+ All Categories
Home > Documents > TradeZone Caliper 140 Oct - Nov 2014

TradeZone Caliper 140 Oct - Nov 2014

Date post: 04-Apr-2016
Category:
Upload: tradezone
View: 240 times
Download: 0 times
Share this document with a friend
Description:
TradeZones awesome deals for October and November
Popular Tags:
20
ENGINEERING CONSUMABLE SPECIALS TradeZone proud sponsors of Proud sponsors of SUPPLIERS TO INDUSTRY WWW.TRADEZONE.CO.NZ Valid from 1st October to 30th November 2014 • VOL 140 ould WIN a 2014 Mahindra Genio rth T X T 2 W I N ! WIN A Tradies UTE $24,999 YOU COULD WIN A 2014 MAHINDRA GENIO DOUBLE CAB DIESEL TURBO UTE Worth $24,999.00. To WIN this UTE...purchase ANY TengTools set, then text your code to 360. Buy any POWERBUILT product at participating stores and go into the draw to win the ULTIMATE SHIMANO FISHING KIT Worth $900. (1 prize per participating TradeZone Store) TWO CHANCES TO WIN EVERY ENTRY ALSO GOES INTO THE MAJOR PRIZE DRAW TO WIN A GONE FISHIN FISHING TRIP WITH GRAEME SINCLAIR (Available at participating TradeZone stores) TWO CHANCES TO WIN
Transcript
Page 1: TradeZone Caliper 140 Oct - Nov 2014

EnginEEring ConsumablEspECials

TradeZone proud sponsors of

Proud sponsors of

SUPPLIERS TO INDUSTRY

WWW.TRADEZONE.CO.NZ

Valid from 1st October to 30th November 2014 • VOL 140

YOU could WIN a 2014 Mahindra Genio

Double Cab Diesel Turbo Ute worth

To WIN this UTE...purchase ANY TengTools set*,

then text your code to 360.

TXT 2 WIN!WIN A Tradies UTE

You will receive one (1) unique code

per qualifying TengTools set or tool box

purchased. The more times you purchase

a TengTools set the more times you can

enter. Each code can only be used once.

How to EntEr:

• Duetothenatureoftheprizeyoumustbe16years

oldorovertoenter,andhaveavalidNZDrivers

Licence.

• Toenterthedrawyoumustpurchaseaqualifying

TengToolsproduct.

• Yourretailerwillaffixauniquetxtcodeorcodesto

yourinvoiceorreceipt.

• Text‘UNIQUE CODE’space‘YOUR FULL NAME’to ‘360’

• (i.e.‘UN1QU3BOBSMITH’).

• Youmustretainandpresentyourinvoice/receiptwithuniquecode(s)affixedasproofof

purchasetovalidateyourentryshouldyoubedrawnasthewinner.

• PromotionopensMonday1September2014&endsSaturday28February2015.

• Nofreetext,standardtextchargesapplywhichmayvarydependingonyourTelcoprovider.

PrizE DEtails:

• Oneprize,Onewinner.

• Theprizeisa2014MahindraGenioDoubleCabDieselTurboUte**

• TotalpackageisworthRRP$24,999.

• Fullvehiclespecificationavailableinstoreorvisitwww.mahindraauto.co.nz.

*Someexclusionsapply.Forfulltermsandconditionsvisitwww.tengtools.co.nz/txt2win-ute orviewatyour

TengToolsparticipatingretailer.

**Theprizewillberegistered,withchangeofownershiptowinnersname/businessandwarranted(nolessthan

6months),withupto5000kmontheodometer.Minimum3000kmofRUCwillbeincludedplusafulltankofdiesel.

Scan the code to view

‘How to Enter Video’.

Promoter: ISL Industrial Ltd www.isl-industrial.co.nz

$24,999You CoulD Win a 2014 maHinDra gEnio DoublE Cab

DiEsEl Turbo uTE Worth $24,999.00.

To WIN this UTE...purchase ANY TengTools set, then text your code to 360.

buy any poWErbuilT product at

participating stores and go

into the draw to win the

ulTimaTE sHimano

fisHing kiTWorth $900.

(1 prize per participating

TradeZone Store)

TWO CHANCES TO WIN

EVEry Entry

aLsO gOEs intO

thE majOr

prizE draw

tO win a

gOnE fishin

fishing trip

with

graEmE sincLair

(Available at participating

TradeZone stores)

TWO CHANCES TO WIN

Page 2: TradeZone Caliper 140 Oct - Nov 2014

WELDING

Power Supply 415 -3 +/- 15%Wire Feeder Type Gear Driven 4 RollDuty Cycle @ 40°c 40% @ 500AmpsCurrent Range MIG 40A - 500 AmpsCurrent Range MMA 20A - 500 Amps

• Industrial 500 Amp Power Source • 10m Long Interconnecting Cables • Control Settings at the Wire Feeder• 4 Drive Roll Separate Wire Feeder• Digital Meters• Crater Current Setting• 2/4T Trigger Function• Trolley with Accessory Drawer

WARRANTY$4,975.00 GST Incl.

$4,32609+GST

XA-MIG500SWF-SP

XA-MIG500 AMP WELDER M.T.S MIG-TIG-STICK INVERTER

500AMPS OF PURE GRUNT

TIG TORCH IS OPTIONAL & EXTRAC/w Mig Torch, Arc Set & RegulatorCompliant to AS/NZ 60947 Standard

$1,429.00 GST Incl.

$1,24261+GST

TIG -HF Arc Ignition - Stick (MMA) 2T/4T Trigger - Pulse SelectDown Slope - Post GasRemote Amp Control Select

XA TIG180PR Machine XA17x8m Torch + Spares Earth Lead & Arc LeadArgon Flowmeter

XA-TIG180P DC TIG/HF INVERTER PULSE WELDER180AMP, 230VOLT SINGLE PHASEINDUSTRIAL DC TIG INVERTER

PACKAGE DEAL:Compliant to AS/NZ 60947 Standard Input power voltage 230V±15%

Rated power 10.8KVAMMA current range 10-200AMIG current range 30-250ADuty Cycle @ 25°c 70% @ 250AOutput voltage range 15.5v - 26.5VSize (mm ) ( L×W×H ) 620x290x500 Weight 35Kg

PORTABLE 250AMP - 230 VOLTMIG- GAS & GASLESS 5 &15Kg SPOOL CAPACITY SPOOLGUN CONNECTIONLIFT ARC DC TIG MMA STICK ELECTRODE

$1,949.00 GST Incl.

$1,694 78+GST

C/w Mig Torch, Arc Set & RegulatorTIG TORCH IS OPTIONAL & EXTRA

New Generation Technology Razorweld

RAZOR205 MIG/TIG/MMA

MIG/TIG/STICK

200 AMP - 230V - 5KG SPOOL MIG/TIG/STICK - LIFT ARC TIG

Power Supply 230v - 1Ph Duty Cycle @ 40°c 20% @ 200ACurrent Range MIG 30 - 200ACurrent Range TIG/MMA 10- 165ARated Power 9.4 KVADimensions (mm) 470x190x380 Weight 18kg

POWERFUL & PORTABLE

C/w Mig Torch Arc Set & Regulator

• MIG - Gas/Gasless• MIG - Spool Gun Ready • TIG - Lift Arc Ignition• TIG - Trigger Control • MMA - VRD• MMA - Hot Start• Hot Start Electrode • AS/NZ 60947 Certified

MACHINE &GEAR CARRY

BAG

New Generation Technology Razorweld

• 240V Single Phase• Duty Cycle 40%@200Amps• Hot Start• Anti Stick• Arc Force• Generator Compatible (7KVA)• DC TIG Welding Lift Arc Ignition• Compact (365 x 227 x 135mm)• Light Weight 6.5 Kgs)

RAZORWELD ARC200RZ PFCMMA/TIG 200A DC INVERTERPOWER FACTOR CORRECTIONMMA - Stick ElectrodeVRD SafetyDC TIG - Lift Arc

C/w Arc Set & Carry Bag$849.00 GST Incl.

$73826+GST

• 170 Amp 230V, • Electrode Hot Start • Adjustable Arc Force • Tig Lift Arc - Soft Start • 60% Duty Cycle • 10 -170 Amps • Weighs 5.2 Kg • Generator Compatible

MMA/TIG DC INDUSTRY BENCHMARK INVERTERPERFORMANCE PROVEN!RELIABILITY CONFIRMED!

C/w - Arc Set 4m, Carry CaseTig Torch is optional and extra

XA-ARC170 PRICE SMASH DEAL!

$592.00 GST Incl.

$51478+GST

Compliant to AS/NZ 60947 Standard

NEW!BRAND NEW! 200AMP!

Tig Torch is Optional & Extra

XA-MIG205RZMTS-SP

MONTH 24Machine Warranty

XA-ARC170-SP

WARRANTY

MONTH 24Machine Warranty

Tig Torch is Optional & Extra

XA-ARC200RZ-SP

XA-MIG250C SUPER PRICE DEAL!

XA-MIG250C-SP

WARRANTY

$1,849.00 GST Incl.

$1,60783+GST

XA-TIG180PR-SP WARRANTY

WELDERSTEE

SHIRT

Caliper 140.indd 1 29/08/14 2:03:10 p.m.

WELDING

2

Page 3: TradeZone Caliper 140 Oct - Nov 2014

WELDINGWELDINGWELDING

WELDING SCREEN FRAME & WELDING CURTAINSLAVAshield welding screens meet NZ OSHA standards. Screens are

transparent and resistant to UV rays, flame and abrasion. Kevlar sewn with grommets placed at 270mm intervals.

Size: 1.8m x 1.8m

XA-55-8166

XA-55-6466

$99.00 GST Incl.

$86 09

$115.00 GST Incl.

$100 00

XG-PH01-8A

Pilot Light with Flame Adjustment Valve$132.00 GST Incl.

