part D refers to Prescription Drug Plans offering at least a standard level of coverage set by Medicare; some are available as stand-alone plans. • Do your research. Benefits differ from company-to-com-pany and even state-to-state, so do your research. Look beyond premium cost to ensure there aren’t hidden copays or fees that will end up costing you more. Pay close attention to medication quantity limits and make sure your plan offers adequate drug coverage. • Pay your Medicare Part B premium. Even if you’re enrolled in a private Medicare plan, you must continue paying your Part B premium. If you’re having trouble, contact your lo-cal Medicaid office to see if you qualify for a Medicare Savings Program. • Don’t settle. Priorities change, so the plan that worked when you were 65 may not be best when you’re 75. Plans also change year-to-year so review before renewing. • Know your network. Many plans offer choices with a network of doctors. If you visit a doctor out of network, you could be responsible for out-of-pocket costs. However, net-works offered by Medicare Advantage choices, such as Cig-na-HealthSpring, can foster better coordination among doctors, leading to better care. Ask your doctors what plans they accept or check your network directory. • Don’t worry about the Exchanges. With a few excep-tions, Medicare will be a better option than the Exchanges (also called “Marketplaces”). In fact, it’s illegal for someone to sell you an Exchange plan if they know you have Medicare. • Use free resources. The Centers for Medicare & Med-icaid Services’ Plan Finder helps you compare costs, covered medications and other items. Many insurance plans offer free seminars with no obligation to sign up. You can also check com-panies’ websites or call their Customer Service number for more information. Local agencies on aging can also be helpful.

Tips for the 2015 Medicare Annual Enrollment Period

(c) Wavebreak Media - Thinkstock.com



ARIES (March 21 to April 19) Travel plans could be interrupted by the re-emergence of a workplace problem that was never quite fully resolved. Deal with it at once, and then take off on that well-deserved trip.

TAURUS (April 20 to May 20) Aspects fa-vor cultural activities for sensuous Bovines. Attend a concert or an art show. Better yet, create something yourself (a poem, per-haps?), and dedicate it to someone special.

GEMINI (May 21 to June 20) Respect any doubts you might now be feeling about a new situation. They could be reflecting your inner awareness that some essential infor-mation might be missing. Check it out.

CANCER (June 21 to July 22) It’s important to start the new month with as clean a slate as possible. Either complete all those unfin-ished tasks or pass them on to others who would be more than happy to take them on.

LEO (July 23 to August 22) This is a good time to cut down on expenses and tame that urge to splurge. Applying some financial discipline now could help the Big Cat ride out a possible monetary crunch later on.

VIRGO (August 23 to September 22) Mon-ey matters are dominant this week. Recheck your accounts and make sure they’re up-to-date. Also, pay more attention to personal issues before they become major problems.

LIBRA (September 23 to October 22) You might be tempted to employ the same tactics as your adversary, but that could backfire. Better to use the same balanced approach that has worked for you before and could again.

SCORPIO (October 23 to November 21) A changing workplace environment could stir up confusion as well as apprehension. Best to ignore the rumors and get the facts. You could find that the changes bring positive el-ements.

SAGITTARIUS (November 22 to Decem-ber 21) Communication is easier this week with people ready and eager to hear what you have to say. Also, check for possible technical problems before you start your new project.

CAPRICORN (December 22 to January 19) Aspects favor change for the usually tradi-tional Goat. Opening your mind to possibili-ties you had ignored could lead you to make decisions you once considered improbable.

AQUARIUS (January 20 to February 18) Making personal as well as professional adjustments to changing conditions might be easier with more information explaining the “hows” and “whys” of the situations in question.

PISCES (February 19 to March 20) With a growing tide of positive reactions to buoy your confidence, this could be the right time to put the finishing touches to your new project and get it well and truly launched.

BORN THIS WEEK: You have a gift for setting an example of quiet, calm reasoning in the midst of chaotic conditions.


Please Support Your Local Merchants!


HOME & GARDEN

A pregnant woman is in a car accident and falls into deepcoma. Asleep for nearly six months, she wakes up and sees

that she is no longer pregnant. Frantically, she asks thedoctor about her baby.

