+ All Categories
Home > Documents > Web Develpoment System

Web Develpoment System

Date post: 06-Apr-2018
Category:
Upload: nimarta-kaur
View: 222 times
Download: 0 times
Share this document with a friend

of 51

Transcript
  • 8/2/2019 Web Develpoment System

    1/51

  • 8/2/2019 Web Develpoment System

    2/51

    &&((5577,,)),,&&$$77((

    77KKLLVVLLVVWWRRFFHHUUWWLLII\\WWKKDDWWWWKKHHWWKKHHVVLLVVHHQQWWLLWWOOHHGG::((%%''((99((//332200((117766

  • 8/2/2019 Web Develpoment System

    3/51

    ''((&&//$$55$$77,,2211

    ,, KKHHUUHHEE\\ GGHHFFOODDUUHH WWKKDDWW WWKKHH ZZRRUUNN EEHHLLQQJJ VVXXEEPPLLWWWWHHGG WWRR WWKKHH 33RRVVWW **UUDDGGXXDDWWHH ''HHSSDDUUWWPPHHQQWW RRII

    00DDQQDDJJHHPPHHQQWW 6666&&0077 &&RROOOOHHJJHH $$PPUULLWWVVDDUU EE\\ PPHH LLQQ WWKKHH SSUURRMMHHFFWW XXQQGGHHUU WWLLWWOOHH ::((%%''((99((//332200((117766

  • 8/2/2019 Web Develpoment System

    4/51

    $$&&..1122:://((''**((00((1177

    77ZZRRRRUUPPRRUUHHFFDDQQGGRRDDZZRRUUNNRRIIWWKKLLVVQQDDWWXXUUHH,,KKDDYYHHEEHHHHQQDDEEOOHHWWRREEUULLQQJJSSUURRMMHHFFWWLLQQWWKKLLVVSSUUHHVVHHQQFFHH

    VVKKDDSSHHRRQQOO\\EEHHFFDDXXVVHHRRIIKKHHDDUUWWLLOO\\FFRRRRSSHHUUDDWWLLRRQQRRIIDDKKHHDDGGVV KKDDQQGGVV77KKHHUUHHDDUUHH VVRRPPHHZZKKRRKKDDYYHH

    EEOOHHVVVVHHGG VVRRPPHH ZZKKRR KKDDYYHH DDGGYYLLVVHHGG VVRRPPHH ZZKKRR KKDDYYHH ZZLLVVKKHHGG DDQQGG VVRRPPHH ZZKKRR KKDDYYHH DDVVVVLLVVWWHHGG

    77KKXXVVHHDDFFKKKKDDVVFFRRQQWWUULLEEXXWWHHGGRRQQHHVVPPLLJJKKWWLLQQVVRRPPHHIIRRUUPPRRUUWWKKHHRRWWKKHHUU

    77KKDDQQNNVVEEHHLLQQJJDDVVPPDDOOOOZZRRUUGGFFDDQQQQRRWWEEHHHH[[SSUUHHVVVVHHGGWWKKHHLLPPPPHHQQVVHHVVHHQQVVHHRRIIJJUUDDWWLLWWXXGGHHRRQQHHGGZZHHOOOOVV

    LLQQ WWKKHHKKHHDDUUWW WWRRZZDDUUGGVVDDQQ\\RRQQHH66RR LLVV WWKKHH WWUUXXHHZZLLWWKK WWKKLLVVKKXXPPEEOOHHVVHHOOIIZZKKLLOOHHVVWWDDUUWWLLQQJJVVRR LLQQ WWKKLLVV

    OOLLQQHH

    ,,ZZRRXXOOGGOOLLNNHHWWRRWWKKDDQQNNPPHHSSUURRMMHHFFWW**XXLLGGHHOOHHFFWW$$PPDDQQGGHHHHSSNNDDXXUUIIRRUUVVSSHHQQGGLLQQJJKKLLVVSSUUHHFFLLRRXXVVWWLLPPHH

