Template Detection forTemplate Detection for 3D Structure Prediction3D Structure Prediction
Michael Tress Michael Tress
CNIOCNIO
The growth of known sequences and structures
Why are structures so far behind?
Sequencing millions of DNA sequences is relatively easy, while the experimental determination of a single protein structure takes1-3 years
Small targets
Closing the Gap
In its simplest form all that is necessary to build a 3D structural model for a sequence with unknown structure (the query or target sequence) is a similar protein with known structure (a template).
Since experimental techniques for determining protein structure are relatively slow and expensive, modelling is a way of extending the set of known 3D structures.
Comparative modelling steps
Template DetectionFind a sufficiently similar structural template(s) from the PDB, by sequence search (BLAST, HMM, PSI-BLAST or by structure-based techniques (hybrid, fold recognition etc.).
Alignment All template detection methods generate alignments and alignments can be edited.
Model BuildingCan be the simple transference of PDB coordinates but most programs have more complex all atom modelling.
EvaluationMost methods assess model quality, whether the model 3D structure is protein-like.
MRGKVVVE: :::.:.MVGKVTVN
Template Detection
MREYKLVVLGSGGVGKSALTVQFVQGIFVDEYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINR
??
?
Given a new sequence one fundamental question is "into which structure will it fold?"
In Fact Protein Structure is Highly Conserved
Early comparisons of the 3D structures of homologous proteins showed that structure is rarely affected by small changes in protein sequence.
For example, these two structures have only 20% sequence identity.
Even large sequence shifts may have little effect on the backbone structure.
The fact that structure is highly conserved means we can reliably predict structure based on homology
Structural space(more limited)
Sequence space(more diverse)
Comparative Modelling TargetRemotely Homologous Target
So we can make predictions for unknown sequences simply by searching databases of known 3D structures.
IWLKDFIAVGQILPESQWND-SSIDKIEDRDFLVRYACEPTAEKFVPIDI
IWLKDFIDIAEVYNAKKWAQ-VRQSVNKERNFLVRYVCEPVAENFVPVDI
LQLFNFIRVANVMDGSKWEV-LKGNVDPERDFTVRYICEPTGEKFVDINI
IYLRDLQFVANIKNEKEYLDSVNEGKMDSNMFLCRSACLPSGTNLADLDI
IKLEQIIDKAKVLNQTEWNLLSTTDKGYETTYFLRYACEPSSSNFVAIDI
VKFIDFIRPINVLSESQFADVVIDESNSHSTFLVKRATDNEGNFSDIFDY
All these different sequences fold the same way
Even remotely related sequences can have similar folds
The development of template detection methods that use structural information (fold recognition etc.) came from the observation that even proteins with apparently unrelated sequences had very similar 3-dimensional structures.
Template Identification
Template DetectionA database search program such as FASTA or BLAST is usually sufficient to detect structural templates from a search of the sequences in the PDB database.
This should always be the first step because the results of this search will condition the approach.
DomainsMany proteins are made up of several structural domains. This complicates searching for templates. A domain search should be carried out at the same time as the sequence search.
Domain orientation is often not conserved between homologous proteins.
Multiple TemplatesUsing more than one template can be advantageous.
Detecting Remote
Templates
Similar PDB Template ExistsIf a similar PDB structure (or structures) is found from the search with BLAST, you can move on to the comparative modelling step (after checking the alignment).
No Similar PDB Template ExistsIf no template can be found for a domain, more work will be needed, particularly with the alignment.
The predictor may also have to use more complex sequence search methods (PSIBLAST, FFAS, HMMs) or fold recognition techniques.
If the sequence identity between the target sequence and the nearest template falls below 25 or 30%, homology models are less likely to be successful.
Pairwise sequence search methods detect folds when sequence similarity is high, but are very poor at detecting relationships that have less than 20% identity.
No Template Found by BLAST?
Structural space(more limited)
Sequence space(more diverse)
Comparative Modelling Target
Remotely Homologous Target
The relationship between sequence and structure space applies to more distant folds too
Hybrid and fold recognition techniques can find folds that sequence based methods cannot because they use structural information as well as sequence similarity to evaluate templates..
Advanced Sequence-Based and Hybrid Techniques
PSIBLASTThe more sequences in an alignment the more likely the alignment is reliable. PSI-BLAST uses multiple alignments (profiles) to search for templates.
Profile methods can be as accurate as many fold recognition techniques at detecting remote homology and expert users can usually spot biologically meaningful templates from careful analysis of low-scoring hits.
Hidden Markov Models Hidden Markov models regard the sequence as a series of nodes, each node corresponding to a column in a multiple alignment.
HMMs are very similar to profiles.
META-PROFILES (Hybrid methods)Coincidence of real and predicted secondary structure and accessibility also generally improves alignments. Hybrid methods are profile-based methods that include predicted secondary structure.