The doctor replies, “Ma’am, you had twins!A boy and a girl. The babies are fine.

Your brother came in and named them.”

The woman thinks to herself, “Oh no, not my brother, he’s an idiot!” Expecting the worst, she asks the doctor, “Well,

what’s the girl’s name?”

“Denise,” says the doctor.

The new mother thinks, “Wow, that’s not a bad name. I guess I was wrong about my brother. I like Denise!”

Then she asks the doctor, “What’s the boy’s name?”

The doctor replies, “Denephew”

A very successful businessman had a meeting with his new son-in-law. “I love my daughter, and now I welcome you into the family,” said the man. “To show you how much we care for you, I’m making you a 50-50 partner in my business. All you have to do is go to the factory every day and learn the operations.”

The son-in-law interrupted, “I hate factories. I can’t stand the noise.”

“I see,” replied the father-in-law. “Well, then you’ll work in the of-fice and take charge of some of the operations.”

“I hate office work,” said the son-on-law. “I can’t stand being stuck behind a desk all day.”

“Wait a minute,” said the father-in-law. “I just make you half-own-er of a moneymaking organization, but you don’t like factories and won’t work in a office. What am I going to do with you?”

“Easy,” said the young man. “Buy me out.”

The Partners

Oh No, Not My Brother!

Please Support Your Local Merchants!

(StatePoint) A beautiful lawn is im-portant for a lovely home, but when those autumn leaves begin to fall, some extra ef-fort is required to keep things picture perfect. This once meant firing up noisy machinery and piling up bag after bag of yard waste. Now

that we live in more environmentally-conscientious times, this might not seem like such a responsible idea. Doing things by hand doesn’t have to lead to a sore back. Learn-ing some helpful hints can make your lawn really stand out this year and help you get the job done in a breeze. Spring is when the lawn and garden really come into full bloom, but fall is when plants are storing energy and nutrients to have ready when the season turns. Like an athlete training in the offseason, get a step up on the competition by building a good foundation. Now’s the time to fertilize and aerate since roots keep growing and storing energy even when above-ground growth slows during the colder months. Don’t forget to keep watering too! Weeding can be made less painful if you adhere to the old gar-dener’s trick of completing this task after it rains. When the earth is dry, it’s harder to pull out the whole weed without breaking off the top. After rainfall, the ground is soft, making it easier to pluck out entire weeds. They can easily be added to leaves and other debris that needs to be hauled away. Leaves can smother your lawn if enough of them build up, pre-venting sunlight from reaching the grass and increasing the chances of lawn disease. Collecting the leaves in bags allows your lawn to breathe and receive proper sunlight. The average cost to remove leaves is $374. There are easy DIY methods that can save you money. To make your life easier and get the job done faster, consider using tools such as the EZ Leaf Hauler, which acts like a giant dustpan for leaves, and is a cost-effective, green alterna-tive. Reduce waste by packing more leaves into every bag with tools like the EZ Leaf Stomper or using leaves and yard debris for mulch or compost. Good posture can also prevent backaches when raking leaves. Keep your head up and back straight. Relieve back pressure by raking in the “scissors” stance: placing one foot forward and the other back and reversing position when comfortable. Another option is to haul tarps by using pull handles like EZ Tarp Tugger. Opt for ergonomically designed rakes, shears and pruners that re-quire less hand strength and provide a comfortable non-slip grip to help prevent muscle soreness. More information on innovative tools for rak-ing, hauling and bagging yard waste can be found at www.ezlawnand-garden.com Get a head start on home improvement this fall with smart lawn and garden care. Grab the kids and get the clippers, rake ‘em in and bag ‘em up.

Smart Tips to Make FallLawn Care Easier


Thanks For Reading The Nifty Pickle!Please Support Your Local Merchants!