    LLQQJJDDWWKKHHUULLQQJJNNQQRRZZOOHHGGJJHHSSUURRSSHHUUJJXXLLGGDDQQFFHHHHQQFFRRXXUUDDJJHHPPHHQQWWDDQQGGYYDDOOXXDDEEOOHHVVXXJJJJHHVVWWLLRRQQVV

    ,, WWDDNNHH WWKKHHSSUULLYYLLOOHHJJHHRRII FFRRQQYYHH\\LLQQJJRRXXUU KKHHDDUUWWLLHHVVWWJJUUDDWWLLWWXXGGHH WWRRDDOOOORRII WWKKHHVVHHZZKKRRGGLLUUHHFFWWOO\\RRUU LLQQ

    GGLLUUHHFFWWOO\\HHQQDDEEOOHHGGXXVVWWRRFFRRPPSSOOHHWWHHWWKKHHGGLLVVVVHHUUWWDDWWLLRRQQ

    //DDVVWWEEXXWWQQRRWWWWKKHHOOHHDDVVWWZZHHDDUUHHKKLLJJKKOO\\WWKKDDQQNNIIXXOOWWRRRRXXUUSSDDUUHHQQWWVVDDQQGGPP\\IIUULLHHQQGGVVIIRRUUWWKKHHUUHHHHYYHHUU

    ZZLLOOOOLLQQJJFFRRRRSSHHUUDDWWLLRRQQDDQQGGPPRRUUDDOOVVXXSSSSRRUUWW

    $$..66++,,$$552255$$

    &217(176

    y ,QWURGXFWLRQ$ERXW&RPSDQ\o 2EMHFWLYHVRIWKH&RPSDQ\

    y 3URGXFWDQG6HUYLFHV

  • 8/2/2019 Web Develpoment System

    5/51

    y &XVWRPL]HG6RIWZDUH'HYHORSPHQW

    y :HEVLWH'HVLJQ6ROXWLRQV

    o (&RPPHUFH6ROXWLRQV

    y 6HDUFK(QJLQH2SWLPL]DWLRQ

    y 'DWDEDVH'HVLJQDQG'HYHORSPHQW

    y &RQWHQW0DQDJHPHQW6ROXWLRQy 0LVVLRQ6WDWHPHQWV

    y SHUVRQQHORIWKH&RPSDQ\

    y :RUN([SHULHQFH

    o +70/

    o &66

    o 3+3

    o $'2%(3+2726+23

    o '%0V

    o 64/

    y ,QWURGXFWLRQ2EMHFWLYHVRI:HE'HYHORSPHQWy :HEGHYHORSPHQWDVDQLQGXVWU\

    y 7\SLFDO$UHDV

    y &OLHQW6LGH&RGLQJ

    o 6HUYHU6LGH&RGLQJ

    o &OLHQW6LGH6HUYHU6LGH

    o 'DWDEDVH7HFKQRORJ\

    y 3UDFWLFDO:HE'HYHORSPHQW

    o %DVLF

    o $GYDQFHGy 6HFXULW\&RQVLGHUDWLRQV

    y 15 Web Site Development Process

    y 16 Web Components

    o 16.1Client and Server Side Coding

    o 16.2 Domains Names, URLs and IP Addresso 16.3 Registrars

    y 17 Coding

    y 18Conclusion

  • 8/2/2019 Web Develpoment System

    6/51

  • 8/2/2019 Web Develpoment System

    7/51

    MANSA INFOTECH: M

    ansa Infotech is an offshore WebDevelopment and Web Solutions Company in India with client base all

    over the world. They provide versatile, high quality and cost effective

    services which include web hosting, Internet marketing, SEO Services,

    Search Engine Marketing, Software Development, E-Commerce

  • 8/2/2019 Web Develpoment System

    8/51

  • 8/2/2019 Web Develpoment System

    9/51

  • 8/2/2019 Web Develpoment System

    10/51

  • 8/2/2019 Web Develpoment System

    11/51

    Public sector organizations that monitor or control private sectoractivities have objectives that are to ensure that the business they are

    monitoring comply with the laws laid down.