$114 78+GST

XCEL- GAS

PH01 Air/Propane (LPG) Heating Torch

Manufactured & Compliant to AS/NZ4267

1 x Heavy Duty Tool Box1 x Oxygen Regulator1 x Acetylene or LPG Regulator1 x Cutting Attachment3 x Cutting Nozzles1 x Blow Pipe Handle1 x Mixer 3 x Welding / Brazing Tips 1 x Heating Tip - Acetylene Only 1 x 10 Metre Twin Line Hose Set1 x Welding / Cutting Goggles1 x Oxygen Flash Back Arrestor1 x Fuel Gas Flash Back Arrestor1 x Combination Spanner 1 x Radius Bar and Pivot 1 x Roller Guide 1 x Tip Cleaner Set

INDUSTRIAL CUTTING WELDING & BRAZING

NO COMPROMISE ON PRICE OVER SAFETY INCLUDES REGULATOR FLASH BACK ARRESTORS

$560.00 GST Incl.

$48696 ea+GST

Part No. Type 10pc Pkt +GST Inclusive

WT20-16-175 Thoriated 1.6mm $16.96 $19.50

WT20-24-175 Thoriated 2.4mm $38.17 $43.90

WZ8-24-175 Zirconiated 2.4mm $38.17 $43.90

WZ8-32-175 Zirconiated 3.2mm $68.48 $78.75

TUNGSTEN ELECTRODESSUPERIOR ELEMENT MIX SUPER FINE GRAIN STRUCTURESEAMLESS EXTRUSIONGROUND POLISHED FINISH

GASLESS MIG WIRE

$109.00 GST Incl.

$94 78

XAE71TGS08450.8mm x 4.54kg Spool

XAE71TGS09450.9mm x 4.54kg Spool

$103.00 GST Incl.

$8957

FLUX CORED GASLESS WIRE GREAT FOR OUTDOOR USESMOOTH STABLE ARC

XA-10-1027-L GDS Tig Welding Gloves-LargeXA-10-1027-XL GDS Tig Welding Gloves-X Large $23.00 GST Incl.

$2000+GST

GOAT & DEER SKINULTIMATE TIG GLOVE

Developed by a Professional Welder for TIG welding. Constructed out of 3 types of leather -“deer skin” palm for excellent finger tip sensitivity “goat skin” back for dexterity and heat protection & cowhide cuff for durable wrist & forearm protection. 100% Kevlar stitched for strength & better protection against seam burn out.

$33.50 GST Incl.

$29 131.6mm x 1kg Tube 2.4mm x 1kg Tube

$32.90 GST Incl.

$2861

XA316L-R1-16 XA316L-R1-24

XA-316LSi STAINLESS STEEL TIG FILLER WIRE

1KGTUBE

• Suits1.8m x 1.8m Screens • 5 Minute Assembly • High Quality Steel• Easy Assembly • Click Together Corners• Castor Wheels Included

NOW WITH CASTOR WHEELS

Made in USA

For Confined Spaces, Inspection, Tank Work, Pipe Welding, Military, Remote & Mobile Welding, Ideal for Hard Hat situations. Available in Blue, Silver & Bronze

4 SensorsShade 9-13Delay to Dark TimerSensitivity AdjustmentSolar Powered Battery Grind Warning Flash Low Amp Tig Capable

WIDE SCREEN HELMET100mm x 60mm VISION AREA

HIGH QUALITY - TIG OPERABLE - ANSI Z87.1 APPROVED

AS4000W-SP

GRIND MODE FUNCTION

$275.00 GST Incl.

$23913+GST

WARRANTY

AMAZING! AUTOMATIC WELDING GOGGLES • Arc Welding • Mig Welding • Tig Welding • Plasma Cutting • Gas Welding

Technical DataReaction Time 0.05msSensors 2 x IndependentShade: 5-7-9-11-13Sensitivity AdjustableDelay Control AdjustablePower Supply Battery, Solar CellsOperating Temp -10°C to 55°CStandards ANSI Z87.1 / DINWarranty 12 months

New!Face Clip

Shield

$395.00 GST Incl.

$34348+GST

AUTOWELD WIDE VIEW OXYGEN ACETYLENE AND LPG GAS SETS

XG-GSK-A1 (ACETYLENE) XG-GSK-LPG1 (LPG)

WLSIL-SP

Caliper 140.indd 2 29/08/14 2:03:12 p.m.

3

WLBLU-SP WLBRO-SP WLSIL-SP

Page 4: TradeZone Caliper 140 Oct - Nov 2014

abrasIvEs & WIrE brushWarE

4

Inox ThIn CuT off WheelsProfessional inox cutting wheels are suitable for stainless steel, mild steel and heat sensitive steels.

Code Description +GST Inclusive SR9100 100 x 1.0 x 16mm $1.39 $1.60SR9115 115 x 1.0 x 22mm $1.48 $1.70SR9125 125 x 1.0 x 22mm $1.57 $1.80

Inox DC WheelsProfessional inox grinding wheels are suitable for stainless steel, mild steel and heat sensitive steels.

Code Description +GST Inclusive SR3100 100 x 6 x16mm $2.09 $2.40SR3115 115 x 6 x 22mm $2.26 $2.60SR3125 125 x 6 x 22mm $2.43 $2.80

speeDlok DIsC 75mm DIaWidely used for rapid stock removal on stainless steel, titanium and other exotic metals. Achieve a superb performance finish from the zirconia grain and grinding aid combination.

Code Description +GST Inclusive

8834160299 zirconia, (40G) $1.65 $1.90

8834169579 zirconia, (60G) $1.65 $1.90

8834160303 zirconia, (80G) $1.65 $1.90

8834168384 zirconia, (120G) $1.65 $1.90

hanDy Roll 40mm x 50mHigh flexibility for sanding contoured components. Tears easily from handy roll. Suitable for maintenance and general engineering use.

Code Description +GST Inclusive

66623320798 (P40) Grit $45.13 $51.9066623320797 (P60 Grit) $41.48 $47.7066623320803 (P80) Grit $39.04 $44.9066623320806 (P100) Grit $38.17 $43.9066623320810 (P120) Grit $38.17 $43.9066623320808 (P150) Grit $38.17 $43.9066623320820 (P180) Grit $38.17 $43.9066623320816 (P240 Grit) $39.13 $45.0066623320814 (P320 Grit) $42.35 $48.7066623324126 (P400 Grit) $46.26 $53.20

noRzon fIbRe DIsCCode Description +GST Inclusive

63642531839 100 x 16mm (P36) $1.39 $1.60

66261061296 100 x 16mm (P60) $1.30 $1.50

69957360048 115 x 22mm (P24) $2.17 $2.50

63642539615 115 x 22mm (P36) $1.74 $2.00

63642539616 115 x 22mm (P60) $1.39 $1.60

63642539617 115 x 22mm (P80) $1.30 $1.50

63642539619 125 x 22mm (P24) $2.17 $2.50

63642536483 125 x 22mm (P36) $1.74 $2.00

69957360057 125 x 22mm (P60) $1.39 $1.60

63642539622 125 x 22mm (P80) $1.30 $1.50

66261138594 180 x 22mm (P24) $3.83 $4.40

63642533063 180 x 22mm (P36) $3.04 $3.50

63642533065 180 x 22mm (P60) $2.52 $2.90

63642533066 180 x 22mm (P80) $2.52 $2.90

63642533068 180 x 22mm (P120) $2.52 $2.90

a275 no-fIl aDalox sheeTs 230 x 280mm

Code Description +GST Inclusive

66261131634 (P80) Grit $1.04 $1.20

66261131633 (P100) Grit $1.04 $1.20

66261131632 (P120) Grit $1.04 $1.20

66261131631 (P150) Grit $1.04 $1.20

66261131630 (P180) Grit $0.96 $1.10

66261131628 (P240) Grit $0.96 $1.10

66261131627 (P280) Grit $0.96 $1.10

66261131626 (P320) Grit $0.96 $1.10

66261131624 (P400) Grit $0.96 $1.10

Norton No-Fil Adalox A275 Paper Sheets are the light-weight paper sheet performance leader for dry finishing. Full size (9” x 11”) and cut paper sheets are used for both metalworking and woodworking applications. Packed in protective dispensers and/or convenient job packs to eliminate waste and permit easy, neat storage. Applications include light-duty metal sanding, primer sanding, defect removal from painted surfaces, filler sanding, sanding and finishing of composites and fiberglass, bare wood sanding, and sanding between sealer coats. Paper sheets are typicallly used for hand or jitterbug sanding.

Inox CuTTIng DIsCCode Description +GST Inclusive

DISC-XT10-100 100 x 1.0 x 16mm $2.43 $2.80

DISC-XT10-115 115 x 1.0 x 22mm $2.52 $2.90

DISC-XT10-125 125 x 1.0 x 22mm $2.78 $3.20

DISC-XT10-180 180 x 1.5 x 22mm $4.61 $5.30

DISC-XT10-230 230 x 1.9 x 22mm $5.13 $5.90

flap DIsC fIbRe baCk - 60 gRITIndustrial Quality. Universal disc for use on a wide range of ferrous materials. Fibre Backed Angled Face - FBZ. Ideal for use in applications such as weld preparation, weld seam removal, surface blending and edge grinding. Long life compared to resin fibre discs. Reduced vibration and noise compared todepressed centre grinding discs.

Code Description +GST Inclusive

GAFA10016060 100mm (P60) $7.74 $8.90

GAFA11522060 115mm (P60) $8.78 $10.10

GAFA12722060 127mm (P60) $9.74 $11.20

WIRe WheelFor the removal of rust, paint, scale, edges etc.; Cleaning of forged pieces; Surface processing in metal, rubber, plastic, wood, glass etc.

Code Description +GST Inclusive WHEW1505 150 x 20mm $27.83 $32.00WHEW2005 200 x 20mm $36.52 $42.00WHEW2007 200 x 27mm $42.61 $49.00

GrEaTvaLuE

Page 5: TradeZone Caliper 140 Oct - Nov 2014

safETy proDucTs

CR-39/001 single CR-39/100 100pC pkt

5

eyemuffsRJP006

Extreme safety wear, 2 in 1, earmuffs & goggles. This

combination of hearing & eye protection has raised the bar in PPE standards. Provides 100% ear cup

seal at all times, comfort. One size fits all. Light weight non slip. Quick

release replaceable lenses (clear, amber, smoke tint).