(BPT) - Reading the computer, chalkboard and books are critical elements of getting an education that can lead stu-dents to reaching their full potential and making their goals and dreams come true. Surprisingly, vision disability is the single most prevalent disabling condition among children. In fact, one in four students in kin-dergarten through sixth grade has an un-detected vision problem that can interfere with their ability to read and learn, accord-ing to the American Optometric Associa-tion. While scheduling your children’s doctor and dentist visits before they head back to school this year, it’s important to remember that an eye exam is just as important. The ability to see clearly and comfortably can directly impact children’s performance both in and out of the class-room. Three-time Grammy Award winner Darius Rucker knows first-hand the role that vision plays in seeing and achieving your best: “Vision is such an important part of my life, both professionally and per-sonally,” Rucker says. “And it’s surprising just how many kids don’t receive quality vision care, especially since seeing their best can help them pursue their biggest dreams.” While your children might re-

Why It’s Critical to Make Eye Exams Part of Your Back-to-School Routine

ceive vision screenings in school at the beginning of the year, some of the most common vision issues such as eye coor-dination, lazy eye and farsightedness can only be detected through a comprehensive exam with an eye doctor. Some signs that your child might need a comprehensive eye exam include:•Squinting or rubbing eyes continuously•Complaining about headaches•Holding reading materials too close or too far away•Using fingers to trace words while read-ing•Exhibiting lack of attention or fatigue during school It’s also important to make sure that your children have eyewear that not only enhances their vision, but protects it as well. Consider Transitions adaptive lenses, which automatically change from clear indoors to dark outdoors, blocking 100 percent of harmful UV rays to keep their eyes comfortable whether they are inside for class or outside for recess. “I’ve worn Transitions lenses for years, and always make sure that my fam-ily and I get to the eye doctor regularly so we can all see our best,” says Rucker. Access to quality vision care is important here in the United States, and is even more of an issue worldwide, af-fecting approximately half a billion peo-ple globally. Transitions Optical and Dar-ius Rucker have recently teamed up with OneSight - a nonprofit organization work-ing to provide access to quality eye care and eyewear in underserved communities worldwide. To find out how you can help, visit www.onesight.org. For more information and the op-portunity to experience enhanced vision with Transitions lenses for yourself, visit transitionstrial.com to receive a free pair of Transitions Trial Decals.




Fishing is fun but it requires some skill and timing. Regardless of the type of fish or water, there are some fishing tips that everyone should follow. •Be sure to choose the right lure for the right situation. Not every time of day or area of water will require the same type of lure. Each lure has its own purpose, and is meant for different bass or different loca-tions. It may take trial and error, but this is a very valuable lesson. •Get familiar with the waters you’re fishing in. If you go to one specific location more than another, learn about which areas the bass tend to swim in, and find out which time of day they are most prevalent. Timing is everything when it comes to bass fishing.Ask some experts or seasoned fishermen for advice. People who have been bass fish-ing for a long time will most likely have plenty of good advice to share. Stay tuned next week for more Fishing Tips & Tech-niques!

Fishing Tips & Techniques “Turn saltine crackers into a gourmet party snack. This

recipe is cheap, delicious and requires no cooking! These are really great with chili.”

Ingredients1 2/3 cups vegetable oil

1 teaspoon garlic powder

1 teaspoon onion powder

1/2 teaspoon black pepper

2 (1 ounce) envelopes ranch dressing mix

3 tablespoons crushed red pepper flakes

1 (16.5 ounce) package multigrain saltine crackers

Directions Place the vegetable oil, garlic powder, onion pow-der, black pepper, ranch dressing mix, and crushed red pep-per flakes in a 2-gallon plastic zipper bag. Seal the bag and smoosh with your hands to thoroughly combine the oil and spices. Place the crackers into the bag, seal, and turn the bag over to cover the crackers with the spice mix. Let the bag sit for about 1 hour, then turn again. Repeat several more times until the crackers are well-coated with spice mix, and allow the bag to sit overnight. Remove crackers and serve.

Alabama Fire Crackers


A Computer Tablet Made for Seniors

If you’re still wary of using com-puter technology because of the compli-cations, or if you use the computer at the library because the cost keeps you from having your own, AARP has good news for you -- the RealPad tablet, specifically designed for seniors.

Here are a few things that make the RealPad good for hesitant seniors:

There’s an intuitive interface to help you send email and photos, browse the Internet and even have video chats. It comes already loaded with apps (applica-tions, or programs) and tutorial videos on how to use the touch screen, browse the Internet and set up a video call or email.