    Health care and education establishments their objectives areto provide a service most private schools for instance have charitable

    status. Their aim is the enhancement of their pupils through education.

    Charities and voluntary organizations their aims and objectivesare led by the beliefs they stand for.

    Changing Objectives

    A business may change its objectives over time due to the following

    reasons:

    A business may achieve an objective and will need to move onto another

    one (e.g. survival in the first year may lead to an objective of increasing

    profit in the second year).

    The competitive environment might change, with the launch of new

    products from competitors.

    Technology might change product designs, so sales and productiontargets might need to change.

    Products and Services

    Mansa Infotech provides the following solutions:

    y Customized Software Development

  • 8/2/2019 Web Develpoment System

    12/51

  • 8/2/2019 Web Develpoment System

    13/51

  • 8/2/2019 Web Develpoment System

    14/51

    y ASP.NET:ASP.NET is a Web application framework developedand marketed by Microsoft to allow programmers to build dynamic

    Web sites, Web applications and Web services.

    y JAVA:Javais a general-purpose, concurrent, class-based, object-oriented language that is specifically designed to have as few

    implementation dependencies as possible. It is intended to let

    application developers "write once, run anywhere.

    E-Commerce Solutions

    This is our specialty. They are ecommerce experts. They

    understand how to build a website that sells. They can help designan end-to-end ecommerce solution from start to finish. They will

    help you:

    y Set up a merchant account and negotiate the best rate

    y Pick a domain name that sells

    y Design an ecommerce friendly website

    y Implement payment methods such as Visa/MC and PayPal

    y Integrate shopping cart functionality

    y Create a trusted web presence with a valid SSL certificateand risk prevention tools

    y Manage risk from fraud with industry leading fraudmanagement tools.

    Search Engine OptimizationHaving a great website is only half the battle; we still need

    qualified traffic to present our ideas to. MansaInfotech can deliver

    a traffic driving strategy for your business. They can:

    y Optimize your website for organic search

  • 8/2/2019 Web Develpoment System

    15/51

  • 8/2/2019 Web Develpoment System

    16/51

  • 8/2/2019 Web Develpoment System

    17/51

    most advanced information technologies, including computer systems,

    software, storage systems and microelectronics. We translate theseadvanced technologies into value for our customers through our

    professional solutions, services and consulting businesses worldwide.

    PERSONNEL OF COMPANY:

    Number of emplyees 70

    Education Level BCA,MCA,B-TECH,M-

    TECH,MBA-IT

    Dress FormalAge GROUP 21-45

    Behaviour Respectable,Moral,Ethical,Discourge

    Discrimination related to

    race,gender,color,religion,marital

    status etc.

    Groming Web/online e-learning

  • 8/2/2019 Web Develpoment System

    18/51

    During training, I learn following language:

    HTML: Hypertext Markup Language (HTML) is the predominantmarkup language for web pages. HTML elements are the basic building-

    blocks of webpages.

  • 8/2/2019 Web Develpoment System

    19/51

    HTML is written in the form of HTML elements consisting of tags,

    enclosed in angle brackets (like ), within the web page content.HTML tags most commonly come in pairs like and ,

    although some tags, known as empty elements, are unpaired, for

    example . The first tag in a pair is the starttag, the second tag isthe end tag (they are also called opening tags and closing tags). In

    between these tags web designers can add text, tags, comments, and

    other types of text-based content.

    The purpose of a web browser is to read HTML documents and compose

    them into visible or audible web pages. The browser does not display the

    HTML tags, but uses the tags to interpret the content of the page.

    HTML elements form the building blocks of all websites. HTML allows

    images and objects to be embedded and can be used to create interactiveforms. It provides a means to create structured documents by denoting

    structural semantics for text such as headings, paragraphs, lists, links,

    quotes and other items. It can embed scripts in languages such as

    JavaScript which affect the behavior of HTML webpages.