WelDIng helmeT633-PAPolypropylene flip front welding helmet complete with Shd 10 lenses. Easy adjustable headgear with replaceable sweatband welding helmet. 51 x 108mm lift-up lens holder. Standards CE EN175/ ANSI Z87.

blue DIsposable eaRplugsEasy to insert due to tapered shape. Specially formulated low pressure foam. Individually packaged.

TeChnospeC safeTy speCsVery popular, Wraparound safetyspec. Lightweight one piece polycarbonate lens providing exceptional fit and protection. Black polycarbonate side arms. Standards AS/NZS 1337:1992SM-3100C Clear lensSM-3100S smoke lensSM-3100M mirror lens

WelDIng CoveR lens1000hr cover lens. Made of durable heat resistant material. Meets ANSI Z87 safety impact standards. Size 51 x 80mm. Wrapped individually.

gas WelDIng goggleGW-250

Lift up front round lens holders complete with Shd 5 lens.

Replaceable lenses available. 6 indirect air vents.

sWIvel knee paDFGK1Foam inner pad. Reinforced lining. Hard swivel cap. Quick on/off locking system. Absorbs shock and retains shape. Anti moisture neoprene.

$18.90 GST Incl.

$16 43 $45.00 GST Incl.

$39 13

$2.20 GST Incl.

$1 91

$7.50 GST Incl.

$6 52

$49.00 GST Incl.

$42 61 $31.80 GST Incl.

$27 65

$23.90 GST Incl.

$20 78

$46.90 GST Incl.

$40 78

$4.90 GST Incl.

$4 26 EA

$143.80 GST Incl.

$125 04

$1.00 GST Incl.

$ .87

MICROFIBRECARRY BAG

DIsposable mask, p1 valveDP1 Dust/Mist mask with exhalation valve adds comfort. AS/NZS 1716: 2003

$2.30 GST Incl.

$2 00 $17.30 GST Incl.

$15 04

EP331B/01 single mask

EP331B/12 box 12 masks

EP-251/001 single pair

EP-251/200 200pc box

DIsposable masks, p2 valueDP2 Dust/Mist/fume mask with exhalation valve adds comfort. AS/NZS 1716: 2003.

$2.70 GST Incl.

$2 35 $21.10 GST Incl.

$18 35

EP321B/01 single mask

EP321B/12 box 12 masks

An engineer was crossing a road one day, when a frog called out to him and said, “If you kiss me, I’ll turn into a beautiful princess.” He bent over, picked up the frog and put it in his pocket. The frog then cried out, “If you kiss me and turn me back into a princess, I’ll stay with you for one week and do ANYTHING you want.” Again, the engineer took the frog out, smiled at it and put it back into his pocket. Finally, the frog asked, “What is the matter? I’ve told you I’m a beautiful princess and that I’ll stay with you for one week and do anything you want. Why won’t you kiss me?” The engineer said, “Look, I’m an engineer. I don’t have time for a girlfriend, but a talking frog, now that’s cool.”

fIlTeR speC pRo, goggle/RespIRaToR ComboFSPGAnti fog, anti scratch, medium impact goggle with P2, valved, carbon filter mask attached. AS/NZS 1337.1:2010 certified.

pRosense one-plus anTI vIbe gloveONNFRBPAnti-vibration foam padded glove with back of hand protection. Foam nitrile palm for superior grip. EN388 - 4241. Sizes: 7,8,9,10 & 11

FrEE glovE clIpvAlUEd AT

$5.95EA. WIThEvErY pAIr

oF glovEs sold.

Page 6: TradeZone Caliper 140 Oct - Nov 2014

coNsumabLEs

6

meChanICs hanD ToWel 4 Rolls0-7024B48cm x 70m blue paper towel. 2 ply infused with a fabric mesh. Ultra absorbant, 99% lint free.

ConCenTRaTeD CleaneR & DegReaseR 4.0l SG31251SuperGreen is a concentrated multipurpose cleaner & degreaser it contains the latest plant based surfactant technology that works quickly to penetrate, detach and lift soiling and greases. NZFSA Approved C32.Natural Plant based. Zero VOC. No Phosphates. No Caustics. Neutral pH.

hammeRITe 400ml aeRosolThe quick and convenient way to protect and decorate metal surfaces. Unlike conventional systems, it can be painted directly onto rusty metal Its special 3 in 1 formula means you do not need a primer or undercoat and it is touch dry in 1 hour. Hammerite Metal Paint™ also comes in a range of colours and finishes to match your specific requirements.

PAIH-040B black. Hammered finishPAIH-040S silver. Hammered finishPAIS-040B black. Smooth finishPAIS-040S silver. Smooth finish

meTal polIsh CReamNon abrasive formula gives great shine on all metals. Removes tarnish and oxidation, leaves a silicone film to protect the finish, can be used with polishers and buffers. 69 500 550g Tub 69 550 2043g Tub

yuk off - oRange hanD CleaneRWith pumice and citrus for powerful and fast hand cleaning.

31908 400ml. bottle

31909 4l pump bottle

20l sImplegReen ConCenTRaTe (maf C32)SG13004Where to Use: Engines & Machinery. Dip tanks. Aqueous-based parts washers. Steam cleaners. Pressure sprayers. Prepping prior to painting, plating or welding. Floor scrubbing & General plant maintenance. Fleet and mass transit vehicles. HVACR* coils and cooling towers. Removing machining oils and cutting fluids from manufactured parts and extruded tubing.

kResTo heavy DuTy hanD CleaneR sTaRTeR paCkSK29984502Includes 2 x 2000ml Softbottles & 1 x Black Dispenser.

35:1 longlIfe soluble oIl 4lRY515200An extreme pressure soluble oil water-mix cutting fluid formulated to give a long predictable sump life. It provides exceptional performance in medium / severe cutting operations on a wide range of ferrous and non-ferrous metals.

zInC paInT 350g aeRosolD12000Zincpaint is a cost effective, high quality, cold galvanizing product which provides metal protection against extended exposure to the elements which causes rust and corrosion to occur.

Extra heavy-duty cleanser for tough soils such as grease, oil, ink and carbon black. Contains all-natural, biodegradable walnut shell scrubbers to remove even ground-in dirt. Low solvent content, good skin compatibility.

$17.50 GST Incl.

$15 22

$49.00 GST Incl.

$42 61

$23.80 GST Incl.

$20 70 $68.00 GST Incl.

$59 13

$99.00 GST Incl.

$86 09

kResTo heavy DuTy hanD CleaneRsSK34736 410ml flip-Top bottle Suitable for toolboxes & mobile technicians.

SK30362 1892ml pump bottle Suitable for mobile technicians, workstations.

SK87045 2000ml soft bottle Suitable for Stoko Dispensers only.

$12.00 GST Incl.

$10 43 $42.70 GST Incl.

$37 13 $49.00 GST Incl.

$42 61

$79.90 GST Incl.

$69 48

$17.90 GST Incl.

$15 57

$21.00 GST Incl.

$18 26 EA

$139.00 GST Incl.

$120 87

$139.00 GST Incl.

$120 87

$10.90 GST Incl.

$9 48hoT

prIcE

DISPENSERPER CARTONOF 4 ROLLS

RTUCLEANING PACK

InsulaTIng & sealIng WRap121264Red tape, 25mm wide x 3mm thick x 3m long. Loctite® Insulating & Sealing Wrap is a non-sticky, self fusing, multipurpose wrap. It can withstand extreme conditions: -50°C to 260°C, tensile strength up to 700 psi and dielectric strength up to 400 vpm. The wrap is uv, saltwater, fuel and acid resistant.Typical Applications: Jumper cable grip/insulating, emergency hose repair,exhaust wrap, tool handles.

$29.00 GST Incl.

$25 22

Page 7: TradeZone Caliper 140 Oct - Nov 2014

chEmIcaLs & LubrIcaNTs

7

CoppeR anTI-seIze & lubRICaTIng CompounDSafe for use on both ferrous and non-ferrous metals. Protects parts up to 982° C. Does not compromise integrity of soft metals. Heat aging won’t affect lubricity of product. NZFSA Approval C12.

Code Description +GST Inclusive 3145 75ml Tube $6.87 $7.90

3183 500ml Tin $28.61 $32.90

3195 400ml Aerosol $21.22 $24.40

596 supeRflex® ReD hIgh Temp. 316° C RTv sIlICone aDhesIve sealanTRecommended for sealing all types of flanges including stamped sheet metal where high temperature resistance is required, e.g. assembly and repair of industrial furnaces, ovens, boilers, exhaust stacks and high temperature ducting. Fills gaps to 6mm.

Code Description +GST Inclusive34243 85g Tube $11.65 $13.40

59675 300ml Cartridge $28.87 $33.20

bRakleen 600gm aeRosol5089Removes contaminants from industrial machinery, brake linings, pads, drums and callipers. Non-staining, non-corrosive and leaves no residue.

mulTI-use lubRICanT 521mlWD61104Superior penetrating power. Breaks through rust & corrosion. Frees stuck and frozen metal parts. Protects against rust and corrosion. Displaces moisture.

ml-11™ mulTI-puRpose maInTaIn & lube 360ml41106 Light, semi-drying , oil type spray that penetrates, lubricates, displaces water prevents rust & cleans.

fReeze & Release aeRosol 310gmFARShock-freezes seized and rusted parts down to -43ºC, causing microscopic cracks in the rust and allowing the lubricant to penetrate. The assembly can be easily dismantled after allowing 1- 2 minutes and parts remain lubricated and protected from corrosion. Recommended for: Seized and or rusted components.

mulTI puRpose lubRICanT & peneTRanT aeRosol 340gm 104444 x the lubricity and longer lasting than petroleum based oils. Ultralube lubricants are manufactured from renewable, biogradable vegetable base stock oils. Excellent rust and corrosion preventer. Lasts longer. Non toxic. Safer to use.

$10.00 GST Incl.

$8 70

$9.30 GST Incl.

$8 09

$11.10 GST Incl.

$9 65 $11.50 GST Incl.

$10 00

$12.80 GST Incl.

$11 13

$159.90 GST Incl.