The RealQuick Fix feature has one button that helps you view the status of your tablet and identify what might be wrong (for example, if your WiFi goes out) and fix it with one click.

Customer service is 24/7 -- and free. Call the toll-free number, and you’ll get help with any questions.

The price is $189, and it includes a year membership in AARP (or a year extension on a current membership), plus a one-year limited warranty on the tablet.Here are some of the things that stand out on the list of specifications:

•powered by an Intel Atom processor, which means it’s fast.•a 7.85-inch touch screen•WiFi (You’ll need WiFi in your home, or use a free one in stores, libraries and many other places.)•front- and rear-facing cameras (front for your video chats and rear for your own photos)•16 gigabytes of storage•built-in speakers

RealPad was available to pre-or-der early in September, and it will be in Walmart stores in mid-October. To see the RealPad, go online to www.aarprealpad.org.

Matilda Charles regrets that she cannot personally answer reader ques-tions, but will incorporate them into her column whenever possible. Send email to [email protected].


(BPT) - Kathy Hesselgrave’s 90-year-old mother’s health declined to the point where she was no longer able to live in her home by herself. Because her mother need-ed help cooking and taking her medication, Hesselgrave found herself taking care of her mom, splitting the days and nights with her niece. Other family members pitched into help, too, but it became too much. “We didn’t have the money in the bank for her to move into assisted living,” says Hesselgrave, who lives in Sussex, Wis. “So we worked with a company that helps in this kind of situation and took a loan against her home to help pay for care until her house is sold.” Hesselgrave’s situation is becoming common among the “sandwich generation” - middle-aged Americans who are caring for their parents and their children. This year, the youngest baby boomers turn 50 and, according to the U.S. Census Bureau, peo-ple 65 and older are expected to represent 20 percent of the population by 2030, near-ly a two-thirds increase in percentage from 2010. As America’s “silver tsunami” draws near, more seniors and their children are searching for options to pay for retirement living and quality care. “When making plans for the future and looking for a senior living community that’s right for you or your loved one, it’s im-portant to find a community that will work with you and care about your unique needs and abilities,” says Greg Richard, chief op-erating officer of Brookdale, a leading se-nior living company that operates more than 1,100 communities in 46 states. “Finding a community that will partner with you and help find solutions to financial, social and health care needs makes a transition easier and more enjoyable.” Even with the best financial plan-

Easy Ways To Make Senior Living Affordablening, seniors and their families are looking for a creative, smart and advantageous way to pay for retirement living and quality care in the future. Most don’t think they can af-ford living in a retirement or assisted living community, until they find out that a wide variety of financial options is available to them. For instance, for veterans who need assistance, the Department of Veteran’s Af-fairs offers benefits in addition to a monthly pension through the Veterans Aid and Atten-dance Program. This support allows veterans and their surviving spouses who require a caregiver to assist in various aspects of daily living - including eating, bathing, dressing and medication dosing - to receive money to help pay for long-term care in their own home, a skilled nursing community or an as-sisted living community. The benefit is not dependent upon service-related injuries. A veteran married to a non-veteran is eligible for approximately $2,000 per month while a married couple who are both veterans is el-igible for nearly $2,800 per month. Benefits are also available to veterans who are inde-pendent, but who have an ill spouse. Veter-ans can get monthly financial assistance not only for themselves if they need care, but also for a spouse who needs assistance. Richard says that Brookdale part-ners with several companies that offer re-verse mortgage loan options, life insurance solutions and home equity loans. Financial counselors are available to assist seniors and their families in determining the best financial option to help pay for home care, assisted living or retirement community needs. Many of these companies, like El-derlife Financial Services, can get families the money they need in less than 24 hours to help with funding gaps. Others, like Life Care Funding Group, can take an existing life insurance policy and set up a long-term care benefit plan. “Planning for the future is diffi-cult, especially for those of us who didn’t start saving early enough during our main bread-winning years,” says Richard. “Re-gardless of your age, it’s never too late to research the financial options available for your future or your loved one’s needs.”


Train up a child in the way he should go: and when he is old, he

will not depart from it.Proverbs 22:6

If we confess our sins, He is faithful and just to forgive us [our] sins, and to cleanse us from all unrighteousness.