    Web browsers can also refer to Cascading Style Sheets (CSS) to define

    the appearance and layout of text and other material.

    CSS:Cascading Style Sheets (CSS) is a style sheet language used todescribe the presentation semantics (the look and formatting) of a

    document written in a markup language. Its most common application isto style web pages written in HTML and XHTML, but the language can

    also be applied to any kind of XML document, including plain XML,

    SVG and XUL.

    CSS is designed primarily to enable the separation of document content(written in HTML or a similar markup language) from document

    presentation, including elements such as the layout, colors, and fonts.

    This separation can improve content accessibility, provide more

    flexibility and control in the specification of presentation characteristics,

    enable multiple pages to share formatting, and reduce complexity and

  • 8/2/2019 Web Develpoment System

    20/51

  • 8/2/2019 Web Develpoment System

    21/51

  • 8/2/2019 Web Develpoment System

    22/51

    servers, many operating systems and platforms, and can be used with

    many relational database management systems (RDBMS). It isavailablefree of charge, and the PHP Group provides the complete source code

    for users to build, customize and extend for their own use.

    SYNTAX

    The PHP interpreter only executes PHP code within its delimiters.

    Anything outside its delimiters is not processed by PHP (although non-

    PHP text is still subject to control structures described within PHP

    code). The most common delimiters are to close

    PHP sections.

    ADOBE PHOTOSHOP: Adobe Photoshop is a graphics editingprogram developed and published by Adobe Systems Incorporated.

    Adobe's 2003 "Creative Suite" rebranding led to Adobe Photoshop 8'srenaming to Adobe Photoshop CS. Thus, Adobe Photoshop CS5 is the

    12th major release of Adobe Photoshop. The CS rebranding also resulted

    in Adobe offering numerous software packages containing multiple

    Adobe programs for a reduced price. Adobe Photoshop is released in

    two editions: AdobePhotoshop, and Adobe PhotoshopExtended, withthe Extended having extra 3D image creation, motion graphics editing,

    and advanced image analysis features Adobe Photoshop Extended is

    included in all of Adobe's Creative Suite offerings except Design

    Standard, which includes the Adobe Photoshop edition.

    Alongside Photoshop and Photoshop Extended, Adobe also publishesPhotoshop Elements and Photoshop Lightroom, collectively called "The

    Adobe Photoshop Family". In 2008, Adobe released Adobe Photoshop

    Express, a free web-based image editing tool to edit photos directly onblogs and social networking sites; in 2011 a version was released for the

    Android operating system and the iPhone.

    DBMS: A database management system (DBMS) is a softwarepackage with computer programs that control the creation, maintenance,

  • 8/2/2019 Web Develpoment System

    23/51

  • 8/2/2019 Web Develpoment System

    24/51

  • 8/2/2019 Web Develpoment System

    25/51

  • 8/2/2019 Web Develpoment System

    26/51

  • 8/2/2019 Web Develpoment System

    27/51

  • 8/2/2019 Web Develpoment System

    28/51

    INTRODUCTION:Web developmentis a broad term for the work involved in developing a

    web site for the Internet (World Wide Web) or an intranet (a private

    network). This can include web design, web content development, client

    liaison, client-side/server-side scripting, web server and network security

    configuration, and e-commerce development. However, among web

    professionals, "web development" usually refers to the main non-design

    aspects of building web sites: writing markup and coding. Web

    development can range from developing the simplest static single page

    of plain text to the most complex web-based internet applications,

    electronic businesses, or social network services.

    For larger organizations and businesses, web development teams can

    consist of hundreds of people (web developers). Smaller organizations

    may only require a single permanent or contracting webmaster, or

    secondary assignment to related job positions such as a graphic designer

    and/or information systems technician. Web development may be a

    collaborative effort between departments rather than the domain of a

    designated department.

    Objective and Scope

    Web developmentis the process of designing websites a collection of

    online content including documents and applications that reside on a

    web server/servers.