$139 04

CDT CuTTIng lIquID3064 500ml

CDT CuTTIng lIquID3068 5 litre

Cutting, drilling, tapping and reaming lubricant. Contains high performance, extreme pressure additives. provides very high resistance to temperature, pressure

and wear. for use on all types of metal. suitable for hand and machine cutting. nzfsa approved C12.

BoNUs oFFEr: EAch 6 cANs comEs WITh A FrEE crc pUshdoWN BoTTlE opENEr, oNlY WhIlE sTocks lAsT.

nICkel anTI-seIze & lubRICaTIng CompounDCopper-free formulation - For all metals, especially stainless steel. Protects fasteners and metal surfaces from seizing and galling. High temperature resistance - Protects parts up to +1315° C. Will not harden - Heat aging won’t affect lubricity of product. Electronically conductive – Does not insulate and interrupt current flow.

Code Description +GST Inclusive

3147 75ml Tube $9.22 $10.60

3193 500ml Tin $40.78 $46.90

3197 400ml Aerosol $23.91 $27.50

buy 1 GET 1 frEE

$27.60 GST Incl.

$24 00

CDT meTal CuTTIng pasTe3062 500ml Tin

CDT CuTTIng oIl3063 400ml aerosol

$29.90 GST Incl.

$26 00 $19.90 GST Incl.

$17 30

Page 8: TradeZone Caliper 140 Oct - Nov 2014

LubrIcaTIoN EquIpmENT

8

samoa 20kg gRease kIT424170Integral filter protects pump from foreign particle contamination. Delivery rates of up to 0.9 kg/min. 55:1 ratio air motor develops grease pressures of up to 7,950psi (548bar). Will handle high density, tacky greases up to NLGI2. Cast alloy dual cylinder air motor won’t dent or distort prematurely. Ergonomic grease control valve is easy and comfortable to operate, convenient carry handle assists in kit portability and helps address OH&S issues, and operator friendly. Easily adjustable bung adaptor enables the kit to be used on a variety of drum sizes and types. Single toggle air motor operation ensures a long service life. Heavy duty 3 jaw coupler ensures a tight and precise grease nipple connection. Manufactured in Spain.

5l oIl Jug5000MFN

Multi Purpose Oil Measure: Polyethylene oil measure will not dent, scratch or corrode. Flexible delivery spout makes the topping up of

engines, gear boxes, diffs, transmissions and crank cases a quick and easy proposition. Screw on lid helps to prevent contaminants

from entering the oil measure and ultimately vehicle engines.

leveR aCTIon gRease gun 450gm600ADevelops grease pressures of up to 12,000psi (828bar). Delivers up to 1.6g of grease per stroke. Plastic wing nut enables the rigid extension to be locked at the required angle. Coarse thread on barrel assembly eliminates the possibility of cross threading during cartridge change over. Unique Twin Lock System seals the piston and eliminates the possibility of dummy lubrication. Patented Ever-Flow System enables the gun to be used with thick tacky greases even in the coldest conditions. Large diameter piston with a long lever travel facilitates high volume greasing. High volume, high pressure greasing guaranteed. Manufactured in Germany.

TRIggeR aCTIon gRease gun 450gm660ANGrease pressures of up to 8,500psi (586bar). Delivers up to 1.1g of grease per stroke. Coarse thread on barrel assembly eliminates cross threading during cartridge changeover. Twin Lock System seals the piston and eliminates the possibility of dummy lubrication. Patented Ever-Flow System enables the gun to be used with thick tacky greases even in the coldest conditions. Light weight, durable and compact aluminium die cast head assembly. High volume or high pressure option facilitates fast and efficient greasing. 4 jaw coupler and flexible 30cm long extension. Manufactured in Germany. The ultimate greasing tool.

RoTaRy DRum pumpARP3250Suits 205L and fits 60L drums. Up to 25LPM. Suitable for petrol, diesel, kerosene and light oils. Cast alloy pump body. 1.2m of 25mm polypropylene discharge hose, without nozzle. Can syphon andtransfer fuels in reverse.

polypRopylene ChemICal RoTaRy pumpARP8210

Suits 60L and 205L drums. Delivers up to 20LPM. Suitable for the transfer of petrol, diesel, water, light grade oil, herbicides, pesticides, chemicals and

mild detergents. Polypropylene, ryton and stainless steel metallic parts offer good

chemical resistance. Unique, rotating 2 piece discharge spout assists fluid transfer.

heavy DuTy gRease gunAH122710,000psi, uses standard 450gm cartridges. Can be bulk loaded, suction filled or hand filled.

500CC oIl suCTIon gunARG3620Quality no leak piston/cylinder design. Suitable for emptying and filling engines, gearboxes and differentials. Industrial quality. Long flexible suction hose.

leveR DRum pumpARP3325Suits 60L and 205L drums. Delivers up to 40LPM, 1L per stroke. Suitable for the transfer of petrol, diesel, kerosene and light oils. Lockable handle.

unIveRsal beaRIng paCkeR ARA2765Easy to use with either air or hand operated grease guns. Working height between cones: 0-50mm. Use as portable or bench mounted. Bearing capacity: minimum 10mm ID; maximum 135mm OD. For roller and ball bearings.

$35.00 GST Incl.

$30 43

$37.00 GST Incl.

$32 17

$25.00 GST Incl.

$21 74

$113.80 GST Incl.

$98 96

$83.50 GST Incl.

$72 61

$35.60 GST Incl.

$30 96

$99.00 GST Incl.

$86 09 $161.20 GST Incl.

$140 17

$135.00 GST Incl.

$117 39 $899.00 GST Incl.

$781 74

WIN WITH

UlTImaTe FIsHINg KIT

Page 9: TradeZone Caliper 140 Oct - Nov 2014

cuTTING TooLs

9

90° CounTeRsInk seTs

DRIll seTsCode Description +GST Inclusive BL-M1 11pc. 1 - 6 x 0.5mm increments $17.30 $19.90BL-M2 19pc. 1 - 10 x 0.5mm increments $39.13 $45.00BL-M3 25pc. 1 - 13 x 0.5mm increments $77.39 $89.00

5pC unIveRsal DRIll seT2700-SETSizes: 4, 5, 6, 8 & 10mm.

Tap & DIe seT 115pCSAV50-S1Metric/UNC/UNF/BSP/NPT. (2 - 18mm, 4G - 3/4” & 1/8” to 1/4”).

DRIll seT hss 1/2” ReDuCeD shank meTRIC 4Rm 4pC seT176794High speed steel. Metric 1/2”” reduced shank drills. 16, 18, 22 & 25mm. Made in New Zealand.

spaDe bIT seT 3pC178382Set includes spade bits 19, 22, 25mm. Evacut spade bits feature a spur design cutting edge to reduce splintering and ensure fast, smooth, clean holes. Features include: Hex shank. For use in wood or plastic. Can be resharpened.

xTReme holesaW seT, quICk ChangeBLX7065-S1M42 Cobalt holesaws. Sizes: 16, 20, 22, 25, 32, 40, 51, 54 & 60mm Up to 24% longer life.

xTReme ReCIp blaDes14TpI Demolition & Rescue saw blades. For cutting pipe, angle iron, nail embedded wood and structural steel. Wider (25mm) and thicker (1.1mm) blades for demolition work. 1/2” universal shanks.

Code +GST InclusiveBLXT614 $5.83 $6.70BLXT914 $7.74 $8.90BLXT1214 $9.48 $10.90

6TpI Wrecking saw blades: For cutting wood, sleepers and other tough materials. Wider (22mm) and thicker (1.6mm) blades for demolition work. 1/2” universal shanks.

Code +GST Inclusive BLXT66 $6.00 $6.90BLXT96 $7.74 $8.90BLXT126 $9.13 $10.50

ReTRaCTable uTIlITy knIfes

T1774106 proTouch Retractable utility knifeEasy blade change with safe lock system to prevent blade from slipping during use. Tool free access to spare blades, storing up to 10 blades.

T2088600 auto-retracting safety utility knifeBlade automatically retracts when it loses contact with cut material. Strong die cast aluminium body with 19 degree angled nose.

DebuRRIng s pRomo seT NONG8150Designed for deburring steel, aluminium and plastic. Set includes an ergonomic NG-1 Handle and 10 x heavy duty S10 (3.2mm)blades. Spare blades are kept inside the handle.

DebuRRIng s Tele seTNONG8350

Deburrs steel, aluminium, plastic, brass and cast iron. NG-3 handle, S Holder, S10 blades (x5), S20 blades (x5).

Spare blades are kept inside the handle. S Holder holds S blades (3.2mm) and telescopes

from 30-115mm.

CaRbIDe buR seT 5pC918CRSET5MDouble cut bur allows for rapid stock removal in harder materials. Chisel tooth pattern. 6mm shank. Includes: 12mm x Cylindrical (Square), Cylindrical (Radius), Tree (Radius), Tree (Pointed) & Flame.

sCReW exTRaCToR seTs Designed to remove broken studs, bolts, socket screws and fittings.

$32.80 GST Incl.

$28 52

$49.80 GST Incl.

$43 30

$56.60 GST Incl.

$49 22 $94.40 GST Incl.

$82 09

$24.50 GST Incl.

$21 30

$37.00 GST Incl.

$32 17

$17.40 GST Incl.

$15 13

$50.40 GST Incl.

$43 83 $61.70 GST Incl.

$53 65

$315.00 GST Incl.

$273 91 $188.00 GST Incl.

$163 48

$155.00 GST Incl.

$134 78

$219.00 GST Incl.

$190 43

$11.30 GST Incl.

$9 83

M603S20 S20 - 10 Piece set. Includes screw extractors #1 - #5 and stub drills 5/64 - 19/64”.

M603S15A S15A -- 6 Piece set Includes screw extractors #1 - #6.