Adding structural information to the profiles helps find distant but structurally similar homologues.
Profile-Profile Searching MethodsProfile-profile alignment methods use evolutionary information in both query and template sequences. As a result, they are able to detect remote homologies beyond the reach of other sequence comparison methods.
More Advanced Sequence-Based and Hybrid Techniques
Hybrid and Sequence-Based Servers
SAM T02 - www.cse.ucsc.edu/research/compbio/HMM-apps/T02-query.htmlThe query is checked against a library of hidden Markov models. This is a sequence based technique, but it does use secondary structure information.
Meta-BASIC - at bioinfo.plMeta-BASIC is based on consensus alignments of profiles. It combines sequence profiles with predicted secondary structure and uses several scoring systems and alignment algorithms.
FFAS – ffas.ljcrf.edu/ffas-cgi/cgi/ffas.plFFAS03 is a profile-profile alignment method, which takes advantage of the evolutionary information in both query and template sequences.
HHPRED – toolkit.tuebingen.mpg.de/hhpredHHpred is based on the pairwise comparison of profile hidden Markov models. It searches domain databases, like Pfam or SMART instead of single sequences and is meant to be as easy as BLAST, but more sensitive at finding remote homologues.
MREYKLVVLGSGGVGKSALTVQFVQGIFVDEYDPTIEDSYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINR
?
Fold Recognition
When fold recognition methods were first developed it was thought that they could detect analogous, proteins – those that were structurally similar but with no evolutionary relationship.
In fact most of these predictions were later shown to be homologous (have an evolutionary relationship) once advanced sequence comparison methods, such as PSI-BLAST, were developed.
Fold recognition methods are used because they allow you to find more distant templates.
There is also research to show that no single method can always find the correct identify a fold, so it is often advantageous to use more than one method.
In fold recognition we are asking the opposite to the question we asked
earlier: “given a known protein structure, does the target sequence
fit?”
Fold recognition methods have built in fold libraries
Fold recognition methods work by superimposing the target onto a database of known 3D structures (folds) and evaluating the sequence-fold alignments.
Each method has its own non-redundant database of folds to save calculation time.
Here you start with the query sequence …
Align the sequence with all folds from the library.
(Fold recognition programs use a library of folds …)
Evaluate the fit between the target and all the structures
Fold recognition – a summary
Instead of aligning two sequences … LKRPMT ...
Evaluate whether this would be a good structure (secondary structure, accessibility, contacts)
FRIPLN ...
L
R
K
P
Take the template structure …
F
I
R
P
R
P
I
L
Align the target sequence with the template structure …
Align again …
Evaluation Sequence-Structure Fit
Scoring Functions
Scoring functions for evaluating the sequence-structure fit can include any or all of the following:
●The similarity between the usual and observed residue structural environment
●Pair potentials
●Solvation energy
●Coincidence of real and predicted secondary structure or accessibility
●Evolutionary information (from aligned structures and sequences)
Fold Recognition Servers
3D-PSSM - www.sbg.bio.ic.ac.uk/~3dpssm/Based on sequence profiles, solvatation potentials and secondary structure.
mGenTHREADER - www.psipred.net/Combines profiles and sequence-structure alignments. A neural network-based jury system calculates the final score based on solvation and pair potentials.
RAPTOR - software.bioinformatics.uwaterloo.ca/~raptor/Best-scoring server in CAFASP3 competition in 2002. ACE server (based on Raptor) best FR server in CASP6. You have to ask to use it first ...
SPARKS2,3,4 - http://sparks.informatics.iupui.edu/Top servers in CASP 6. Sequence, secondary structure Profiles And Residue-level Knowledge-based Score for fold recognition
Consensus Fold Recognition
No one method can hope to correctly identify every fold. In fact the best predictions are often when server predictions agree.
Human experts have recognised this, and generally they are better at fold prediction than machines.
Human experts usually use several different fold recognition methods and predict folds after evaluating all the results (not just the top hits) from a range of methods.
So why not produce an algorithm that mimics the human experts?
The first consensus server, Pcons, sent the target sequence to six publicly available fold recognition web servers.
Predictions were structurally superimposed and evaluated for their similarity. The best model was predicted from similarity to other predicted models.
Consensus Fold Recognition Servers
3D Jury - http://bioinfo.pl/meta/3D Jury is a consensus predictor that utilizes the results of fold recognition servers, such as FFAS, 3D-PSSM, FUGUE and mGenTHREADER, and uses a jury system to select alignments and templates. Models are built with Modeller.
GeneSilico - http://genesilico.pl/meta/A gateway to various methods for protein structure prediction. Domains are identified by HmmPfam, and there are several methods for secondary and tertiary structure (FR) prediction. Consensus predictions are made with the Pcons consensus server and you can also send a subset of alignments to the FRankenstein server.