    As a whole, the process of web development includes planning, post-production, research, advertising, as well as media control that is applied

    to the pages within the site by the designer or group of designers with a

    specific purpose. The site itself can be divided into its main page, also

  • 8/2/2019 Web Develpoment System

    29/51

    known as the home page, which cites the main objective as well as

    highlights of the site's daily updates; which also contains hyperlinks thatfunctions to direct viewers to a designated page within the site's domain.

    Web development as an industry

    Since the mid-1990s, web development has been one of the fastest

    growing industries in the world. In 1995 there were fewer than 1,000web development companies in the United States, but by 2005 there

    were over 30,000 such companies in the U.S. alone. The growth of this

    industry is being pushed by large businesses wishing to sell products and

    services to their customers and to automate business workflow.

    In addition, cost of Web site development and hosting has droppeddramatically during this time. Instead of costing ten thousands of dollars,

    as was the case for early websites, one can now develop a simple website for free using one of the many free website builders such as Google

    Sites etc., depending on the complexity and amount of content. SmallerWeb site development companies are now able to make web design

    accessible to both smaller companies and individuals further fueling the

    growth of the web development industry. As far as web development

    tools and platforms are concerned, there are many systems available tothe public free of charge to aid in development. A popular example is

    the LAMP (LINUX,MYSQ,PHP) stack, which is usually distributed free

    of charge. This fact alone has manifested into many people around the

    globe setting up new Web sites daily and thus contributing to increase in

    web development popularity. Another contributing factor has been therise of easy to use WYSIWYG web development software, most

    prominently Adobe Dreamweaver, Netbeans, WebDev, orMicrosoft

    Expression Studio, Adobe Flex. Using such software, virtually anyonecan develop a Web page in a matter of minutes. Knowledge of Hyper

    Text Markup Language (HTML), or other programming languages is not

    required, but recommended for professional results.

    The next generation of web development tools uses the strong growth in

    LAMP, Java Platform Enterprise Edition technologies and Microsoft

  • 8/2/2019 Web Develpoment System

    30/51

    .NET technologies to provide the Web as a way to run applications

    online. Web developers now help to deliver applications as Web serviceswhich were traditionally only available as applications on a desk based

    computer.

    Instead of running executable code on a local computer, users are

    interacting with online applications to create new content. This has

    created new methods in communication and allowed for many

    opportunities to decentralize information and media distribution. Users

    are now able to interact with applications from many locations, instead

    of being tied to a specific workstation for their application environment.

    Examples of dramatic transformation in communication and commerce

    led by web development include e-commerce. Online auction sites such

    as eBay have changed the way consumers consume and purchase goodsand services. Online resellers such as Amazon.com and Buy.com

    (among many, many others) have transformed the shopping and bargain

    hunting experience for many consumers. Another good example of

    transformative communication led by web development is the blogWeb

    applications such as WordPress and Movable Type have created easily

    implemented blog environments for individual Web sites. Open source

    content management systems such as Joomla!, Drupal, XOOPS, andTYPO3 and enterprise content management systems such as Alfresco

    have extended web development into new modes of interaction andcommunication.

    In addition, web development has moved to a new phase of Internet

    communication. Computer web sites are no longer simply tools for work

    or commerce but used most for communication. Websites such asFacebook and Twitter provide users a platform to freely communicate.

    This new form of web communication is also changing e-commerce

    through the number of hits and online advertisement.