NOGA

BL370-CSK02 3pc

10, 14 & 20.5mmBL370-CSK03 6pc 6, 8, 10, 12, 16, 20.5mm

hoTprIcE

GrEaTDEaL

BLUMOLBL-M3 DRILL SET

(1-13mm)

Page 10: TradeZone Caliper 140 Oct - Nov 2014

NEWmodEl

poWEr TooLs

10

angle gRInDeR 125mm - 1100W9565P

12,000rpm. Paddle type on/off switch.

angle gRInDeR 125mm - 1250WLong service life for demanding applications; powerful and robust angle grinder with highest power density in its class for work progress.Safety clutch, marathon motor, advanced ergonomics.

angle gRInDeR 125mm 1550WRobust, powerful angle grinder with greatest power density in its class for quick work progress. Safety clutch, marathon motor, advanced ergonomics. WE15-125Q 1550WWEP15-125Q 1550W with paddle switch

150mmBG151250 watt. No load speed: 2850rpm. Wheel: 150 x 20 x 12.7mm

200mmBG201300 watt. No load speed: 2850rpm. Wheel: 200 x 25 x 16mm

200mmBG203550 watt. Magnifying lens. Auto on light. No load speed: 2850rpm. Wheel: 200 x 25 x 16mm

DRIll pRess - benCh mounTDP305BThe Tooline DP305B bench drill press has a net weight of 34kgs and an overall height of 870mm. The chuck to base measures 538mm and the chuck to table measures 413mm. The table size is 245 x 240mm, with the chuck measuring 16mm. The maximum spindle travel is 80mm, and there are 12 spindle speeds, 230 - 2470rpm. The features of this bench drill press include an inbuilt light to illuminate workpiece, a fully adjustable table with angle indicator, a cast iron base for added stability, an emergency stop button, a locking depth stop for blind hole drilling and an aluminium motor housing for increased heat dissipation and lighter weight. Compact and lightweight. Ideal for the home or workshop.

DRIll pRess - flooR mounTDP430F430mm swing. 850w powerful motor. No volt-release switch prevents automatic starting when power is restored. 28mm capacity drilling in steel. 16mm chuck. Coolant table. 16 speed.

18v CoRDless DRIll & gRInDeR kITSB18LTXBL/W18Kit includes: SB18LTX BL 18v cordless brushless drill, W18LTX 18v angle grinder, 2 x 5.2Ah Li-ion batteries, AC30 charger & carry bag.

angle gRInDeR 125mm - 1400WGA5040CVariable Speed, 2,800-11,000rpm. Super-joint system II. Electronic limiter. Soft start. Anti-restart function. Constant Speed Control. With side grip.

angle gRInDeR 125mm1700W - paDDle sWITCh

WEPBA17-125QMaximum productivity: first 1,700 Watt angle grinder

with the power of a large grinder and the compactness of a small one for quickest material removal for

industrial applications. Brake. Safety clutch. Soft start.

Marathon motor.

angle gRInDeR 230mm - 2000WGS23SRHeat resistant 2000w motor. Strong alloy gearbox with spindle lock. 3 position side handle. Easy to operate trigger switch.

$99.00 GST Incl.

$86 09

$215.00 GST Incl.

$186 96

$1,029.00 GST Incl.

$894 78

$142.00 GST Incl.

$123 48 $199.00 GST Incl.

$173 04

$343.00 GST Incl.

$298 26

$789.00 GST Incl.

$686 09

$279.00 GST Incl.

$242 61

$299.00 GST Incl.

$260 00

$599.00 GST Incl.

$520 87

$479.00 GST Incl.

$41652 EA

$399.00 GST Incl.

$34696 EA

CUT OFF DISCS10PC PKT

CUT OFF DISCS10PC PKT

NEWmodEl

benCh gRInDeRs

angle gRInDeR 125mm - 730W G13SR3 Strong alloy gearbox. Ergonomic side handle.Supplied in a case.

$99.00 GST Incl.

$86 09

NEWmodEl

W12-125QWP12-125Q

Page 11: TradeZone Caliper 140 Oct - Nov 2014

poWEr TooLs

ExclUsIvE To

11

ImpaCT poWeR bIT seT 5pCT9097049Includes: Hex 3, 4, 5, 6, 8mm. Compact, portable design allows for easy transport to and from worksite and ease-of-use while on the job. Moulded plastic case holds up to rigors of daily use. Easy to read marking provide simple identification of set contents.

18v DRIveR DRIll & gRInDeR Combo

KC18DSGL(GB)Includes 2 x 5.0Ah energy Li-ion batteries

& Smart Charger. 18v Pro Series Driver Drill & 18v Angle Grinder.

18v ImpaCT DRIllDV18DJL(GC)Comes with 2 x 2.5Ah batteries, charger and case.

18v CoRDless DRIveR DRIllDDF480RFELXT(Lithium-ion) cordless brushless driver-drill. 13mm keyless chuck. Extreme Protection Technology (XPT). 2x 3.0Ah batteries. Fast charger. Carry case.

eleCTRIC DRIll 13mm - 750W, vsRDP4002K0-600rpm. Max torque 73Nm. Aluminium gear housing. Geared 13mm chuck. Variable speed, reversible. Carry case.

hammeR DRIll 20mm - 720W, vsRHP2050HVariable speed, reversible. 2-speed. Aluminium Gear Housing. Safety Clutch.

18v RIghT angle DRIll - baRe ToolDN18DSLnn10mm single sleeve keyless chuck with ratcheting feature and spindle lock. Low profile head - only 88mm. Variable speed paddle switch with reverse. LED light toilluminate work area. Battery level indicator for convenience.Compatible with ALL Hitachi 18V slide batteries.Supplied without batteries, charger and carry case.

18v bRushless ImpaCT WRenChbaRe ToolWR18DBDLnnHigh performance brushless motor. Max torque 250Nm. 1/2” Dr. Selective strike mode, continuous and burst. 4 stage power selector.

heavy DuTy DRIllD13VG

Powerful high performance 800w motor. Heavy duty 13mm keyed chuck. Triple reduction

gearbox gives high torque output of 74Nm. Variable speed, reversible.

all puRpose vaCuum CleaneRs“Auto Remote Start With Power Tools.”

ASA 32L 1200WMobile, compact vacuum cleaner for liquids and dry solids. Suitable for cleaning the construction site, workshop, vehicle and much more.32L bag.

ASR 35L 1400WFor hard continuous use during grinding, milling, drilling and cutting jobs on the construction site or

in the workshop.Auto clean

function.35L bag.

meTal CuT off saW 355mmCC14SFPowerful 2000w motor. Quick release vice. Spark diversion guide. Capable of cutting chaped steel up to 130 x 130mm.

$12.20 GST Incl.

$10 61

$487.00 GST Incl.

$423 48 $929.00 GST Incl.

$807 83

$429.80 GST Incl.

$373 74

$379.00 GST Incl.

$329 57

$645.00 GST Incl.

$560 87

$699.00 GST Incl.

$607 83

$357.90 GST Incl.

$311 22

$357.90 GST Incl.

$311 22

$329.00 GST Incl.

$286 09

$299.00 GST Incl.

$260 00

$472.90 GST Incl.

$411 22

CORDLESSANGLE GRINDER

SKIN

HITACHIWORK GLOVES

BIT SET

HITACHI18V CORDLESS

FAN

NEWmodEl

Page 12: TradeZone Caliper 140 Oct - Nov 2014

coNsumabLEs

12

415pC masTeR mm/sae gRease nIpple assoRTmenT

CA2415Master Kit. 20 Sizes. Metric and Imperial. Zinc Plated. Supplied in metal case. Replacement packs available.

255pC sTaInless sTeel splIT pIn assoRTmenTCA1850 metric 304/A2. 10 Sizes: 1.6mm to 5mm Dia. Replacement packs available.

masTeR o-RIng assoRTmenTsCA407 407pC ImperialNitrile, 70 Shore. 32 Sizes 1/8” to 2” I.D. Replacement packs available.

CA408 425pC metric Nitrile, 70 Shore. 32 Sizes 3mm to 50mm I.D. Replacement packs available.

Wall mounTeD paRTs bIn kIT22 pIeCePBKIT1 x LPR002 305H x 915W Louvre Panel 7 x 105 x 110 x 50mm - Plastic parts bin 7 x 105 x 140 x 75mm - Plastic parts bin 7 x 105 x 190 x 75mm - Plastic parts bin

CoppeR WasheR assoRTmenTs CA225 260pC Imperial 12 Sizes: 1/4” to 1” I.D. Thickness: 20G. Replacement packs available.

CA226 305pC metric. 14 Sizes: 6mm to 26mm I.D. Thickness: 1, 1.5 & 2mm. Replacement packs available.

1640pC masTeR splIT pIn assoRTmenTCA2540 zinc plated 16 Sizes: 1.6 x 22mm to 6.3 x 50mm plus 7/64 & 9/64”. Supplied in metal case. Replacement packs available.

RIChmonD CasToRs 100mm DIa.Non Marking easy push wheel. 150kg Castor with rebound rubber wheels.

Code Description +GST InclusiveR4043 Rigid Castor $16.43 $18.90S4042 Swivel Castor $20.87 $24.00S4042B Swivel & Braked Castor $28.35 $32.60

oeTIkeR 2-eaR Clamps. Multi purpose clamps for maintenance, repair and service purposes. With this type of clamp, rubber hoses, plastic tubing, electrical cables, air hoses and other materials can be securely fastened. Mild steel Zinc Plated.