Pcons - www.sbc.su.se/~arne/pcons/Pcons was the first consensus server for fold recognition. It is built into both the main consensus servers, but now can be used on its own once again.
Alignments
Alignments
TARGET FLGAAQIMPDDQFEKSSLDKIRDN--IVRIAMDPSSDKFLAMDIFNV--RGRELEEFLKKLS |....||.|..|...||.|||.|. .||.|..|...||...|||.. |..|..|.||..|TEMPLATE FIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMDEYLKRVS
The quality of any comparative model depends mostly on the alignment between the target and template sequences.
TARGET FIALGQILSESQYQDSSIDKIEDRDIIVRYGCEPTADKFVPIEIFQILRRVKEMDEFLKRVS |||.||||.|||..|||||||||||..|||.|||||.|||||.||||.||||||||.|||||TEMPLATE FIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMDEYLKRVS
Generally, the alignment is more likely to be correct if there is high sequence similarity and few gaps between the two sequences ...
… aligning two sequences becomes more complicated and less reliable when % identity falls and gaps are introduced.
Alignments come free, but are not always reliable
1aac DKATIPSEPFAAAEVADGAIVVDIAKMKYETPELHVKVGDTVTWINREAMPHNVHFVAGV : ... . :. .. :. ... : ..:::. :1plc IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDS
1aac L--GEAALKGPMMKKE------QAYSLTFTEAGTYDYHCTPHPF--MRGKVVVE . : : : : ... ... ..... : :...:.:: : :::.:.1plc IPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
All methods of template detection, whether sequence-based, fold recognition or hybrid generate alignments between the query sequence and the PDB template sequence as a side effect of the search.
If an accurate 3D model is to be built, it is vital that the target-template alignments are correct. Particularly at lower percentage identity the biggest errors stem from the alignments.
Alignments from sequence-based methods are not always reliable - they are usually biased towards sequence evolution not structure. Fold recognition alignments are not any more reliable.
Multiple Alignments
Generally the more evolutionarily related sequences in an alignment, the more likely the alignment is reliable.
For that reason most people generate alignments with multiple sequence alignment programs or profile-based methods.
Since the alignments are for the purposes of generating structures, it is important to take into account structural information such as the coincidence of real and predicted secondary structure and accessibility.
Alignments should be edited manually using actual and predicted secondary structure and accessibility information, and careful placement of gaps.
MREYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRDLYMKNGQGFVLQINKK-KSFKVVLLGEGCVGKTSIVFRYIDNIFNDKHLMTQHAGFFKHINIGGKRICLTIWDTAGQERFHALGPIYYRGSQGALLTRRM----LKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEPNGQIIELALWDTAGQEEYSRLRPLSYTNADVLMVIHTLLS---IKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREGTVGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLDLIMK--TFKVLLVGDSGVGKSCILTRFTSGIFEESTTSTIGVDFKKYLTADGKRCKLTIWDTAGQERFRTLTSSYYRGAQGIIFVLKILQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLVRVIRKMQSIKLVVVGDGAVGKTCLLISYTSNSFPTEYVPTVFDNYSANVMVDNKTVSLGLWDTAGQEDYDRLRPLSYPQTDVFLICAV------FKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFARSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVEIYR----KLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIAKRLP---YKIILVGESGVGKSSILVRFTDNTFSQHFAPTLGVDFNVKTIETGQTVKLQLWDTAGQERFKSITQTFYRGSHGVIVVYIEA
Sequence Alignment vs. Structural Alignments
PHE ASP ILE CYS ARG LEU PRO GLY SER ALA GLU ALA VAL CYS TEMPLATE | . . | | | | | . | PHE ASN VAL CYS ARG THR PRO --- --- --- GLU ALA ILE CYS TARGET (ALIGNMENT 1) PHE ASN VAL CYS ARG --- --- --- THR PRO GLU ALA ILE CYS TARGET (ALIGNMENT 2)
"Alignment 1" may be chosen because of the PRO at position 7. But the 10 Angstrom gap is too big to close with a single peptide bond.
Simplified Protein Structure Simplified Protein Structure Prediction Flow ChartPrediction Flow Chart
Simplified Protein Structure Simplified Protein Structure Prediction Flow ChartPrediction Flow Chart
Acknowledgments
Ana Rojas
Florencio Pazos
Lawrence Kelley
Arne Eloffson
and anyone else whose figures I
used ...
✤ CASP6✤ Osvaldo Graña✤ Iakes Ezkurdia✤ Gonzalo Lopez✤ Alfonso Valencia
✤ CASP7✤ Osvaldo Graña✤ Iakes Ezkurdia✤ Gonzalo Lopez✤ Alfonso Valencia✤ Ana Rojas✤ Txema G. Izarzugaza