1 John 1:9

for Reading The Nifty

Pickle!

10. Promises to improve foreign relations with Hawaii.

9. Runs a series of attack ads against MartinSheen’s character on “The West Wing.”

8. His #1 choice to work on his cabinet is “That Bob Vila guy.”

7. Outstanding record as Governor of Texasnullified by the fact that no one really cares.

6. Got his degree in Political Economics by bribing Sally Struthers with a chocolate do-nut.

5. Anybody mentions Washington, he asks, “The state or the DC thingie?”

4. At the debates, answers every question with a snarled, “You wanna wrestle?!?”

3. Vows to put an end to the war in Pokemon and free the Pikachu refugees once and for all.

2. Says the Pledge of Allegiance as quickly as possible, then shouts, “I win!”

..and the Number 1 sign your presidential candidate Is under-qualified..

1. On the very first question of the debate, he attempts to use a LIFELINE.”

Top 10 Signs That the Candidate isUnderqualified

Answer to question on page 2: Sure you can - Yesterday, Today, and Tomorrow!



Wordsearch ContestWin a $50 Gift Card... Find the Advertisers listed below and tell us which page that their ad was found. Mail this entire page to us at 7032 US Hwy 431 • Albert-ville, AL 35950. Deadline is October 6, 2014. (Date of Puzzle: September 25, 2014)

Find these names:alabamacraftshowboazharvestfestivalbottomlinewebdesignbrigittesclothingconstantvaultcustompestcontrolfullcolorprintingincarerxmcclendonauctionhousemcclendonwholesaleniftypicklevarietypigglywigglyqslowsmokedsandmountainpesttradebankwlcaccounting

HOW TO PLAY: On this entry form you will find some of the businesses ad-vertised in this issue. Simply browse the Nifty Pickle, look-ing for these advertisements. When you find them, record the page number on which you found their advertisement in the space provided on this en-try form. Then, find and circle that business name in the word search puzzle. Once you have located all of the advertisers listed, complete the entry form and mail this entire page to the address shown above. Your entry must be re-ceived by October 6, 2014. We will then draw one entry from the group of correct entry forms and announce that win-ner in the October 9th issue. Incorrect or incomplete entry forms will be disqualified. All decisions by Nifty Pickle, Inc. are final. There will be only one winner for this contest each week. GOOD LUCK!

Name:________________________Address:________________________City, State, Zip________________________Telephone:________________________Email Address:________________________

Page Numbers:________________________________________________________________________________________________________________________________________________________________

The Winner of the September 11thWordsearch Puzzle Contest is

D. Williams of Boaz. Congratulations!


Would you like to seeyour pet featured in the Nifty Pickle?

Jot down some information about your pet (name, personality, some-thing funny, tricks it can do, etc.) and send it along with a photo to Nif-ty Pickle Pet Pix, PO Box 1161 Guntersville, Alabama 35976, email to [email protected] or bring it by the office at 7032 US Hwy 431 in Albertville (next to Merle Norman).

After reading about She-ba and cousin Gracie, I thought I would write in and introduce myself, one of their other cousins. My name is Joy Owens and I’m a Miniature Schnau-zer. I’m a real lady... I don’t get on furniture or all the others things dogs do. I don’t like thunder

and lightning... they make me get under the bed. But other than that, I can’t complain. Life is good! Just ask my daddy and mama.

My Name Is Joy


ACCOUNTING, PAYROLL, CONSULTING, BOOKKEEP-ING and Much More. Call James at WLC ACCOUNTING 256-673-8190. 7032 US Hwy 431 in Albert-ville... 3 Doors Down from The Nifty Pickle Variety Store.

ALABAMA CRAFT SHOW Selling Year Around Crafts hand-made by local artists. Custom or-ders welcome. Piper Station, Boaz. 256-996-4945.

ALASOLD AUCTION 10040 Hwy 431 North in Boaz. Tuesday and Friday Nights. Doors Open at 6pm. Sale starts at 7pm. Every Tuesday is Open to ALL Sellers. For more information, call 256-477-3914.

BOTTOMLINE WEB DESIGN Web Sites starting at ONLY $29.95 per month. Call 256-673-8190.