Code Diameter Range +GST InclusiveOE10100008 7.0 - 9.0mm $0.96 ea $1.10OE10100013 9.0 - 11.0mm $0.96 ea $1.10OE10100016 11.0 - 13.0mm $1.04 ea $1.20OE10100019 13.0 - 15.0mm $1.04 ea $1.20OE10100022 15.0 - 17.0mm $1.13 ea $1.30OE10100024 15.0 - 18.0mm $1.13 ea $1.30OE10100027 17.0 - 20.0mm $1.39 ea $1.60OE10100029 19.0 - 22.0mm $1.65 ea $1.90

DuCT Tape 48mm x 9m

WoRm DRIve hose ClampsW3 Band, screw & housing - stainless steel throughout. 7.5mm banD WIDTh hose Clamp

Code Diameter Range +GST InclusiveN-008-12/7.5W3P 8 - 12mm $2.09 ea $2.40N-010-16/7.5W3P 10 - 16mm $1.91 ea $2.20

9.0mm banD WIDTh hose ClampCode Diameter Range +GST Inclusive N-008-16/9W3P 8 - 16mm $2.09 ea $2.40N-012-20/9W3P 12 - 20mm $2.09 ea $2.40N-016-25/9W3P 16 - 25mm $2.35 ea $2.70N-020-32/9W3P 20 - 32mm $2.52 ea $2.90N-025-40/9W3P 25 - 40mm $2.52 ea $2.90

12.0mm banD WIDTh hose ClampCode Diameter Range +GST InclusiveN-016-27/12W3P 16 - 27mm $2.87 ea $3.30N-020-32/12W3P 20 - 32mm $2.87 ea $3.30N-025-40/12W3P 25 - 40mm $2.87 ea $3.30N-035-50/12W3P 35 - 50mm $3.48 ea $4.00N-040-60/12W3P 40 - 60mm $3.48 ea $4.00N-050-70/12W3P 50 - 70mm $3.57 ea $4.10

pvC InsulaTIon Tape 19mm x 20mPVC1920-BLACK BlackPVC1920-GREEN GreenPVC1920-RED RedPVC1920-WHITE WhitePVC1920-YEL/GRE Yellow/GreenPVC1920-YELLOW Yellow

pvC InsulaTIon Tape 10pC mIxeD paCkPVC1920-RAINBOWBlack, red, white, green/yellow stripe & blue (19mm X 20m).

$84.10 GST Incl.

$73 13

$69.00 GST Incl.

$60 00

$13.90 GST Incl.

$12 09

$109.00 GST Incl.

$94 78 EA

$99.00 GST Incl.

$86 09 EA

$6.00 GST Incl.

$5 22 EA

$1.50 GST Incl.

$130 EA

$341.90 GST Incl.

$297 30

$255.80 GST Incl.

$222 43

HEAVY DUTY450G GREASE

GUN

93PC LARGE SIZESPLIT PIN

ASSORTMENT

6620-2-10-BLK Black 6620-2-10-BLU Blue 6620-2-10-BUR Burgundy 6620-2-10-GRN Green 6620-2-10-ORG Orange 6620-2-10-RED Red 6620-2-10-SIL Silver 6620-2-10-WHT White 6620-2-10-YLW Yellow

ULLMAN 4PCHOOK & PICK

SET

hoTprIcE

Page 13: TradeZone Caliper 140 Oct - Nov 2014

mEasurING TooLs

13

engIneeRs Chalk 144pCC302100mm long.

Toolbox level 250mmKL724

Accuracy: 0.5mm/m. Two solid acrylic shockproof vials.Tape measuResSmooth operating nylon coated blades.

Code Description +GST InclusiveTA3325 5m x 19mm $15.22 $17.50TA3330 8m x 25mm $24.35 $28.00TA3335 10m x 25mm $27.83 $32.00TA3345 5m/16ft x 19mm $15.22 $17.50TA3350 8m/26ft x 25mm $24.35 $28.00

open fRame fIbReglass measuRIng TapeCode Description +GST InclusiveTA3506 30m x 13mm $49.57 $57.00TA3510 50m/165ft x 13mm $50.96 $58.60TA3520 100m/330ft x 13mm $82.09 $94.40

magneTIC baseM329Clamping capacity is 60kg.With fine adjustment. DIal gaugeM339A50mm face with a capacity of 0 - 10mm. 0.01mm graduations.

4pC engIneeRs squaRe seT.GZ01011Hardened spring steel blades are permanently fixed to the stock by means of tapered self locking rivets which ensure complete rigidity. Both are precisely ground to ensure straightness and parallelism.

DepTh gauge WITh pRoTRaCToRGZ01225A versatile tool, the depth gauge with protractor allows for measurement of both angles and depths.

apollo heavy DuTy box level WITh gRIpPlumb Site Dual View vial. 3 solid acrylic vials. Epoxy-locked vials. 2 milled surfaces. Shock absorbing bi-material end caps. Ergo Grip non-slip handles Accuracy: 0.5mm/m (0.0005 in/in).

veRnIeR CalIpeRsStainless steel. Metric and english markings.

InfRa ReD DIgITal TheRmomeTeR 0.95/ -18 - +380°C153180104Non contact, Infra-Red Thermometer that measures temperature with high accuracy and quick reading. The laser spot indicates the centre of the measurement area. Registers max. and min. values. 0.95 fixed emissivity factor. Automatic shutoff after 8 seconds. Display lighting. Adjustable between °C and °F. Warning for low battery voltage. Battery & instructions included.

ThReaD gauge mm/unC 2580120055 Blades. 60°. 0.25-6mm. 4-42TPI”.

engRavIng pen207940107Steel body with knurled grip and on/off control. The pen is comfortable to work with from hardened steel to soft plastic. Supplied with 360° swivel hose nipple and 1.5 metre connection cable.

sTeel engIneeRs RulesMade in Japan to JIS standards.

Code Description +GST Inclusive150B 150mm/6” $10.35 $11.9030012 300mm/12” $16.52 $19.0060024 600mm/24” $37.83 $43.50100036 1000mm/36” $77.39 $89.00

$18.90 GST Incl.

$16 43

$112.00 GST Incl.

$97 39

$37.20 GST Incl.

$32 35 $69.00 GST Incl.

$60 00

$28.60 GST Incl.

$24 87

$21.70 GST Incl.

$18 87

$39.00 GST Incl.

$33 91

$169.00 GST Incl.

$146 96

$211.90 GST Incl.

$184 26

$59.00 GST Incl.

$51 30 $67.00 GST Incl.

$58 26KL985-100 100cm KL985-120 120cm

maDE INJapaN

$42.90 GST Incl.

$37 30 EA

M500 150mm / 6” M502 200mm / 8”

Page 14: TradeZone Caliper 140 Oct - Nov 2014

14

Roe spanneR seTs 14pCKT1214MR metric Sizes: 10 - 32mmKT1214SR ImperialSizes: 5/16 - 1.1/4”

Roe spanneR seT 26pCKT1226MR metricSizes: 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 32mm

ToRque mulTIplIeRMP91500For dismantling stubborn bolts & nuts. For use with torque wrench and impact sockets. Max Torque: 1500Nm / 1100ft/lbs. Input Drive: 1/2in. Output Drive: 3/4in. Ratio: 1:10.

ToRque WRenChesTorque wrenches manufactured to ISO6789. With ratchet the torque wrench can be used for both tightening, and final checking of the torque. Reversible with lever, but only for right-hand action for torque checking. Lockable setting. Accuracy ±4%.

Code Description +GST Inclusive1492AG-E 1/4” Dr. 5-25Nm (4-18 ft/lb) Length: 277mm $73.91 $85.003892AG-E3 3/8” Dr. 19-110Nm (14-81ft/lb) Length: 368mm $86.09 $99.001292AG-EP 1/2” Dr. 40-210Nm (30-160ft/lb) Length: 465mm $95.65 $110.003492AG-E 3/4” Dr. 90-450Nm (60-300ft/lb) Length: 850mm $234.78 $270.00

WC6013 13pcSizes: 6, 8, 10, 12, 13, 14, 15, 17, 18, 19, 21, 22, 24mm.

aDJusTable WRenChesChrome alloy steel. Made in Spain. Ole!

Code Description +GST InclusiveIG77-04 100mm/4” $18.26 $21.00IG77-06 150mm/6” $19.04 $21.90IG77-08 200mm/8” $22.26 $25.60IG77-10 250mm/10” $28.52 $32.80IG77-12 300mm/12” $38.70 $44.50IG77-15 375mm/15” $68.70 $79.00IG77-18 450mm/18” $106.52 $122.50IG77-24 600mm/24” $260.00 $299.00IG771-30 750mm/30” $458.26 $527.00

19pC meTRIC Roe spanneR seTWC7023

Heat treated, drop forged, chrome vanadium steel, raised panel.

Features 15˚ offset and chamfered open end for easy access.

Includes 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,

21, 22, 23, 24mm.

ball enD l-WRenCh seT blx15m

T109951.27mm - 10mm.

Balldriver tip allows easyinsertion and removal

of fasteners from a 25 deg angle.

geaR spanneR seTs meTRIC Built to exceed ANSI specifications. Heat treated, drop forged, chrome vanadium steel, fully polished. Chamfered open end for easy access. Works with just 5˚ swing.WC0346 7pcSizes: 8, 10, 12, 13, 14, 16m, 17mm.

WRenCh Rev geaReD seT 15pC GBA1541Chrome vanadium steel. Satin chrome finish. Includes 8 - 19mm. Socket adapters 1/4, 3/8, 1/2”.

RaTCheT WRenCh seT 7pC meTRICKT12107MRSizes: 10, 11, 12, 14, 15, 17, 19mm.

goRIllagRIp folD up hex key seTT125872 - 8mm. Flip-and-turn feature eliminates need to reposition tool on screw head. 40% stronger than steel handles, and will not rust or corrode. Patented flutes allow for easy selection of one tool at a time.

CombInaTIon WRenCh seTs 6pCDrop forged from carbon steel with polished ends. WREC-S06AL Imperial. Size range: 1.3/8” - 2”. WREC-S06ML Metric. Size range: 35 - 50mm.

spaNNErs & WrENchEs

$111.40 GST Incl.

$96 87

$16.00 GST Incl.

$13 91

$49.00 GST Incl.

$42 61

$49.90 GST Incl.

$43 39

$99.00 GST Incl.

$86 09

$755.90 GST Incl.

$657 30

$331.00 GST Incl.

$287 83

$239.00 GST Incl.

$207 83

$249.00 GST Incl.

$216 52

$135.60 GST Incl.

$117 91

$215.00 GST Incl.

$18696 EA

$239.00 GST Incl.

$20783 EA

70 - 350NMTORQUE WRENCH

hex & ball enD mulTIpaCks blf16T14187Ball Driver Set T10999 & T12587®

®

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

Page 15: TradeZone Caliper 140 Oct - Nov 2014

15

socKET sETs

1/4” DR. 30pC meTRIC soCkeT & bIT seTKBT2773(6pt Std) Sockets 4mm - 13mm 75mm Wobble Extension. Coupler, Bits (25mm) Phillips #2, #3. Slotted 5mm, 6mm. Pozi #2. Hex 5mm, 6mm. Torx T-10 - T-40. Robertson S-2.