  • 8/2/2019 Web Develpoment System

    31/51

    Typical Areas

    Web Development can be split into many areas and a typical and basic

    web development hierarchy might consist of:

    Client Side Coding

    y Ajax Asynchronous JavaScript provides new methods of using

    JavaScript, and other languages to improve the user experience.

    y Flash Adobe Flash Player is an ubiquitous browser plugin ready for

    RIAs. Flex 2 is also deployed to the Flash Player (version 9+).

    y JavaScript Formally called ECMAScript, JavaScript is a ubiquitous

    client side platform for creating and delivering rich Web applicationsthat can also run across a wide variety of devices.

    y JQuery Cross-browser JavaScript library designed to simplify and

    speed up the client-side scripting of HTML.

    y Microsoft Silverligt Microsoft's browser plugin that enables

    animation, vector graphics and high-definition video playback,

    programmed using XAML and .NET programming languages.

    y Real Studio Web Edition is a rapid application development

    environment for the web. The language is object oriented and issimilar to both VB and Java. Applications are uniquely compiled to

    binary code.

    y HTML5 and CSS3 Latest HTML proposed standard combined withthe latest proposed standard for CSS natively supports much of the

    client-side functionality provided by other frameworks such as Flash

    and Silverlight

    Looking at these items from an "umbrella approach", client side coding

    such as XHTML is executed and stored on a local client (in a web browser) whereas server side code is not available to a client and is

    executed on a web server which generates the appropriate XHTML

    which is then sent to the client. The nature of client side coding allows

    you to alter the HTML on a local client and refresh the pages with

    updated content (locally), web designers must bear in mind the

  • 8/2/2019 Web Develpoment System

    32/51

  • 8/2/2019 Web Develpoment System

    33/51

    characteristics that demand special considerations. In recent years of

    web development there have been some developments towardsaddressing these problems and requirements. As an emerging discipline,

    web engineering actively promotes systematic, disciplined and

    quantifiable approaches towards successful development of high-quality,ubiquitously usable web-based systems and applications.(3)(4) In

    particular, web engineering focuses on the methodologies, techniques

    and tools that are the foundation of web application development and

    which support their design, development, evolution, and evaluation.

    Web application development has certain characteristics that make it

    different from traditional software, information system, or computer

    application development.

    Web engineering is multidisciplinary and encompasses contributions

    from diverse areas: systems analysis and design, software engineering,

    hypermedia/hypertext engineering, requirements engineering, human-computer interaction, user interface, information engineering,

    information indexing and retrieval, testing, modeling and simulation,

    project management, and graphic design and presentation. Webengineering is neither a clone, nor a subset of software engineering,

    although both involve programming and software development. While

    web engineering uses software engineering principles, web developmentencompasses new approaches, methodologies, tools, techniques, and

    guidelines to meet the unique requirements for web-based applications.

    Client Side + Server Side

    y Google Web Toolkit provides tools to create and maintain complex

    JavaScript front-end applications in Java.

    y Opa is a high-level language in which both the client and the server

    parts are implemented. The compiler then decides which parts run on

    the client (and are translated automatically to JavaScript) and which

    parts run on the server. The developer can tune those decisions with

    simple directives. (open source)

  • 8/2/2019 Web Develpoment System

    34/51

    Pyjamas is a tool and framework for developing Ajax applications

    and Rich Internet Applications in python.

    y Tersus is a platform for the development of rich web applications by

    visually defining user interface, client side behavior and server sideprocessing. (open source)

    However languages like Ruby and Python are often paired with database

    servers other than MySQL (the M in LAMP). Below are example of

    other databases currently in wide use on the web. For instance some

    developers prefer a LAPR(Linux/Apache/PostgreSQL/Ruby on Rails)

    setup for development.

    Database Technology

    y Apache Derby

    y DB2 (IBM proprietary)

    y Firebird

    y Microsoft SQL Server

    y MySQL

    y Oracle

    y PostgreSQLy SQLite

    y Sybase

    Practical Web Development

    Basic

    In practice, many web developers will have basic interdisciplinary skills/ roles, including:

    y Graphic design / web design

    y Information architecture and copywriting/copyediting with web

    usability, accessibility and search engine optimization in mind

  • 8/2/2019 Web Develpoment System

    35/51

    The above list is a simple website development hierarchy and can be

    extended to include all client side and server side aspects. It is stillimportant to remember that web development is generally split up into

    client side coding, covering aspects such as the layout and design, and

    server side coding, which covers the website's functionality and backend systems.