BRIGITTE’S CHILDREN’S CLOTHING 403 Martling Road, Albertville. 256-744-8404 or 256-506-5853. Family owned business Specializing in Boys and Girls Clothing Sizes Newborn to 14.

CUSTOM PEST CONTROL Termite and Pest Services. We Guarantee Our Service! No Con-tract, No Commitment... Just Dead Bugs! 256-593-6613

McCLENDON AUCTION HOUSE Returns and Shelf Pulls from ALL Major Box Stores. Open Monday - Saturday 9am until 5pm. Sale on Saturday and Thursday at 6:30pm. 702 Chastain Blvd West, Glencoe. 256-492-5333.

McCLENDON WHOLESALE Buy It By The Pallet. Returns and Shelf Pulls from All Major Stores. Great for Auctions, Trade Day, Yard Sales, etc. Open Tuesday - Friday 9am until 4pm. Claybrook Road in Albertville. Call Charlie at 256-477-3914 for more informa-tion.

NIFTY PICKLE VARIETY STORE 7020 US Hwy 431 in Al-bertville, 2 doors down from Ace Hardware. Merchandise Added Daily. We Buy, Sell and Trade. 256-673-8190

PIGGLY WIGGLY of ALBERT-VILLE, BOAZ & GUNTERS-VILLE Shop Piggy Wiggly for Great Specials, Everyday Low Prices, Fresh Meats and Produce and Delicious Deli Bakery Items! Save Even More with the Coupons found in The Nifty Pickle!

Q SLOW SMOKED BBQ 106 South Main Street in Old Down-town Boaz. If you love BBQ, then you will love REAL Q-slow-smoked with natural hardwoods. 256-281-9699. See our ad and cou-pon in this issue.

SAND MOUNTAIN PEST MANAGEMENT Got Bugs? Call Sand Mountain Pest Management at 256-891-7400 and start protect-ing your house from unwanted pests. Be sure to see our coupons in this issue of The Nifty Pickle.

TRADEBANK The Smarter Way To Barter®.Save Cash on Business and Personal Expenses. See our Ad in this issue or call JW at 256-673-8190.

HEADBOARDS and FOOT-BOARDS. ALL Sizes and Styles. Prices range from $18 to $40 for a set. These can be seen at the ware-house in Albertville. Call JW at 256-673-8190.

BED FRAMES/RAILS. ALL siz-es. Prices start at $10. These can be seen at the warehouse in Albert-ville. Call JW at 256-673-8190.

DUNE BUGGY. Needs to be completed. Big Boy Frame, Brand New Tires, New Seats, New Gas Tank and much more. $3000 obo. Call James at 256-673-8190.

OUTSIDE SALES Representa-tive, Graphics Designer, Editori-al Specialist. Mail Your Resume and Salary Requirements to Nifty Pickle, 7032 US Hwy 431, Albert-ville, AL 35950.

Dune Buggy For Sale!

$3,000 obo256-673-8190

New Seats, New Gas Tank, New Tires and

Chrome Wheels and much more.

2 FREE MIXED PIT BULL-DOGS. 3 months old. Need good home. If you get both dogs, I will throw in a bag of dog food. Call Clint at 256-571-6123.

OFFICE SPACE FOR RENT Located on Hwy 431 in Albert-ville. Starting at $150 per month. Utilities Included (Power, Water, Garbage) Telephone and Internet would be up to the renter. Great location with plenty of parking. Shared reception and kitchen with refrigerator and microwave. Call James at 256-673-8190.

HOUSE FOR RENT 3 BR / 2 Bath Brick Home with carport and large yard outside Boaz in Mt. Hebron area. $500/month. Refer-ences and Deposit Required. Call 256-558-4499 after 5pm please.

CLASSIFIEDS: $5 each week for 30 words or less. 10¢ each additional word. Mail your ad and payment to Nifty Pickle, 7032 US Hwy 431, Albertville, AL 35950 or you can come by the office located at that address. The dead-line is every Monday at Noon.


Date post:	04-Apr-2016
Category:	Documents
Upload:	james-webster
View:	223 times
Download:	3 times

Nifty pickle 09 25 14

Documents