3/8” DR. 39pC CombInaTIon soCkeT seTKBT2760(12pt) Sockets 6mm - 22mm, 1/4” - 3/4”. (6pt Deep) 10mm, 12mm, 13mm, 14mm. Extensions. Universal Joint. Power Bar. Spark Plug Sockets. 3-Way Adaptor.

3/8”DR. 74pC meTRIC Tool seTKBT2765Sockets: 3/8” Dr 6mm to 22mm. Accessories: 3/8” Dr. Gear to gear ratchet, spark plug sockets, extension, universal joint. Plus additional hand tools.

1/2”DR. 79pC meTRIC Tool seTKBT2957Sockets: 1/2” Dr 10mm to 36mm Accessories 1/2” Dr. Gear to gear ratchet, spark plug socket, extension, power bar. Plus additional hand tools.

soCkeT seT, 1/4”DR. 30pC CombInaTIonKT2530CR01Sizes range from: 4 - 12mm & 5/32” - 1/2” Made in Taiwan.

soCkeT seT, 3/8”DR. 36pC CombInaTIonKT3036CR01-KSizes range from: 6 - 22mm & 1/4” - 7/8” Made in Taiwan.

1/2” DR. 23pC meTRIC soCkeT seTKBT2759(6pt Std) Sockets 10mm - 32mm. Gear to Gear Ratchet (48T) Extensions. Universal Joint. 3-Way Adaptor.

1/2” DR. 44pC CombInaTIon soCkeT seTKBT2768(12pt Std) Sockets 10mm - 36mm, 1/2” -1 1/8” Gear to Gear Ratchet (48T). Spark Plug Sockets. Extensions. Power Bar. Sliding T Bar. Universal Joint.

soCkeT seT, 1/2”DR. 42pC CombInaTIon

KT4042CR06Sizes range from: 10 - 32mm &

5/16” - 1 1/4” Made in Taiwan.

68pC. 1/2”DR. meTRIC soCkeT & Tool seTT1268Containing 16 regular 12-point metric sockets, fibre reinforced ratchet, universal joint, 2½” and 6” extension bars, adaptor 3/8” F - 1/8” M, magnetic bits holder, 10 combination spanners, 6 screwdrivers, 4 pliers as well as 26 bits. Supplied in plastic case with latch lock in metal, retractable handle and metal pin hinges. The underside of the case is fitted with rubber feet to prevent it from sliding.

soCkeT seT, 3/4”DR. 24pC CombInaTIon KT6224CRSocket Sizes: 22, 24, 27, 30, 32, 36, 38, 41, 46, 50mm 1, 1-1/8, 1-1/4, 1-5/16, 1-3/8, 1-7/16, 1-1/2, 1-5/8, 1-3/4, 2.Made in Taiwan.

$45.70 GST Incl.

$39 74

$111.00 GST Incl.

$96 52

$109.00 GST Incl.

$94 78

$115.60 GST Incl.

$100 52

$199.00 GST Incl.

$173 04

$349.00 GST Incl.

$303 48 $189.00 GST Incl.

$164 35

$489.00 GST Incl.

$425 22 $395.00 GST Incl.

$343 48

$329.00 GST Incl.

$286 09

$249.00 GST Incl.

$216 52

1/2” DR. SOCKETSET 12-23mmValue $43.60

1/2” TORQUEWRENCH IN

A TRAY

®

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

26PC METRICSOCKET SET1/4” DR.

Page 16: TradeZone Caliper 140 Oct - Nov 2014

socKET sETs & TooL KITs

16

ToRx soCkeT seT 35pC645020 1/4”, 3/8”, 1/2” Dr.Built to exceed ANSI specifications. Heat treated, chrome vanadium steel. Offers Z-Drive for stronger grip. Features two grease rings for superior user grip. Torx Bit Sockets. Tamper Proof Torx Bit Sockets. Female Torx Sockets.

poWeR baR

CFBC1215 3/8” Dr. 375mm CFBC1624 1/2” Dr. 600mm

appRenTICe Tool ChesT & Tools 189pCCCT009FNice set of popular tools housed in a 9 drawer tool chest. See instore for a full listing.

hex bITs soCkeT seT 1/2” DRGAAD1007 10pc - 55mm long Includes 4,5,6,7,8,10,12,14,17,19mm

GAAD0905 9pc - 80mm long Includes 4,5,6,7,8,10,12,14,17mm.

2pC sToRage Combo RaCIng seRIesRS53569 Drawer Tool Chest & 7 Drawer Roller CabinetHeavy duty side handles. Internal locking system.Powder coat finish. Protective drawer liners.Easy move, ball bearing slides on all drawers.Full length aluminium extrusion drawer handle.Steel thickness: 0.8mm Drawer, 1.0mm Body.Maximum load limit per drawer: 34.9kg

Tool ChesT seT 99pCGCAZ0038

3 Draw Tool Chest with Lift Up Lid. 1/4” Drive Socket Set 4-13mm.

1/2” Drive Socket Set 10-32mm. Combination ROE Spanners.

Screwdrivers, Pliers, Hammer, Torq & Hex Keys,.

Tool seT 236pCKT911-003CRQuality set housed in a 6 drawer tool chest. Made in Taiwan. See in store for details.

2pC sToRage Combo RaCIng seRIesRS5758

41” - 8 dwr tool chest, 41” - 11 dwr roller cabinet.Heavy duty side handles. Gas struts. Internal locking system. Powder coat finish. Protective drawer liners.

Easy move, ball bearing slides on all drawers.Full length aluminium extrusion drawer handle.Steel thickness: 0.8mm Drawer, 1.0mm Body.Overall dimensions: 1042 x 449 D x 545mm.

Features two fixed and two castor wheels.

eRgonomIC mInI soCkeT & bIT seT 1/4”DR 18pCSCR-RGOXSPocket size tool set built for tough work in tight spaces. Ratchet forged in one piece from CV steel. Contents stored in a robust strong box.

$75.00 GST Incl.

$65 22

$39.90 GST Incl.

$34 70 $61.00 GST Incl.

$53 04

$113.80 GST Incl.

$98 96

$59.00 GST Incl.

$5130 EA

$999.00 GST Incl.

$868 70

$899.00 GST Incl.

$78174

$1,125.00 GST Incl.

$978 26

$573.00 GST Incl.

$498 26

$1,799.00 GST Incl.

$1,564 35125PC METRICSOCKET SET &ACCESSORIES

23PC METRICSOCKET SET1/2” DR.

GrEaTvaLuE

sharpprIcE

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

Page 17: TradeZone Caliper 140 Oct - Nov 2014

scrEWDrIvErs, pLIErs & rIvETErs

17

sCReWDRIveR seT, 7pCKT30117MRSlot; 3 x 75 , 4 x 100 , 5.5 x 125 , 6.5 x 150 , 8 x 175. Philips; No.1 x 80 , No.2 x 100.

10pC “go ThRough” sCReWDRIveR seT

WSS5012 Chrome vanadium steel hex shank ideal for use with a wrench for added torque. Handle optimized for absorbing downward striking

forces. Includes Phillip, Slotted & Robertson.

all sTaR sCReWDRIveR bIT seT 11pC SCR-AS020S12Securely holds the screw. Automatic adjustment to depth of the screw head. One hand operation. Quick & easy replacement of bits. Phillips, Pozi, Square.

vIse-gRIp loCkIng plIeRs 250mm T10CR Curved JawT10R Straight JawT10WR Curved Jaw with Wire Cutter

sCReWDRIveR seT, 14pCKT35114MRWith phillips and flat tip screwdrivers. Includes an insulated screwdriver

sCReWDRIveR seT 8pC GAAE0821Designed for the NZ market. Flat, Pozi, Phillips, Square. New style ergonomic cushion grip knurled handles. Magnetic tips.

ImpaCT DRIveR seTKT4112FRComes complete witha selection of bits.

CIRClIp plIeR seT, 4pCKT42114GPContains internal and external pliers, bent and straight. 200mm.

TRaDe qualITy plIeRsCode Description +GST Inclusive KT6111-06 Linesman, 163mm $16.96 $19.50KT6111-08 Linesman, 213mm $17.30 $19.90KT-6211-06 Diagonal, 163mm $16.96 $19.50KT6231-08 Diagonal, 200mm $17.30 $19.90KT6311-06 Long Nose, 163mm $16.96 $19.50KT6311-08 Long Nose, 203mm $17.30 $19.90

plIeR loCkIng ChaIn Clamp 450mmDMAB1A8Professional grade quality. Chrome molybdenum handle. Adjustable chain locking positions. Ideal for holding awkward shapes.

CIRClIp plIeR seT 4pC. heavy DuTyGPAQ04027” Straight Internal & External, 7” Bent Internal & External Heavy duty canvas wallet.Ball bearing steel tips. InDusTRIal leveR RIveTeR

JBAB32644 interchangeable heads. Rivet sizes - 3.2, 4, 4.8, 6.4mm Overall length 450mm. Aluminium body, steel tube with rubber grip. Lever handle design reduces physical strength required when using.

$49.90 GST Incl.

$43 39 $77.30 GST Incl.

$67 22

$44.60 GST Incl.

$3878

$45.80 GST Incl.

$39 83

$113.90 GST Incl.

$99 04

$59.00 GST Incl.

$5130

$45.00 GST Incl.

$39 13

$99.00 GST Incl.

$86 09

$69.00 GST Incl.

$60 00

$33.00 GST Incl.

$28 70

$31.00 GST Incl.

$26 96 EA

Made in Taiwan

WIN WITH

UlTImaTe FIsHINg KIT

NEWdEsIgN

Page 18: TradeZone Caliper 140 Oct - Nov 2014

18

pIn punCh seT 9pCKT1009PRSizes: 2 x 30, 3 x 40, 4 x 50, 5 x 50, 6 x 50, 8 x 50, 10 x 65, ∅12 x 70, 14 x 75mm.