    Advanced

    Some more advanced web developers will also have these

    interdisciplinary skills / roles:

    y GUI (Graphic User Interface) design

    y Audio, Video and Animation processing & encoding (for web usage)y Flash Capabilities (animation, audio, video, scripting)

    y Web content management system Deployment and/or Content

    management infrastructure design, development and integration

    y Web applications development, integration and deployment

    y Web server stress testing (how much traffic can a web server running

    a specific application endure before collapsing)

    y Web site security analysis & testing

    y Web site code optimization (which is an important aspect of searchengine optimization)

    y Project management, QA and other aspects common to IT

    development

    Security Considerations

    Web development takes into account many security considerations, such

    as data entry error checking through forms, filtering output, andencryption.[2]

    Malicious practices such as SQL injection can be executed

    by users with ill intent yet with only primitive knowledge of web

    development as a whole. Scripts can be exploited to grant unauthorized

    access to malicious users trying to collect information such as emailaddresses, passwords and protected content like credit card numbers.

  • 8/2/2019 Web Develpoment System

    36/51

  • 8/2/2019 Web Develpoment System

    37/51

    Web Site Development Process-The life-cycle

    steps

    Like the traditional software development, the process of web site

    development can also be divided into different life cycle steps. This can

    help to format the team effectively, and the standards and procedures

    can be adopted to achieve maximum quality. This article explains the

    steps of development which can be possibly arranged as a process of

    web engineering. This is just a guideline to help you, to know, how a

    process can be done. The steps may vary from application to application.

    A system development process can follow a number of standard or

    company specific frameworks, methodologies, modeling tools and

    languages. Software development life cycle normally comes with some

    standards which can fulfill the needs of any development team. Likesoftware, web sites can also be developed with certain methods with

  • 8/2/2019 Web Develpoment System

    38/51

    some changes and additions with the existing software development

    process. Let us see the steps involve in any web site development.

    1. Analysis:

    Once a customer is started discussing his requirements, the team gets

    into it, towards the preliminary requirement analysis. As the web site is

    going to be a part of a system, It needs a complete analysis as, how theweb site or the web based application is going to help the present system

    and how the site is going to help the business. Moreover the analysis

    should cover all the aspects especially on how the web site is going tojoin the existing system. The first important thing is finding the targeted

    audience. Then, All the present hardware, software, people and data

    should be considered during the time of analysis. For example, if acompany XYZ corp is in need of a web site to have its human resource

    details online, the analysis team may try to utilize the existing data about

    the employees from the present database. The analysis should be done in

    the way, that it may not be too time consuming or with very less

    informative. The team should be able to come up with the complete cost-

    benefit analysis and as the plan for the project will be an output ofanalysis, it should be realistic. To achieve this the analyst should consult

    the designers, developers and testers to come up with a realistic plan.

    2.Specification Building:

    Preliminary specifications are drawn up by covering up each and everyelement of the requirement. For example if the product is a web site then

    the modules of the site including general layout, site navigation and

    dynamic parts of the site should be included in the spec. Larger projectswill require further levels of consultation to assess additional business

    and technical requirements. After reviewing and approving the preliminary document, a written proposal is prepared, outlining thescope of the project including responsibilities, timelines and costs.

  • 8/2/2019 Web Develpoment System

    39/51

  • 8/2/2019 Web Develpoment System

    40/51

  • 8/2/2019 Web Develpoment System

    41/51

    7.Promotion:

    This phase is applicable only for web sites. Promotion needs preparation

    of meta tags, constant analysis and submitting the URL to the search

    engines and directories. There is a details article in this site on site

    promotion. The site promotion is normally an ongoing process as the

    strategies of search engine may change quite often. Submitting a siteURLs once in 2 months can be an ideal submission policy. If the

    customer is willing, then paid click and paid submissions can also be

    done with additional cost.

    8. Maintenance and Updating:

    Web sites will need quite frequent updations to keep them very fresh. In

    that case we need to do analysis again, and all the other life cycle steps

    will repeat. Bug fixes can be done during the time of maintenance. Once

    your web site is operational, ongoing promotion, technical maintenance,

    content management & updating, site visit activity reports, staff training

    and mentoring is needed on a regular basis depend on the complexity of

    your web site and the needs within your organization.

    Mentoring is needed on a regular basis depend on the complexity ofyour web site and the needs within your organization.

  • 8/2/2019 Web Develpoment System

    42/51

    y Clients and Servers Side Coding

    y Domains Names ,URLs and IP Address

    y Registrars

    Client & Server Side Coding

    y Web Development comprises of server-side coding & client-

    coding

    Client-Side Coding

    Server-Side Coding

    CSS PHP

    HTML

    Domains URLS and IPs

    y Domain name: The specific address of a computer on the internet.

    y Uniform Resource Locator (URL):

    http://www.microsoft.com

    y Internet Protocol (IP) Address:

    192.168.1.1

  • 8/2/2019 Web Develpoment System

    43/51

    Domain Register

    y A company that provides domain name registration services for a

    free.y Maintain database which maps domain names to IPs.

    y Propagate new domain name/IP address information across the

    internet.

    Creating A Web Site

    y Choose a domain name

    y Register with a registrar

    y Choose a hosting service

    y Tell Registrar the IP address

    y Create Web Content

    y Submit new site to search engine

    Creating your Web SiteTechnologies & Tools

    Markup Languages

    o HTML, DHTML etc

    Cascading Style Sheets(CSS)

    Scripting Language

    o PHP, JAVASCRIPT etc..

    Web Creation And Editing Software

    oNotepad, Adobe Dreamweaver etc.

  • 8/2/2019 Web Develpoment System

    44/51

  • 8/2/2019 Web Develpoment System

    45/51

    HTML-Fundamental

    Basic Structure

    The title of your html page

    HTML FundamentalsHeadings.

    Heading 1 level text

    Heading 2 level text

    Heading 3 level text

    Heading 4 level text

    Heading 5 level textHeading 6 level text

  • 8/2/2019 Web Develpoment System

    46/51

    HTML FundamentalLists

    Unordered List

    apples

    bananas

    grapes

    Ordered List

    apples

    bananas

    grapes

    HTML FundamentalLists

    Unordered List

    apples

    bananas

    grapes

    Ordered List

    i. apples

    ii. bananas

    iii. grapes

  • 8/2/2019 Web Develpoment System

    47/51

    HTML FundamentalTables

    Student

    Grade

    Tom

    B+

    Sue

    A-

    HTML FundamentalTables

    Student Grade

    Tom B+

    Sue A-

  • 8/2/2019 Web Develpoment System

    48/51

  • 8/2/2019 Web Develpoment System

    49/51

    HTML FundamentalCASCADING STYLE SHEETS (CSS)

    Styles enable you to define a consistent 'look' for

    your documents by describing once how

    headings, paragraphs, quotes, etc. should be

    displayed.

    Style sheet syntax is made up of three parts:

    selector {property: value}

    selector = element.class

  • 8/2/2019 Web Develpoment System

    50/51

    A Small Sample Code Of PHP

    PHP test

    OUTPUT

    Here the Output is:

    Hello World

  • 8/2/2019 Web Develpoment System

    51/51

    ConclusionThe process described on these pages is a basic way of determining what

    is called the "Information Architecture" of your web site. Information

    Architecture is a standard practice across almost any technology

    development effort, particularly web development. A good Information

    Architecture is what separates a well designed site from one that is

    thrown together without much thought about how the site will be used.

    Once this process has been completed, you should have a good idea

    about your site's content and functional requirements. If you are going to

    build your own site, this will help you break down what you will need to

    learn. If you are going to hire a developer, this will help them determineexactly what you want and how to build it. This process should also give

    you an idea of the technical requirements of your site, and help you

    determine which hosting plans are available that will meet your needs.

    Any good developer will go through a similar process when they start a

    web development project.


Recommended