DRIll pRess vICesCopy Size +GST Inclusive

GZ35120 75mm $73.91 $85.00

GZ35121 100mm Jaw $97.04 $111.60

GZ35122 125mm $149.22 $171.60

Drill Press vices “Best In the Market” with their unique Unigrip design. Manufactured from cast iron. 3 mounting options. The jaw width acts as jaw height facilitating longer workpieces to be held.

bIgfooT Tool bag 400mmTR-22516Constructed from lightweight 600 denier polyester material. Six exterior pockets and ten interior pockets for safe storage of small items. Double wall constructed for all-weather use.

mega ToTe 533mmTIR-22214Constructed from high density 1680 denier polyester material. Seven interior pockets and fourteen exterior pockets, including two side padded zippered pockets for tool storage. Moulded waterproof rubber base.

meDIum DuTy g-ClampsI-Braced design, cast from strong SG Ductile iron. Adjustable steel swivel shoe to help clamp uneven surfaces. Fast and smooth action twin start acme cold rolled thread. Fused handle designed to bend if overloaded.

T120/10 250mm

T120/12 300mm

flaT fIlesCode Description +GST 1-110-08-3-2 200mm/8” - Smooth Cut $12.09 $13.901-110-08-2-2 200mm/8” - 2nd Cut $12.09 $13.901-110-08-1-2 200mm/8” - Bastard Cut $12.09 $13.90

half RounD fIles1-210-08-3-2 200mm/8” - Smooth Cut $15.39 $17.701-210-08-2-2 200mm/8” - 2nd Cut $15.39 $17.701-210-08-1-2 200mm/8” - Bastard Cut $15.39 $17.70

RounD fIles1-230-08-3-2 200mm/8” - Smooth Cut $11.22 $12.901-230-08-2-2 200mm/8” - 2nd Cut $11.22 $12.901-230-08-1-2 200mm/8” - Bastard Cut $11.22 $12.90

mIll saW fIles 4-138-08-1-2 200mm/8” - 1RE $13.22 $15.204-138-10-1-2 250mm/10” - 1RE $15.74 $18.104-138-12-1-2 300mm/12” - 1RE $24.43 $28.10

WoRkshop vICe 100mmT1TON-E-BCast from close grained grey iron.

meChanICs vICeCast from close grained grey iron guaranteeing strength and long life. Fullly machined on allload-bearing surfaces for smooth and trouble free operation. Fully fused handle will bend before the vice is overstressed. Fast action rolled twin start acme thread for strength and wear resistance.

Code Description +GST InclusiveT3 100mm $120.87 $139.00T5 125mm $194.61 $223.80T6 150mm $234.78 $270.00

Tool sToRage baCk paCk 356mmTIR-5000Constructed from lightweight 600 denier polyester material. Multiple exterior pockets and twelve interior pockets for tools and fasteners. Top carrying handle and breathable, padded back and shoulder straps for carrying comfort.

4pC plasTIC Tool box seT 3035-S5Material: Polypropylene. Includes Four Toolbox Sizes: 16” - 400 x 155 x 160mm 18” - 455 x 195 x 200mm 20” - 505 x 230 x 240mm 22.5” - 580 x 280 x 295mm

ToTe bags Large zippered storage compartment. Convenient stay-open design. Water-resistant bottom. Wider opening for easier access to your tools.

haND TooLs

$86.00 GST Incl.

$74 78

$65.00 GST Incl.

$56 52

$96.60 GST Incl.

$84 00 $96.60 GST Incl.

$84 00

$77.90 GST Incl.

$6774

$59.90 GST Incl.

$52 09

$44.80 GST Incl.

$38 96 $67.90 GST Incl.

$59 04

$65.00 GST Incl.

$56 52

$69.00 GST Incl.

$60 00

$139.00 GST Incl.

$120 87

GrEaTDEaL

DRIll pRess vICe 100mmT226340

BAGT-T11201 430mm BAGT-T11205 600mm

Page 19: TradeZone Caliper 140 Oct - Nov 2014

19

WorKshop EquIpmENTTaCTICal flashlIghT - CRee leDLLS2255CREE® LED, 250 Lumens.High & low settings. Emergency flashing setting. Machined aluminium housing. Requires 3 x ‘AAA’ Batteries (Included).

WooDWoRkIng ClampsCode Description +GST InclusiveB6000 100 x 50mm (TG10) $14.87 $17.10B6001 160 x 80mm (TG16-2K) $25.22 $29.00B6002 200 x 100mm (TG20-2K) $35.65 $41.00B6003 250 x 100mm (TG25S10-2K) $39.57 $45.50B6004 300 x 120mm (TG30S12-2K) $44.61 $51.30B6005 400 x 120mm (TG40S12-2K) $51.48 $59.20B6006 500 x 120mm (TG50S12-2K) $53.74 $61.80B6007A 600 x 140mm (TG60S14-2K) $76.17 $87.60

1/2” DR. aIR ImpaCT WRenCh kITW5061KFor industrial use. Robust & powerful. Kit includes 10 sockets: 9 - 27mm. 130mm Extension. Mini oiler, nipple, carry case.

DIgITal TyRe gaugeARI90055psi to 150psi measuring range. Accurate to +1%. Two position lever for inflation and deflation. Display powered by 2 x CR2032 Lithium batteries. Battery life of 140 hours. Aluminium body.

aIR CompRessoRSpitfire8238.2cfm, FAD128lpm, 23 litre tank.

65mm RubbeR heaD malleT 24oz Non-slip bi-material fibreglass handle.223001 Black Rubber Head

gas ToRCh kIT - TRIggeR sTaRTGAST-BZ8250TK

Suitable for Propylene & Propane fuel. Adjustable flame control knob for ease in switching between

different applications. Lock button keeps torch lit for finger free use. Instant on/off trigger igniter with simple

one-handed operation. 5ft hose for maximum accessibility & mobility. Solid brass regulator is pressure-regulated

to burn in any direction.

DIe gRInDeR kITGRID-A6313

Ideal for cleaning, deburring, blending and grinding in metal fabrication, maintenance, production and tool and die

applications. Composite handle reduces vibration and insulates the operator from cold housing. Ball bearing construction for

long life. Lever throttle for feathering control.

3 Ton gaRage JaCk647528HLifting range 135mm to 495mm.

axle sTanDs 3 Ton640726

Support range 286 to 425mm.

ThReaD RepaIR kIT 130pC JGAD130AFor repairing & restoring damaged threads. Selection of M5, M6, M8, M10 & M12. Stainless Steel Screw Coils. Includes HSS Taps, Twist Drills, Installation & Pin Breaking Tools.

aIR CompRessoR16RSE-DCHigh quality 3 cylinder cast iron pump rated to a maximum displacement of 18cfm and the unit is matched with a compressor rated 2.7hp motor. Displacement of 445lpm and FAD of 300lpm. Has a slow 964rpm to achieve the output, which provides a longer life.

$25.90 GST Incl.

$22 52

$89.50 GST Incl.

$77 83

$103.00 GST Incl.

$89 57

$18.90 GST Incl.

$16 43

$197.40 GST Incl.

$17165 $149.00 GST Incl.

$129 57

$126.50 GST Incl.

$110 00

$239.00 GST Incl.

$207 83 $343.80 GST Incl.

$298 96

$269.00 GST Incl.

$233 91

$1,838.00 GST Incl.

$1,598 26

MOUNTEDSTONE SET

FILTER REGULATORValue $58.00

mICRo buTane ToRCh - TRIggeR sTaRTGAST-ST2200TPrecision flame for detailed application / use. Adjustable flame control for ease in switching between different applications. Instant on trigger-start for easy lighting. Lock button keeps torch lit for finger free use.

hoTprIcE

$56.50 GST Incl.

$49 13

WIN WITH

UlTImaTe FIsHINg KIT

WIN WITH

UlTImaTe FIsHINg KIT

Page 20: TradeZone Caliper 140 Oct - Nov 2014

We are a fair-minded company and try to exceed the requirements of all ‘Fair Trading’ legislation. Prices are current for the period denoted on the cover. Stocks are not always available in all stores all the time but we will try our best to obtain more or equivalent substitutes. Errors and omissions are rare but can happen, so we apologize and try to take all reasonable measures to fix the issue for you.

If you can’t get to us, phone, fax or email and we will send it to you

WorKshop EquIpmENT25l WeT & DRy DusT exTRaCToRALTO AERO 26-21Push & clean semi auto cleaning system. Powertool socket with On/Off. Blow function.

WaTeRblasTeR 1740psI - WITh hose ReelPoseidon 2-22TBrass pump head for long service life. Flexopower plus adjustable stainless steel lance. 10m hose on hose reel. Industrial 1 year warranty.

gT poWeR 3800W eleCTRIC sTaRT geneRaToRGT3600ESOHV 4 stroke air cooled engine. Electric start (battery incl.) and recoil. Low oil alert with automatic engine shutdown. Ergonomic handles and heavyduty solid wheel kit with rubber tyres for portability. 2 x 230V outlets. 3.8kW (max.) 3.3kW (cont.) 15L fuel tank for up to 9.5 hours continuous operation. 12 month commercial warranty.

gT poWeR 7000W eleCTRIC sTaRT geneRaToR

GT7000ES Electric start (battery incl.)

with backup recoil. Heavy duty frame with solid

wheels and handles. 3 x 15A 240V outlets.

7.0kW (max.), 6.5kW (cont.) 25L fuel tank for up to 8.5 hrs

continuous operation.Ideal for the bach, farm shed or

emergency back-up power. 12 month commercial warranty.

$699.00 GST Incl.

$607 83

$415.40 GST Incl.

$361 22

$1,220.40 GST Incl.

$1,061 22

$1,609.00 GST Incl.

$1,399 13

TURBOHAMMER

LANCE

8” meTal CuTTIng banDsaW - 1100WMBS205With Swivelled Head. Blade size: 2360 mm x 20 mm x 0.9 mm Blade speed: 31, 50, 60 m/min Bow swivel degree: -45 - +45 Cutting capacity at 90O: 205 mm Cutting capacity at 45O: 135 mm

$2,279.00 GST Incl.

$1,981 74

7000WaTT

3800WaTT


Recommended